Protein Family IF02915

Metagenome Isolate
165 Members
71 Samples
144 Scaffolds
207.48 Avg Length

🧬 Representative Sequence

ID
3300010049|Ga0123356_10444375|Ga0123356_104443751
Length
235 aa
Sequence
LIFESIVSFITFVSYKLTNIFLTDMDNDVNMLKFYFPGMTDEQSQQFDALGDSYASWNAMINVISRKDIDNLYERHVLHSLGIARFIRFTAGTRIMDAGTGGGFPGIPLAILLPEVAFHLVDSVGKKIKVAQSVADVLGLKNVTTRHCRIEDEKNAFDFVVSRAVMTLPELAKLVRKNIAKTQHNALPNGLICLKGGNVNKETTPFGKNVIVADLSEYFAEPYFETKKIIYVPL*

πŸ“Š Sample Types

Isolate 12.7%
Metagenome 87.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 29.6%
Kalotermitidae 19.7%
Unclassified 9.9%
Elmidae 9.9%
Culicidae 5.6%
Rhinotermitidae 5.6%
Termopsidae 5.6%
Passalidae 2.8%
Blattidae 2.8%
Formicidae 2.8%
Hodotermitidae 1.4%
Apidae 1.4%
Cambaridae 1.4%
Daphniidae 1.4%

🌳 Taxonomy

Archaea 1
Bacteria 160
Eukaryota 0
Viruses 0
Unclassified 4

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 8114076984 Elizabethkingia anophelis R26 Isolate Culicidae
2 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
3 2864788197 Elizabethkingia anophelis S00027 Isolate Elmidae
4 2864822740 Chryseobacterium shigense S00064 Isolate Elmidae
5 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
6 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
7 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
8 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
9 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
10 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
11 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
12 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
13 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
14 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
15 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
16 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
17 2529292732 Elizabethkingia anophelis R26 Isolate Culicidae
18 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
19 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
20 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
21 2864831662 Chryseobacterium sediminis S00068 Isolate Elmidae
22 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
23 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
24 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
25 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
26 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
27 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
28 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
29 8020009074 Elizabethkingia anophelis MSU001 Isolate Culicidae
30 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
31 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
32 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
33 2921902974 Chryseobacterium sp. cx-624 Isolate Cambaridae
34 3004677695 Bacteroides sp. 214 Isolate Blattidae
35 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
36 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
37 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
38 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
39 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
40 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
41 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
42 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
43 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
44 2864923010 Elizabethkingia anophelis S00177 Isolate Elmidae
45 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
46 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
47 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
48 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
49 2687453786 Chryseobacterium culicis DSM 23031 Isolate Unclassified
50 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
51 2847090942 Elizabethkingia anophelis Ag1 Isolate Culicidae
52 2864882932 Chryseobacterium shingense S00136 Isolate Elmidae
53 2864891731 Chryseobacterium defluvii S00151 Isolate Elmidae
54 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
55 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
56 643348524 Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 Isolate Unclassified
57 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
58 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
59 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
60 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
61 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
62 2590828803 Pedobacter glucosidilyticus DD6b Isolate Daphniidae
63 2864948220 Elizabethkingia anophelis S00205 Isolate Elmidae
64 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
65 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
66 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
67 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
68 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
69 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
70 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
71 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466706_255935 3300042599 Bacteria 48242
2 Ga0466707_161031 3300042601 Bacteria 6072
3 Ga0466713_005558 3300042602 Bacteria 10134
4 Ga0466716_527920 3300042605 Bacteria 23216
5 Ga0466722_223624 3300042609 Bacteria 4492
6 Ga0466709_179340 3300042648 Bacteria 4079
7 Ga0466725_030716 3300042654 Bacteria 28756
8 Ga0466727_331077 3300042655 Bacteria 2521
9 Ga0466715_121550 3300042616 Bacteria 13380
10 Ga0466726_034260 3300042619 Bacteria 7148
11 Ga0123357_10335039 3300009784 Bacteria 1472
12 Ga0123354_10009800 3300010882 Bacteria 14720
13 Ga0466657_070511 3300042582 Bacteria 1163
14 Ga0466657_091532 3300042582 Bacteria 1218
15 Ga0466691_051621 3300042593 Bacteria 8516
16 Ga0466706_093080 3300042599 Bacteria 1402
17 Ga0466713_032013 3300042602 Bacteria 64924
18 Ga0466716_016748 3300042605 Bacteria 11880
19 Ga0466716_065108 3300042605 Bacteria 6086
20 Ga0466735_046855 3300042624 Bacteria 10270
21 Ga0466735_108707 3300042624 Bacteria 3424
22 Ga0466730_079418 3300042625 Bacteria 679131
23 Ga0466703_053508 3300042636 Bacteria 8515
24 Ga0466703_378322 3300042636 Bacteria 3355
25 Ga0466704_566564 3300042643 Bacteria 3062
26 Ga0466727_121354 3300042655 Bacteria 12082
27 Ga0466727_174137 3300042655 Bacteria 3924
28 Ga0466715_051231 3300042616 Bacteria 18964
29 Ga0466726_178537 3300042619 Bacteria 6018
30 Ga0123354_10000656 3300010882 Bacteria 36511
31 Ga0466692_184435 3300042591 Bacteria 106081
32 IMNBL1DRAFT_c0012241 3300000062 Bacteria 3939
33 IMNBL1DRAFT_c0041516 3300000062 Bacteria 1543
34 JGI24696J40584_12955165 3300002834 Bacteria 2778
35 Ga0466705_381005 3300042612 Bacteria 5443
36 Ga0466701_047597 3300042598 Bacteria 1845
37 Ga0466706_084658 3300042599 Bacteria 6301
38 Ga0466707_092068 3300042601 Bacteria 7028
39 Ga0466716_165629 3300042605 Bacteria 14714
40 Ga0466719_397365 3300042606 Bacteria 7417
41 Ga0466722_188856 3300042609 Bacteria 3886
42 Ga0466722_226889 3300042609 Bacteria 6161
43 Ga0466730_046120 3300042625 Bacteria 1166
44 Ga0466703_058308 3300042636 Bacteria 6245
45 Ga0466703_222891 3300042636 Bacteria 9444
46 Ga0466703_233292 3300042636 Bacteria 1451
47 Ga0466709_176307 3300042648 Bacteria 46103
48 Ga0466710_228693 3300042613 Bacteria 1467
49 Ga0466729_140456 3300042621 Bacteria 1903
50 Ga0123357_10004340 3300009784 Bacteria 16620
51 Ga0123357_10472794 3300009784 Bacteria 1066
52 Ga0123356_10444375 3300010049 Bacteria 1444
53 Ga0123353_10504804 3300010167 Bacteria 1761
54 Ga0123353_10557465 3300010167 Bacteria 1651
55 Ga0123354_10018506 3300010882 Bacteria 10922
56 Ga0123354_10153021 3300010882 Bacteria 2783
57 Ga0466690_244468 3300042590 Bacteria 30908
58 Ga0466693_287481 3300042592 Bacteria 2847
59 Ga0466696_224220 3300042596 Bacteria 4604
60 Ga0466701_008116 3300042598 Bacteria 139371
61 JGI24702J35022_10005414 3300002462 Bacteria 7470
62 JGI24705J35276_12229772 3300002504 Bacteria 3462
63 Ga0068302_10057170 3300005071 Unclassified 1078
64 Ga0466701_096297 3300042598 Bacteria 103722
65 Ga0466700_479075 3300042600 Bacteria 5522
66 Ga0466722_073972 3300042609 Bacteria 128406
67 Ga0466704_009030 3300042643 Bacteria 11297
68 Ga0466709_062466 3300042648 Bacteria 7409
69 Ga0466709_318574 3300042648 Bacteria 87877
70 Ga0466712_278001 3300042614 Bacteria 1095
71 Ga0466723_235111 3300042618 Bacteria 13674
72 Ga0123357_10124570 3300009784 Bacteria 3233
73 Ga0123357_10472796 3300009784 Unclassified 1066
74 Ga0123356_10014708 3300010049 Bacteria 7519
75 Ga0123353_10474342 3300010167 Bacteria 1833
76 Ga0123353_10930300 3300010167 Bacteria 1179
77 Ga0466690_023696 3300042590 Bacteria 23811
78 Ga0466692_079572 3300042591 Bacteria 5576
79 Ga0466693_305320 3300042592 Bacteria 1404
80 JGI24699J35502_11133587 3300002509 Bacteria 12286
81 Ga0466733_083305 3300042659 Bacteria 99179
82 Ga0466713_056740 3300042602 Bacteria 3831
83 Ga0466735_047968 3300042624 Bacteria 5356
84 Ga0466735_056052 3300042624 Bacteria 1347
85 Ga0466735_106716 3300042624 Archaea 1751
86 Ga0466704_244636 3300042643 Bacteria 19020
87 Ga0466727_278287 3300042655 Bacteria 4905
88 Ga0466710_076999 3300042613 Bacteria 1628
89 Ga0466726_084517 3300042619 Bacteria 4963
90 Ga0123357_10554571 3300009784 Bacteria 914
91 Ga0123354_10464017 3300010882 Bacteria 1015
92 Ga0466696_084405 3300042596 Bacteria 2291
93 IMNBL1DRAFT_c0000013 3300000062 Bacteria 180832
94 Ga0466732_000584 3300042656 Bacteria 1452
95 Ga0466707_059518 3300042601 Bacteria 3718
96 Ga0466713_080540 3300042602 Unclassified 59038
97 Ga0466719_495834 3300042606 Bacteria 4736
98 Ga0466729_273444 3300042621 Bacteria 8969
99 Ga0466735_105036 3300042624 Bacteria 13392
100 Ga0466704_237703 3300042643 Bacteria 2897
101 Ga0466708_172342 3300042652 Bacteria 21087
102 Ga0466727_008661 3300042655 Bacteria 5716
103 Ga0466711_143612 3300042615 Bacteria 3938
104 Ga0466711_464373 3300042615 Bacteria 18405
105 Ga0466715_291973 3300042616 Bacteria 6082
106 Ga0466690_008835 3300042590 Bacteria 27085
107 Ga0466692_137108 3300042591 Bacteria 7772
108 Ga0466696_342708 3300042596 Bacteria 6300
109 HBC_ctgsDRAFT_1000006 3300000333 Bacteria 61367
110 Ga0466697_241565 3300042611 Bacteria 1315
111 Ga0466700_106489 3300042600 Bacteria 2244
112 Ga0466713_010652 3300042602 Bacteria 41319
113 Ga0466716_541528 3300042605 Bacteria 12605
114 Ga0466704_115958 3300042643 Bacteria 4356
115 Ga0466715_122804 3300042616 Bacteria 8013
116 Ga0466715_501308 3300042616 Bacteria 12254
117 Ga0466729_014216 3300042621 Unclassified 7638
118 Ga0123357_10153004 3300009784 Bacteria 2792
119 Ga0123354_10015146 3300010882 Bacteria 12027
120 Ga0466701_000974 3300042598 Bacteria 6469
121 2227130795 2225789004 Bacteria 8982
122 IMNBL1DRAFT_c0004210 3300000062 Bacteria 8739
123 Ga0103264_1000008 3300007188 Bacteria 140843
124 Ga0123357_10000367 3300009784 Bacteria 42582
125 Ga0466697_171347 3300042611 Bacteria 1106
126 Ga0466705_157917 3300042612 Bacteria 7944
127 Ga0466701_021952 3300042598 Bacteria 1791
128 Ga0466701_035971 3300042598 Bacteria 18774
129 Ga0466707_040792 3300042601 Bacteria 43826
130 Ga0466729_230338 3300042621 Bacteria 4287
131 Ga0466735_076366 3300042624 Bacteria 3348
132 Ga0466735_077776 3300042624 Bacteria 9115
133 Ga0466724_69524 3300042649 Bacteria 891007
134 Ga0466725_109433 3300042654 Bacteria 1358
135 Ga0466726_231187 3300042619 Bacteria 1519
136 Ga0466726_357022 3300042619 Bacteria 1452
137 Ga0466728_051221 3300042620 Bacteria 8656
138 Ga0123354_10016391 3300010882 Bacteria 11613
139 Ga0466656_237763 3300042550 Bacteria 1795
140 Ga0466690_276484 3300042590 Bacteria 44393
141 Ga0466692_151520 3300042591 Bacteria 33800
142 Ga0466696_093250 3300042596 Bacteria 8978
143 JGI24702J35022_10000094 3300002462 Bacteria 40308
144 Ga0102734_1000253 3300007129 Bacteria 16663

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 2820762746 2820763088 185
2 3300002509 JGI24699J35502_11133587 JGI24699J35502_1113358716 186
3 3300042655 Ga0466727_121354 Ga0466727_121354_50_616 188
4 3300042611 Ga0466697_241565 Ga0466697_241565_455_1075 194
5 3300042625 Ga0466730_079418 Ga0466730_079418_603832_604467 199
6 3300042590 Ga0466690_244468 Ga0466690_244468_23933_24547 204
7 3300042598 Ga0466701_000974 Ga0466701_000974_3495_4109 204
8 3300005071 Ga0068302_10057170 Ga0068302_100571701 205
9 3300042596 Ga0466696_093250 Ga0466696_093250_7314_7931 205
10 3300042605 Ga0466716_016748 Ga0466716_016748_822_1439 205
11 3300042614 Ga0466712_278001 Ga0466712_278001_428_1045 205
12 3300042619 Ga0466726_084517 Ga0466726_084517_1001_1618 205
13 3300042619 Ga0466726_178537 Ga0466726_178537_5001_5618 205
14 3300042619 Ga0466726_357022 Ga0466726_357022_491_1108 205
15 3300042636 Ga0466703_378322 Ga0466703_378322_744_1361 205
16 3300042643 Ga0466704_009030 Ga0466704_009030_6321_6938 205
17 3300010049 Ga0123356_10014708 Ga0123356_100147085 206
18 3300010167 Ga0123353_10557465 Ga0123353_105574653 206
19 3300010167 Ga0123353_10930300 Ga0123353_109303001 206
20 3300042582 Ga0466657_070511 Ga0466657_070511_508_1128 206
21 3300042590 Ga0466690_008835 Ga0466690_008835_23593_24213 206
22 3300042590 Ga0466690_276484 Ga0466690_276484_33089_33709 206
23 3300042596 Ga0466696_342708 Ga0466696_342708_4721_5341 206
24 3300042598 Ga0466701_035971 Ga0466701_035971_15977_16597 206
25 3300042598 Ga0466701_047597 Ga0466701_047597_1061_1681 206
26 3300042599 Ga0466706_084658 Ga0466706_084658_175_795 206
27 3300042599 Ga0466706_255935 Ga0466706_255935_21922_22542 206
28 3300042600 Ga0466700_479075 Ga0466700_479075_1604_2224 206
29 3300042601 Ga0466707_059518 Ga0466707_059518_877_1497 206
30 3300042601 Ga0466707_161031 Ga0466707_161031_420_1040 206
31 3300042602 Ga0466713_010652 Ga0466713_010652_39444_40064 206
32 3300042602 Ga0466713_032013 Ga0466713_032013_57748_58368 206
33 3300042602 Ga0466713_080540 Ga0466713_080540_24024_24644 206
34 3300042605 Ga0466716_541528 Ga0466716_541528_2414_3034 206
35 3300042606 Ga0466719_397365 Ga0466719_397365_4513_5133 206
36 3300042609 Ga0466722_188856 Ga0466722_188856_1138_1758 206
37 3300042609 Ga0466722_223624 Ga0466722_223624_963_1583 206
38 3300042611 Ga0466697_171347 Ga0466697_171347_25_645 206
39 3300042612 Ga0466705_381005 Ga0466705_381005_3680_4300 206
40 3300042613 Ga0466710_076999 Ga0466710_076999_271_891 206
41 3300042615 Ga0466711_143612 Ga0466711_143612_1196_1816 206
42 3300042615 Ga0466711_464373 Ga0466711_464373_7209_7829 206
43 3300042616 Ga0466715_051231 Ga0466715_051231_6382_7002 206
44 3300042616 Ga0466715_121550 Ga0466715_121550_9005_9625 206
45 3300042616 Ga0466715_291973 Ga0466715_291973_2223_2843 206
46 3300042618 Ga0466723_235111 Ga0466723_235111_7733_8353 206
47 3300042619 Ga0466726_034260 Ga0466726_034260_1860_2480 206
48 3300042621 Ga0466729_014216 Ga0466729_014216_6019_6639 206
49 3300042621 Ga0466729_140456 Ga0466729_140456_250_870 206
50 3300042621 Ga0466729_230338 Ga0466729_230338_1925_2545 206
51 3300042624 Ga0466735_047968 Ga0466735_047968_3939_4559 206
52 3300042624 Ga0466735_056052 Ga0466735_056052_19_639 206
53 3300042624 Ga0466735_076366 Ga0466735_076366_663_1283 206
54 3300042624 Ga0466735_077776 Ga0466735_077776_7895_8515 206
55 3300042624 Ga0466735_106716 Ga0466735_106716_648_1268 206
56 3300042624 Ga0466735_108707 Ga0466735_108707_1758_2378 206
57 3300042625 Ga0466730_046120 Ga0466730_046120_421_1041 206
58 3300042636 Ga0466703_053508 Ga0466703_053508_4349_4969 206
59 3300042636 Ga0466703_058308 Ga0466703_058308_3471_4091 206
60 3300042636 Ga0466703_222891 Ga0466703_222891_5303_5923 206
61 3300042643 Ga0466704_237703 Ga0466704_237703_1353_1973 206
62 3300042643 Ga0466704_244636 Ga0466704_244636_10361_10981 206
63 3300042643 Ga0466704_566564 Ga0466704_566564_398_1018 206
64 3300042648 Ga0466709_176307 Ga0466709_176307_31740_32360 206
65 3300042648 Ga0466709_179340 Ga0466709_179340_260_880 206
66 3300042648 Ga0466709_318574 Ga0466709_318574_34990_35610 206
67 3300042652 Ga0466708_172342 Ga0466708_172342_16530_17150 206
68 3300042654 Ga0466725_109433 Ga0466725_109433_473_1093 206
69 3300042655 Ga0466727_278287 Ga0466727_278287_2889_3509 206
70 3300042656 Ga0466732_000584 Ga0466732_000584_406_1026 206
71 3300042659 Ga0466733_083305 Ga0466733_083305_29101_29721 206
72 iso_pr_bacteria 2820778767 2820780354 206
73 iso_pr_bacteria 2940216256 2940217788 206
74 iso_pr_bacteria 3004677695 3004680393 206
75 iso_pr_bacteria 8100166142 8100167168 206
76 2225789004 2227130795 2227527705 207
77 3300000062 IMNBL1DRAFT_c0000013 IMNBL1DRAFT_0000013105 207
78 3300000062 IMNBL1DRAFT_c0012241 IMNBL1DRAFT_00122413 207
79 3300000062 IMNBL1DRAFT_c0041516 IMNBL1DRAFT_00415162 207
80 3300002462 JGI24702J35022_10000094 JGI24702J35022_100000942 207
81 3300002504 JGI24705J35276_12229772 JGI24705J35276_122297723 207
82 3300009784 Ga0123357_10004340 Ga0123357_100043405 207
83 3300009784 Ga0123357_10335039 Ga0123357_103350392 207
84 3300010882 Ga0123354_10000656 Ga0123354_1000065616 207
85 3300010882 Ga0123354_10015146 Ga0123354_100151465 207
86 3300010882 Ga0123354_10153021 Ga0123354_101530213 207
87 3300010882 Ga0123354_10464017 Ga0123354_104640171 207
88 3300042550 Ga0466656_237763 Ga0466656_237763_900_1523 207
89 3300042590 Ga0466690_023696 Ga0466690_023696_1405_2028 207
90 3300042591 Ga0466692_079572 Ga0466692_079572_4354_4977 207
91 3300042591 Ga0466692_151520 Ga0466692_151520_3345_3968 207
92 3300042593 Ga0466691_051621 Ga0466691_051621_6200_6823 207
93 3300042596 Ga0466696_224220 Ga0466696_224220_1570_2193 207
94 3300042600 Ga0466700_106489 Ga0466700_106489_402_1025 207
95 3300042601 Ga0466707_040792 Ga0466707_040792_24203_24826 207
96 3300042601 Ga0466707_092068 Ga0466707_092068_851_1474 207
97 3300042605 Ga0466716_165629 Ga0466716_165629_7566_8189 207
98 3300042606 Ga0466719_495834 Ga0466719_495834_230_853 207
99 3300042612 Ga0466705_157917 Ga0466705_157917_1414_2037 207
100 3300042616 Ga0466715_122804 Ga0466715_122804_2056_2679 207
101 3300042616 Ga0466715_501308 Ga0466715_501308_605_1228 207
102 3300042620 Ga0466728_051221 Ga0466728_051221_1907_2530 207
103 3300042621 Ga0466729_273444 Ga0466729_273444_3745_4368 207
104 3300042624 Ga0466735_046855 Ga0466735_046855_3076_3699 207
105 3300042624 Ga0466735_105036 Ga0466735_105036_10006_10629 207
106 3300042636 Ga0466703_233292 Ga0466703_233292_640_1263 207
107 3300042643 Ga0466704_115958 Ga0466704_115958_2531_3154 207
108 3300042648 Ga0466709_062466 Ga0466709_062466_6250_6873 207
109 3300042655 Ga0466727_008661 Ga0466727_008661_1707_2330 207
110 3300042655 Ga0466727_174137 Ga0466727_174137_740_1363 207
111 3300000062 IMNBL1DRAFT_c0004210 IMNBL1DRAFT_00042104 208
112 3300010882 Ga0123354_10009800 Ga0123354_100098006 208
113 3300010882 Ga0123354_10018506 Ga0123354_100185069 208
114 3300042591 Ga0466692_137108 Ga0466692_137108_1726_2352 208
115 3300042592 Ga0466693_287481 Ga0466693_287481_1493_2119 208
116 3300042602 Ga0466713_056740 Ga0466713_056740_2913_3539 208
117 3300042605 Ga0466716_065108 Ga0466716_065108_3589_4215 208
118 3300000333 HBC_ctgsDRAFT_1000006 HBC_ctgsDRAFT_100000620 209
119 3300002462 JGI24702J35022_10005414 JGI24702J35022_100054147 209
120 3300007129 Ga0102734_1000253 Ga0102734_100025310 209
121 3300007188 Ga0103264_1000008 Ga0103264_1000008105 209
122 3300009784 Ga0123357_10000367 Ga0123357_1000036720 209
123 3300009784 Ga0123357_10124570 Ga0123357_101245703 209
124 3300009784 Ga0123357_10153004 Ga0123357_101530042 209
125 3300042592 Ga0466693_305320 Ga0466693_305320_589_1218 209
126 3300042598 Ga0466701_021952 Ga0466701_021952_650_1279 209
127 3300042602 Ga0466713_005558 Ga0466713_005558_4672_5301 209
128 3300042609 Ga0466722_073972 Ga0466722_073972_109520_110149 209
129 3300042619 Ga0466726_231187 Ga0466726_231187_854_1483 209
130 3300042649 Ga0466724_69524 Ga0466724_69524_675682_676311 209
131 3300042655 Ga0466727_331077 Ga0466727_331077_1305_1934 209
132 iso_pr_bacteria 2529292732 2529758447 209
133 iso_pr_bacteria 2847090942 2847091486 209
134 iso_pr_bacteria 2864788197 2864789372 209
135 iso_pr_bacteria 2864923010 2864924184 209
136 iso_pr_bacteria 2864948220 2864949996 209
137 iso_pr_bacteria 643348524 643423267 209
138 iso_pr_bacteria 8020009074 8020011458 209
139 iso_pr_bacteria 8114076984 8114077854 209
140 3300002834 JGI24696J40584_12955165 JGI24696J40584_129551652 210
141 3300009784 Ga0123357_10472794 Ga0123357_104727941 210
142 3300009784 Ga0123357_10472796 Ga0123357_104727961 210
143 3300009784 Ga0123357_10554571 Ga0123357_105545712 210
144 3300010167 Ga0123353_10474342 Ga0123353_104743421 210
145 3300010882 Ga0123354_10016391 Ga0123354_1001639111 210
146 iso_pr_bacteria 2590828803 2592927266 210
147 iso_pr_bacteria 2820759988 2820761554 210
148 3300042596 Ga0466696_084405 Ga0466696_084405_1298_1933 211
149 3300042598 Ga0466701_008116 Ga0466701_008116_74579_75214 211
150 3300042598 Ga0466701_096297 Ga0466701_096297_77014_77649 211
151 3300042599 Ga0466706_093080 Ga0466706_093080_686_1321 211
152 iso_pr_bacteria 2687453786 2690171507 211
153 iso_pr_bacteria 2864822740 2864823946 211
154 iso_pr_bacteria 2864831662 2864832481 211
155 iso_pr_bacteria 2864882932 2864883735 211
156 iso_pr_bacteria 2864891731 2864892325 211
157 iso_pr_bacteria 2921902974 2921903332 211
158 3300042613 Ga0466710_228693 Ga0466710_228693_209_850 213
159 3300042582 Ga0466657_091532 Ga0466657_091532_153_797 214
160 3300042609 Ga0466722_226889 Ga0466722_226889_3665_4315 216
161 3300042605 Ga0466716_527920 Ga0466716_527920_4070_4735 221
162 3300042654 Ga0466725_030716 Ga0466725_030716_1779_2462 227
163 3300010167 Ga0123353_10504804 Ga0123353_105048042 230
164 3300042591 Ga0466692_184435 Ga0466692_184435_49741_50433 230
165 3300010049 Ga0123356_10444375 Ga0123356_104443751 235

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02527 GidB rRNA small subunit methyltransferase G 45 204 0.84
PF13847 Methyltransf_31 Methyltransferase domain 91 191 0.81

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.81 0.84 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.