Protein Family IF02915
Metagenome
Isolate
165
Members
71
Samples
144
Scaffolds
207.48
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_10444375|Ga0123356_104443751
- Length
- 235 aa
- Sequence
- LIFESIVSFITFVSYKLTNIFLTDMDNDVNMLKFYFPGMTDEQSQQFDALGDSYASWNAMINVISRKDIDNLYERHVLHSLGIARFIRFTAGTRIMDAGTGGGFPGIPLAILLPEVAFHLVDSVGKKIKVAQSVADVLGLKNVTTRHCRIEDEKNAFDFVVSRAVMTLPELAKLVRKNIAKTQHNALPNGLICLKGGNVNKETTPFGKNVIVADLSEYFAEPYFETKKIIYVPL*
Sample Types
Isolate
12.7%
Metagenome
87.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
29.6%
Kalotermitidae
19.7%
Unclassified
9.9%
Elmidae
9.9%
Culicidae
5.6%
Rhinotermitidae
5.6%
Termopsidae
5.6%
Passalidae
2.8%
Blattidae
2.8%
Formicidae
2.8%
Hodotermitidae
1.4%
Apidae
1.4%
Cambaridae
1.4%
Daphniidae
1.4%
Taxonomy
Archaea
1
Bacteria
160
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8114076984 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 2 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 3 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 4 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 5 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 6 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 7 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 8 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 9 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 10 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 11 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 12 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 13 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 14 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 15 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 16 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 17 | 2529292732 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 18 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 19 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 20 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 21 | 2864831662 | Chryseobacterium sediminis S00068 | Isolate | Elmidae |
| 22 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 23 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 24 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 25 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 26 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 27 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 28 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 29 | 8020009074 | Elizabethkingia anophelis MSU001 | Isolate | Culicidae |
| 30 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 31 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 32 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 33 | 2921902974 | Chryseobacterium sp. cx-624 | Isolate | Cambaridae |
| 34 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 35 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 36 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 37 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 38 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 39 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 40 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 41 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 42 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 43 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 44 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 45 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 46 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 47 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 48 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 49 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 50 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 51 | 2847090942 | Elizabethkingia anophelis Ag1 | Isolate | Culicidae |
| 52 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 53 | 2864891731 | Chryseobacterium defluvii S00151 | Isolate | Elmidae |
| 54 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 55 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 56 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 57 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 58 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 59 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 60 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 61 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 62 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 63 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 64 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 65 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 66 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 67 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 68 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 69 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 70 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 71 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466706_255935 | 3300042599 | Bacteria | 48242 |
| 2 | Ga0466707_161031 | 3300042601 | Bacteria | 6072 |
| 3 | Ga0466713_005558 | 3300042602 | Bacteria | 10134 |
| 4 | Ga0466716_527920 | 3300042605 | Bacteria | 23216 |
| 5 | Ga0466722_223624 | 3300042609 | Bacteria | 4492 |
| 6 | Ga0466709_179340 | 3300042648 | Bacteria | 4079 |
| 7 | Ga0466725_030716 | 3300042654 | Bacteria | 28756 |
| 8 | Ga0466727_331077 | 3300042655 | Bacteria | 2521 |
| 9 | Ga0466715_121550 | 3300042616 | Bacteria | 13380 |
| 10 | Ga0466726_034260 | 3300042619 | Bacteria | 7148 |
| 11 | Ga0123357_10335039 | 3300009784 | Bacteria | 1472 |
| 12 | Ga0123354_10009800 | 3300010882 | Bacteria | 14720 |
| 13 | Ga0466657_070511 | 3300042582 | Bacteria | 1163 |
| 14 | Ga0466657_091532 | 3300042582 | Bacteria | 1218 |
| 15 | Ga0466691_051621 | 3300042593 | Bacteria | 8516 |
| 16 | Ga0466706_093080 | 3300042599 | Bacteria | 1402 |
| 17 | Ga0466713_032013 | 3300042602 | Bacteria | 64924 |
| 18 | Ga0466716_016748 | 3300042605 | Bacteria | 11880 |
| 19 | Ga0466716_065108 | 3300042605 | Bacteria | 6086 |
| 20 | Ga0466735_046855 | 3300042624 | Bacteria | 10270 |
| 21 | Ga0466735_108707 | 3300042624 | Bacteria | 3424 |
| 22 | Ga0466730_079418 | 3300042625 | Bacteria | 679131 |
| 23 | Ga0466703_053508 | 3300042636 | Bacteria | 8515 |
| 24 | Ga0466703_378322 | 3300042636 | Bacteria | 3355 |
| 25 | Ga0466704_566564 | 3300042643 | Bacteria | 3062 |
| 26 | Ga0466727_121354 | 3300042655 | Bacteria | 12082 |
| 27 | Ga0466727_174137 | 3300042655 | Bacteria | 3924 |
| 28 | Ga0466715_051231 | 3300042616 | Bacteria | 18964 |
| 29 | Ga0466726_178537 | 3300042619 | Bacteria | 6018 |
| 30 | Ga0123354_10000656 | 3300010882 | Bacteria | 36511 |
| 31 | Ga0466692_184435 | 3300042591 | Bacteria | 106081 |
| 32 | IMNBL1DRAFT_c0012241 | 3300000062 | Bacteria | 3939 |
| 33 | IMNBL1DRAFT_c0041516 | 3300000062 | Bacteria | 1543 |
| 34 | JGI24696J40584_12955165 | 3300002834 | Bacteria | 2778 |
| 35 | Ga0466705_381005 | 3300042612 | Bacteria | 5443 |
| 36 | Ga0466701_047597 | 3300042598 | Bacteria | 1845 |
| 37 | Ga0466706_084658 | 3300042599 | Bacteria | 6301 |
| 38 | Ga0466707_092068 | 3300042601 | Bacteria | 7028 |
| 39 | Ga0466716_165629 | 3300042605 | Bacteria | 14714 |
| 40 | Ga0466719_397365 | 3300042606 | Bacteria | 7417 |
| 41 | Ga0466722_188856 | 3300042609 | Bacteria | 3886 |
| 42 | Ga0466722_226889 | 3300042609 | Bacteria | 6161 |
| 43 | Ga0466730_046120 | 3300042625 | Bacteria | 1166 |
| 44 | Ga0466703_058308 | 3300042636 | Bacteria | 6245 |
| 45 | Ga0466703_222891 | 3300042636 | Bacteria | 9444 |
| 46 | Ga0466703_233292 | 3300042636 | Bacteria | 1451 |
| 47 | Ga0466709_176307 | 3300042648 | Bacteria | 46103 |
| 48 | Ga0466710_228693 | 3300042613 | Bacteria | 1467 |
| 49 | Ga0466729_140456 | 3300042621 | Bacteria | 1903 |
| 50 | Ga0123357_10004340 | 3300009784 | Bacteria | 16620 |
| 51 | Ga0123357_10472794 | 3300009784 | Bacteria | 1066 |
| 52 | Ga0123356_10444375 | 3300010049 | Bacteria | 1444 |
| 53 | Ga0123353_10504804 | 3300010167 | Bacteria | 1761 |
| 54 | Ga0123353_10557465 | 3300010167 | Bacteria | 1651 |
| 55 | Ga0123354_10018506 | 3300010882 | Bacteria | 10922 |
| 56 | Ga0123354_10153021 | 3300010882 | Bacteria | 2783 |
| 57 | Ga0466690_244468 | 3300042590 | Bacteria | 30908 |
| 58 | Ga0466693_287481 | 3300042592 | Bacteria | 2847 |
| 59 | Ga0466696_224220 | 3300042596 | Bacteria | 4604 |
| 60 | Ga0466701_008116 | 3300042598 | Bacteria | 139371 |
| 61 | JGI24702J35022_10005414 | 3300002462 | Bacteria | 7470 |
| 62 | JGI24705J35276_12229772 | 3300002504 | Bacteria | 3462 |
| 63 | Ga0068302_10057170 | 3300005071 | Unclassified | 1078 |
| 64 | Ga0466701_096297 | 3300042598 | Bacteria | 103722 |
| 65 | Ga0466700_479075 | 3300042600 | Bacteria | 5522 |
| 66 | Ga0466722_073972 | 3300042609 | Bacteria | 128406 |
| 67 | Ga0466704_009030 | 3300042643 | Bacteria | 11297 |
| 68 | Ga0466709_062466 | 3300042648 | Bacteria | 7409 |
| 69 | Ga0466709_318574 | 3300042648 | Bacteria | 87877 |
| 70 | Ga0466712_278001 | 3300042614 | Bacteria | 1095 |
| 71 | Ga0466723_235111 | 3300042618 | Bacteria | 13674 |
| 72 | Ga0123357_10124570 | 3300009784 | Bacteria | 3233 |
| 73 | Ga0123357_10472796 | 3300009784 | Unclassified | 1066 |
| 74 | Ga0123356_10014708 | 3300010049 | Bacteria | 7519 |
| 75 | Ga0123353_10474342 | 3300010167 | Bacteria | 1833 |
| 76 | Ga0123353_10930300 | 3300010167 | Bacteria | 1179 |
| 77 | Ga0466690_023696 | 3300042590 | Bacteria | 23811 |
| 78 | Ga0466692_079572 | 3300042591 | Bacteria | 5576 |
| 79 | Ga0466693_305320 | 3300042592 | Bacteria | 1404 |
| 80 | JGI24699J35502_11133587 | 3300002509 | Bacteria | 12286 |
| 81 | Ga0466733_083305 | 3300042659 | Bacteria | 99179 |
| 82 | Ga0466713_056740 | 3300042602 | Bacteria | 3831 |
| 83 | Ga0466735_047968 | 3300042624 | Bacteria | 5356 |
| 84 | Ga0466735_056052 | 3300042624 | Bacteria | 1347 |
| 85 | Ga0466735_106716 | 3300042624 | Archaea | 1751 |
| 86 | Ga0466704_244636 | 3300042643 | Bacteria | 19020 |
| 87 | Ga0466727_278287 | 3300042655 | Bacteria | 4905 |
| 88 | Ga0466710_076999 | 3300042613 | Bacteria | 1628 |
| 89 | Ga0466726_084517 | 3300042619 | Bacteria | 4963 |
| 90 | Ga0123357_10554571 | 3300009784 | Bacteria | 914 |
| 91 | Ga0123354_10464017 | 3300010882 | Bacteria | 1015 |
| 92 | Ga0466696_084405 | 3300042596 | Bacteria | 2291 |
| 93 | IMNBL1DRAFT_c0000013 | 3300000062 | Bacteria | 180832 |
| 94 | Ga0466732_000584 | 3300042656 | Bacteria | 1452 |
| 95 | Ga0466707_059518 | 3300042601 | Bacteria | 3718 |
| 96 | Ga0466713_080540 | 3300042602 | Unclassified | 59038 |
| 97 | Ga0466719_495834 | 3300042606 | Bacteria | 4736 |
| 98 | Ga0466729_273444 | 3300042621 | Bacteria | 8969 |
| 99 | Ga0466735_105036 | 3300042624 | Bacteria | 13392 |
| 100 | Ga0466704_237703 | 3300042643 | Bacteria | 2897 |
| 101 | Ga0466708_172342 | 3300042652 | Bacteria | 21087 |
| 102 | Ga0466727_008661 | 3300042655 | Bacteria | 5716 |
| 103 | Ga0466711_143612 | 3300042615 | Bacteria | 3938 |
| 104 | Ga0466711_464373 | 3300042615 | Bacteria | 18405 |
| 105 | Ga0466715_291973 | 3300042616 | Bacteria | 6082 |
| 106 | Ga0466690_008835 | 3300042590 | Bacteria | 27085 |
| 107 | Ga0466692_137108 | 3300042591 | Bacteria | 7772 |
| 108 | Ga0466696_342708 | 3300042596 | Bacteria | 6300 |
| 109 | HBC_ctgsDRAFT_1000006 | 3300000333 | Bacteria | 61367 |
| 110 | Ga0466697_241565 | 3300042611 | Bacteria | 1315 |
| 111 | Ga0466700_106489 | 3300042600 | Bacteria | 2244 |
| 112 | Ga0466713_010652 | 3300042602 | Bacteria | 41319 |
| 113 | Ga0466716_541528 | 3300042605 | Bacteria | 12605 |
| 114 | Ga0466704_115958 | 3300042643 | Bacteria | 4356 |
| 115 | Ga0466715_122804 | 3300042616 | Bacteria | 8013 |
| 116 | Ga0466715_501308 | 3300042616 | Bacteria | 12254 |
| 117 | Ga0466729_014216 | 3300042621 | Unclassified | 7638 |
| 118 | Ga0123357_10153004 | 3300009784 | Bacteria | 2792 |
| 119 | Ga0123354_10015146 | 3300010882 | Bacteria | 12027 |
| 120 | Ga0466701_000974 | 3300042598 | Bacteria | 6469 |
| 121 | 2227130795 | 2225789004 | Bacteria | 8982 |
| 122 | IMNBL1DRAFT_c0004210 | 3300000062 | Bacteria | 8739 |
| 123 | Ga0103264_1000008 | 3300007188 | Bacteria | 140843 |
| 124 | Ga0123357_10000367 | 3300009784 | Bacteria | 42582 |
| 125 | Ga0466697_171347 | 3300042611 | Bacteria | 1106 |
| 126 | Ga0466705_157917 | 3300042612 | Bacteria | 7944 |
| 127 | Ga0466701_021952 | 3300042598 | Bacteria | 1791 |
| 128 | Ga0466701_035971 | 3300042598 | Bacteria | 18774 |
| 129 | Ga0466707_040792 | 3300042601 | Bacteria | 43826 |
| 130 | Ga0466729_230338 | 3300042621 | Bacteria | 4287 |
| 131 | Ga0466735_076366 | 3300042624 | Bacteria | 3348 |
| 132 | Ga0466735_077776 | 3300042624 | Bacteria | 9115 |
| 133 | Ga0466724_69524 | 3300042649 | Bacteria | 891007 |
| 134 | Ga0466725_109433 | 3300042654 | Bacteria | 1358 |
| 135 | Ga0466726_231187 | 3300042619 | Bacteria | 1519 |
| 136 | Ga0466726_357022 | 3300042619 | Bacteria | 1452 |
| 137 | Ga0466728_051221 | 3300042620 | Bacteria | 8656 |
| 138 | Ga0123354_10016391 | 3300010882 | Bacteria | 11613 |
| 139 | Ga0466656_237763 | 3300042550 | Bacteria | 1795 |
| 140 | Ga0466690_276484 | 3300042590 | Bacteria | 44393 |
| 141 | Ga0466692_151520 | 3300042591 | Bacteria | 33800 |
| 142 | Ga0466696_093250 | 3300042596 | Bacteria | 8978 |
| 143 | JGI24702J35022_10000094 | 3300002462 | Bacteria | 40308 |
| 144 | Ga0102734_1000253 | 3300007129 | Bacteria | 16663 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | iso_pr_bacteria | 2820762746 | 2820763088 | 185 |
| 2 | 3300002509 | JGI24699J35502_11133587 | JGI24699J35502_1113358716 | 186 |
| 3 | 3300042655 | Ga0466727_121354 | Ga0466727_121354_50_616 | 188 |
| 4 | 3300042611 | Ga0466697_241565 | Ga0466697_241565_455_1075 | 194 |
| 5 | 3300042625 | Ga0466730_079418 | Ga0466730_079418_603832_604467 | 199 |
| 6 | 3300042590 | Ga0466690_244468 | Ga0466690_244468_23933_24547 | 204 |
| 7 | 3300042598 | Ga0466701_000974 | Ga0466701_000974_3495_4109 | 204 |
| 8 | 3300005071 | Ga0068302_10057170 | Ga0068302_100571701 | 205 |
| 9 | 3300042596 | Ga0466696_093250 | Ga0466696_093250_7314_7931 | 205 |
| 10 | 3300042605 | Ga0466716_016748 | Ga0466716_016748_822_1439 | 205 |
| 11 | 3300042614 | Ga0466712_278001 | Ga0466712_278001_428_1045 | 205 |
| 12 | 3300042619 | Ga0466726_084517 | Ga0466726_084517_1001_1618 | 205 |
| 13 | 3300042619 | Ga0466726_178537 | Ga0466726_178537_5001_5618 | 205 |
| 14 | 3300042619 | Ga0466726_357022 | Ga0466726_357022_491_1108 | 205 |
| 15 | 3300042636 | Ga0466703_378322 | Ga0466703_378322_744_1361 | 205 |
| 16 | 3300042643 | Ga0466704_009030 | Ga0466704_009030_6321_6938 | 205 |
| 17 | 3300010049 | Ga0123356_10014708 | Ga0123356_100147085 | 206 |
| 18 | 3300010167 | Ga0123353_10557465 | Ga0123353_105574653 | 206 |
| 19 | 3300010167 | Ga0123353_10930300 | Ga0123353_109303001 | 206 |
| 20 | 3300042582 | Ga0466657_070511 | Ga0466657_070511_508_1128 | 206 |
| 21 | 3300042590 | Ga0466690_008835 | Ga0466690_008835_23593_24213 | 206 |
| 22 | 3300042590 | Ga0466690_276484 | Ga0466690_276484_33089_33709 | 206 |
| 23 | 3300042596 | Ga0466696_342708 | Ga0466696_342708_4721_5341 | 206 |
| 24 | 3300042598 | Ga0466701_035971 | Ga0466701_035971_15977_16597 | 206 |
| 25 | 3300042598 | Ga0466701_047597 | Ga0466701_047597_1061_1681 | 206 |
| 26 | 3300042599 | Ga0466706_084658 | Ga0466706_084658_175_795 | 206 |
| 27 | 3300042599 | Ga0466706_255935 | Ga0466706_255935_21922_22542 | 206 |
| 28 | 3300042600 | Ga0466700_479075 | Ga0466700_479075_1604_2224 | 206 |
| 29 | 3300042601 | Ga0466707_059518 | Ga0466707_059518_877_1497 | 206 |
| 30 | 3300042601 | Ga0466707_161031 | Ga0466707_161031_420_1040 | 206 |
| 31 | 3300042602 | Ga0466713_010652 | Ga0466713_010652_39444_40064 | 206 |
| 32 | 3300042602 | Ga0466713_032013 | Ga0466713_032013_57748_58368 | 206 |
| 33 | 3300042602 | Ga0466713_080540 | Ga0466713_080540_24024_24644 | 206 |
| 34 | 3300042605 | Ga0466716_541528 | Ga0466716_541528_2414_3034 | 206 |
| 35 | 3300042606 | Ga0466719_397365 | Ga0466719_397365_4513_5133 | 206 |
| 36 | 3300042609 | Ga0466722_188856 | Ga0466722_188856_1138_1758 | 206 |
| 37 | 3300042609 | Ga0466722_223624 | Ga0466722_223624_963_1583 | 206 |
| 38 | 3300042611 | Ga0466697_171347 | Ga0466697_171347_25_645 | 206 |
| 39 | 3300042612 | Ga0466705_381005 | Ga0466705_381005_3680_4300 | 206 |
| 40 | 3300042613 | Ga0466710_076999 | Ga0466710_076999_271_891 | 206 |
| 41 | 3300042615 | Ga0466711_143612 | Ga0466711_143612_1196_1816 | 206 |
| 42 | 3300042615 | Ga0466711_464373 | Ga0466711_464373_7209_7829 | 206 |
| 43 | 3300042616 | Ga0466715_051231 | Ga0466715_051231_6382_7002 | 206 |
| 44 | 3300042616 | Ga0466715_121550 | Ga0466715_121550_9005_9625 | 206 |
| 45 | 3300042616 | Ga0466715_291973 | Ga0466715_291973_2223_2843 | 206 |
| 46 | 3300042618 | Ga0466723_235111 | Ga0466723_235111_7733_8353 | 206 |
| 47 | 3300042619 | Ga0466726_034260 | Ga0466726_034260_1860_2480 | 206 |
| 48 | 3300042621 | Ga0466729_014216 | Ga0466729_014216_6019_6639 | 206 |
| 49 | 3300042621 | Ga0466729_140456 | Ga0466729_140456_250_870 | 206 |
| 50 | 3300042621 | Ga0466729_230338 | Ga0466729_230338_1925_2545 | 206 |
| 51 | 3300042624 | Ga0466735_047968 | Ga0466735_047968_3939_4559 | 206 |
| 52 | 3300042624 | Ga0466735_056052 | Ga0466735_056052_19_639 | 206 |
| 53 | 3300042624 | Ga0466735_076366 | Ga0466735_076366_663_1283 | 206 |
| 54 | 3300042624 | Ga0466735_077776 | Ga0466735_077776_7895_8515 | 206 |
| 55 | 3300042624 | Ga0466735_106716 | Ga0466735_106716_648_1268 | 206 |
| 56 | 3300042624 | Ga0466735_108707 | Ga0466735_108707_1758_2378 | 206 |
| 57 | 3300042625 | Ga0466730_046120 | Ga0466730_046120_421_1041 | 206 |
| 58 | 3300042636 | Ga0466703_053508 | Ga0466703_053508_4349_4969 | 206 |
| 59 | 3300042636 | Ga0466703_058308 | Ga0466703_058308_3471_4091 | 206 |
| 60 | 3300042636 | Ga0466703_222891 | Ga0466703_222891_5303_5923 | 206 |
| 61 | 3300042643 | Ga0466704_237703 | Ga0466704_237703_1353_1973 | 206 |
| 62 | 3300042643 | Ga0466704_244636 | Ga0466704_244636_10361_10981 | 206 |
| 63 | 3300042643 | Ga0466704_566564 | Ga0466704_566564_398_1018 | 206 |
| 64 | 3300042648 | Ga0466709_176307 | Ga0466709_176307_31740_32360 | 206 |
| 65 | 3300042648 | Ga0466709_179340 | Ga0466709_179340_260_880 | 206 |
| 66 | 3300042648 | Ga0466709_318574 | Ga0466709_318574_34990_35610 | 206 |
| 67 | 3300042652 | Ga0466708_172342 | Ga0466708_172342_16530_17150 | 206 |
| 68 | 3300042654 | Ga0466725_109433 | Ga0466725_109433_473_1093 | 206 |
| 69 | 3300042655 | Ga0466727_278287 | Ga0466727_278287_2889_3509 | 206 |
| 70 | 3300042656 | Ga0466732_000584 | Ga0466732_000584_406_1026 | 206 |
| 71 | 3300042659 | Ga0466733_083305 | Ga0466733_083305_29101_29721 | 206 |
| 72 | iso_pr_bacteria | 2820778767 | 2820780354 | 206 |
| 73 | iso_pr_bacteria | 2940216256 | 2940217788 | 206 |
| 74 | iso_pr_bacteria | 3004677695 | 3004680393 | 206 |
| 75 | iso_pr_bacteria | 8100166142 | 8100167168 | 206 |
| 76 | 2225789004 | 2227130795 | 2227527705 | 207 |
| 77 | 3300000062 | IMNBL1DRAFT_c0000013 | IMNBL1DRAFT_0000013105 | 207 |
| 78 | 3300000062 | IMNBL1DRAFT_c0012241 | IMNBL1DRAFT_00122413 | 207 |
| 79 | 3300000062 | IMNBL1DRAFT_c0041516 | IMNBL1DRAFT_00415162 | 207 |
| 80 | 3300002462 | JGI24702J35022_10000094 | JGI24702J35022_100000942 | 207 |
| 81 | 3300002504 | JGI24705J35276_12229772 | JGI24705J35276_122297723 | 207 |
| 82 | 3300009784 | Ga0123357_10004340 | Ga0123357_100043405 | 207 |
| 83 | 3300009784 | Ga0123357_10335039 | Ga0123357_103350392 | 207 |
| 84 | 3300010882 | Ga0123354_10000656 | Ga0123354_1000065616 | 207 |
| 85 | 3300010882 | Ga0123354_10015146 | Ga0123354_100151465 | 207 |
| 86 | 3300010882 | Ga0123354_10153021 | Ga0123354_101530213 | 207 |
| 87 | 3300010882 | Ga0123354_10464017 | Ga0123354_104640171 | 207 |
| 88 | 3300042550 | Ga0466656_237763 | Ga0466656_237763_900_1523 | 207 |
| 89 | 3300042590 | Ga0466690_023696 | Ga0466690_023696_1405_2028 | 207 |
| 90 | 3300042591 | Ga0466692_079572 | Ga0466692_079572_4354_4977 | 207 |
| 91 | 3300042591 | Ga0466692_151520 | Ga0466692_151520_3345_3968 | 207 |
| 92 | 3300042593 | Ga0466691_051621 | Ga0466691_051621_6200_6823 | 207 |
| 93 | 3300042596 | Ga0466696_224220 | Ga0466696_224220_1570_2193 | 207 |
| 94 | 3300042600 | Ga0466700_106489 | Ga0466700_106489_402_1025 | 207 |
| 95 | 3300042601 | Ga0466707_040792 | Ga0466707_040792_24203_24826 | 207 |
| 96 | 3300042601 | Ga0466707_092068 | Ga0466707_092068_851_1474 | 207 |
| 97 | 3300042605 | Ga0466716_165629 | Ga0466716_165629_7566_8189 | 207 |
| 98 | 3300042606 | Ga0466719_495834 | Ga0466719_495834_230_853 | 207 |
| 99 | 3300042612 | Ga0466705_157917 | Ga0466705_157917_1414_2037 | 207 |
| 100 | 3300042616 | Ga0466715_122804 | Ga0466715_122804_2056_2679 | 207 |
| 101 | 3300042616 | Ga0466715_501308 | Ga0466715_501308_605_1228 | 207 |
| 102 | 3300042620 | Ga0466728_051221 | Ga0466728_051221_1907_2530 | 207 |
| 103 | 3300042621 | Ga0466729_273444 | Ga0466729_273444_3745_4368 | 207 |
| 104 | 3300042624 | Ga0466735_046855 | Ga0466735_046855_3076_3699 | 207 |
| 105 | 3300042624 | Ga0466735_105036 | Ga0466735_105036_10006_10629 | 207 |
| 106 | 3300042636 | Ga0466703_233292 | Ga0466703_233292_640_1263 | 207 |
| 107 | 3300042643 | Ga0466704_115958 | Ga0466704_115958_2531_3154 | 207 |
| 108 | 3300042648 | Ga0466709_062466 | Ga0466709_062466_6250_6873 | 207 |
| 109 | 3300042655 | Ga0466727_008661 | Ga0466727_008661_1707_2330 | 207 |
| 110 | 3300042655 | Ga0466727_174137 | Ga0466727_174137_740_1363 | 207 |
| 111 | 3300000062 | IMNBL1DRAFT_c0004210 | IMNBL1DRAFT_00042104 | 208 |
| 112 | 3300010882 | Ga0123354_10009800 | Ga0123354_100098006 | 208 |
| 113 | 3300010882 | Ga0123354_10018506 | Ga0123354_100185069 | 208 |
| 114 | 3300042591 | Ga0466692_137108 | Ga0466692_137108_1726_2352 | 208 |
| 115 | 3300042592 | Ga0466693_287481 | Ga0466693_287481_1493_2119 | 208 |
| 116 | 3300042602 | Ga0466713_056740 | Ga0466713_056740_2913_3539 | 208 |
| 117 | 3300042605 | Ga0466716_065108 | Ga0466716_065108_3589_4215 | 208 |
| 118 | 3300000333 | HBC_ctgsDRAFT_1000006 | HBC_ctgsDRAFT_100000620 | 209 |
| 119 | 3300002462 | JGI24702J35022_10005414 | JGI24702J35022_100054147 | 209 |
| 120 | 3300007129 | Ga0102734_1000253 | Ga0102734_100025310 | 209 |
| 121 | 3300007188 | Ga0103264_1000008 | Ga0103264_1000008105 | 209 |
| 122 | 3300009784 | Ga0123357_10000367 | Ga0123357_1000036720 | 209 |
| 123 | 3300009784 | Ga0123357_10124570 | Ga0123357_101245703 | 209 |
| 124 | 3300009784 | Ga0123357_10153004 | Ga0123357_101530042 | 209 |
| 125 | 3300042592 | Ga0466693_305320 | Ga0466693_305320_589_1218 | 209 |
| 126 | 3300042598 | Ga0466701_021952 | Ga0466701_021952_650_1279 | 209 |
| 127 | 3300042602 | Ga0466713_005558 | Ga0466713_005558_4672_5301 | 209 |
| 128 | 3300042609 | Ga0466722_073972 | Ga0466722_073972_109520_110149 | 209 |
| 129 | 3300042619 | Ga0466726_231187 | Ga0466726_231187_854_1483 | 209 |
| 130 | 3300042649 | Ga0466724_69524 | Ga0466724_69524_675682_676311 | 209 |
| 131 | 3300042655 | Ga0466727_331077 | Ga0466727_331077_1305_1934 | 209 |
| 132 | iso_pr_bacteria | 2529292732 | 2529758447 | 209 |
| 133 | iso_pr_bacteria | 2847090942 | 2847091486 | 209 |
| 134 | iso_pr_bacteria | 2864788197 | 2864789372 | 209 |
| 135 | iso_pr_bacteria | 2864923010 | 2864924184 | 209 |
| 136 | iso_pr_bacteria | 2864948220 | 2864949996 | 209 |
| 137 | iso_pr_bacteria | 643348524 | 643423267 | 209 |
| 138 | iso_pr_bacteria | 8020009074 | 8020011458 | 209 |
| 139 | iso_pr_bacteria | 8114076984 | 8114077854 | 209 |
| 140 | 3300002834 | JGI24696J40584_12955165 | JGI24696J40584_129551652 | 210 |
| 141 | 3300009784 | Ga0123357_10472794 | Ga0123357_104727941 | 210 |
| 142 | 3300009784 | Ga0123357_10472796 | Ga0123357_104727961 | 210 |
| 143 | 3300009784 | Ga0123357_10554571 | Ga0123357_105545712 | 210 |
| 144 | 3300010167 | Ga0123353_10474342 | Ga0123353_104743421 | 210 |
| 145 | 3300010882 | Ga0123354_10016391 | Ga0123354_1001639111 | 210 |
| 146 | iso_pr_bacteria | 2590828803 | 2592927266 | 210 |
| 147 | iso_pr_bacteria | 2820759988 | 2820761554 | 210 |
| 148 | 3300042596 | Ga0466696_084405 | Ga0466696_084405_1298_1933 | 211 |
| 149 | 3300042598 | Ga0466701_008116 | Ga0466701_008116_74579_75214 | 211 |
| 150 | 3300042598 | Ga0466701_096297 | Ga0466701_096297_77014_77649 | 211 |
| 151 | 3300042599 | Ga0466706_093080 | Ga0466706_093080_686_1321 | 211 |
| 152 | iso_pr_bacteria | 2687453786 | 2690171507 | 211 |
| 153 | iso_pr_bacteria | 2864822740 | 2864823946 | 211 |
| 154 | iso_pr_bacteria | 2864831662 | 2864832481 | 211 |
| 155 | iso_pr_bacteria | 2864882932 | 2864883735 | 211 |
| 156 | iso_pr_bacteria | 2864891731 | 2864892325 | 211 |
| 157 | iso_pr_bacteria | 2921902974 | 2921903332 | 211 |
| 158 | 3300042613 | Ga0466710_228693 | Ga0466710_228693_209_850 | 213 |
| 159 | 3300042582 | Ga0466657_091532 | Ga0466657_091532_153_797 | 214 |
| 160 | 3300042609 | Ga0466722_226889 | Ga0466722_226889_3665_4315 | 216 |
| 161 | 3300042605 | Ga0466716_527920 | Ga0466716_527920_4070_4735 | 221 |
| 162 | 3300042654 | Ga0466725_030716 | Ga0466725_030716_1779_2462 | 227 |
| 163 | 3300010167 | Ga0123353_10504804 | Ga0123353_105048042 | 230 |
| 164 | 3300042591 | Ga0466692_184435 | Ga0466692_184435_49741_50433 | 230 |
| 165 | 3300010049 | Ga0123356_10444375 | Ga0123356_104443751 | 235 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.81 | 0.84 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.