Protein Family IF02893

Metagenome Isolate
110 Members
50 Samples
100 Scaffolds
164.17 Avg Length

🧬 Representative Sequence

ID
3300010049|Ga0123356_10326720|Ga0123356_103267202
Length
194 aa
Sequence
MVLILSMHGLQSPYKCVIILTENMGGMHMPKRQSYISWDEYFMGIALLSAYRSKDPRTQVGACIVNGSNRIMSMGYNGLPAGCGDDEFPWEAEGEYLDTKYPYVCHAELNAILNSGGRSLEGCKIYVALFPCNECAKAIIQCGIKEVLYLSDKYAGTPGNQASKRLFAAAGVAMTQLTLGRGSITIDFDPAKV*

📊 Sample Types

Isolate 9.1%
Metagenome 90.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 52.1%
Unclassified 16.7%
Kalotermitidae 10.4%
Rhinotermitidae 6.2%
Blattidae 6.2%
Passalidae 6.2%
Termopsidae 2.1%

🌳 Taxonomy

Archaea 0
Bacteria 101
Eukaryota 0
Viruses 0
Unclassified 9

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820507989 Unclassified Firmicutes Lab288P1bin41 Isolate Unclassified
2 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
3 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
4 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
5 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
6 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
7 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
8 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
9 2940349480 Fusobacterium sp. PH5-44 Isolate Blattidae
10 2820080004 Unclassified Proteobacteria Lab288P4bin34 Isolate Unclassified
11 2820705605 Unclassified Firmicutes Co191P1bin34 Isolate Unclassified
12 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
13 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
14 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
15 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
16 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
17 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
18 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
19 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
20 2940241992 Fusobacterium sp. PH5-29 Isolate Blattidae
21 2820056190 Unclassified Proteobacteria Nt197P4bin9 Isolate Unclassified
22 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
23 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
24 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
25 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
26 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
27 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
28 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
29 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
30 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
31 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
32 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
33 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
34 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
35 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
36 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
37 2820101058 Unclassified Proteobacteria Emb289P4bin76 Isolate Unclassified
38 2820474468 Unclassified Firmicutes Lab288P1bin84 Isolate Unclassified
39 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
40 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
41 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
42 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
43 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
44 2820277137 Unclassified Firmicutes Th196P3bin150 Isolate Unclassified
45 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
46 2940373808 Fusobacterium sp. PH5-7 Isolate Blattidae
47 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
48 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
49 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
50 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_136284 3300042659 Bacteria 8328
2 Ga0123357_10126225 3300009784 Unclassified 3204
3 Ga0123355_11052385 3300009826 Bacteria 855
4 Ga0123356_10033881 3300010049 Bacteria 4777
5 Ga0123353_10025393 3300010167 Bacteria 9028
6 Ga0123353_10049613 3300010167 Bacteria 6687
7 Ga0123353_10152950 3300010167 Bacteria 3681
8 Ga0123353_10172647 3300010167 Bacteria 3430
9 Ga0466703_079286 3300042636 Bacteria 5052
10 Ga0466720_149003 3300042607 Bacteria 3582
11 JGI24702J35022_10016368 3300002462 Bacteria 4065
12 JGI24696J40584_12948642 3300002834 Unclassified 2017
13 JGI24696J40584_12955433 3300002834 Bacteria 2833
14 Ga0123355_10250355 3300009826 Bacteria 2495
15 Ga0123354_10500113 3300010882 Bacteria 948
16 Ga0123354_10521537 3300010882 Bacteria 913
17 Ga0466703_353416 3300042636 Bacteria 1803
18 Ga0466714_109163 3300042603 Bacteria 1146
19 Ga0466714_138063 3300042603 Unclassified 1682
20 Ga0415639_154588 3300038395 Bacteria 1287
21 Ga0466696_154758 3300042596 Bacteria 1622
22 Ga0466726_137563 3300042619 Bacteria 1668
23 JGI24698J34947_10260643 3300002449 Bacteria 643
24 JGI24696J40584_12818880 3300002834 Bacteria 903
25 JGI24696J40584_12954199 3300002834 Bacteria 2598
26 Ga0123355_10034869 3300009826 Bacteria 8180
27 Ga0123356_11478490 3300010049 Bacteria 838
28 Ga0123353_10000076 3300010167 Bacteria 108569
29 Ga0466714_164630 3300042603 Unclassified 2476
30 Ga0466722_239200 3300042609 Bacteria 1569
31 Ga0466712_088434 3300042614 Bacteria 1553
32 Ga0466711_163818 3300042615 Bacteria 18116
33 IMNBL1DRAFT_c0007602 3300000062 Bacteria 5667
34 JGI24702J35022_10012806 3300002462 Bacteria 4653
35 Ga0466732_070736 3300042656 Bacteria 1982
36 Ga0123357_10210109 3300009784 Bacteria 2189
37 Ga0123353_11072825 3300010167 Unclassified 1073
38 Ga0466731_367308 3300042622 Bacteria 3078
39 Ga0466699_294816 3300042597 Bacteria 1639
40 JGI24695J34938_10062312 3300002450 Bacteria 1585
41 Ga0072941_1438651 3300005201 Bacteria 1098
42 Ga0466733_084284 3300042659 Bacteria 1130
43 Ga0123356_10054761 3300010049 Bacteria 3715
44 Ga0123356_10326720 3300010049 Bacteria 1649
45 Ga0123353_10000682 3300010167 Bacteria 41525
46 Ga0123353_10000937 3300010167 Bacteria 35636
47 Ga0123353_10002841 3300010167 Bacteria 21650
48 Ga0123353_10101107 3300010167 Bacteria 4648
49 Ga0123353_10938846 3300010167 Bacteria 1172
50 Ga0466719_398712 3300042606 Bacteria 71100
51 Ga0466698_403695 3300042610 Bacteria 5098
52 Ga0466715_551549 3300042616 Bacteria 80655
53 JGI24702J35022_10368277 3300002462 Bacteria 862
54 Ga0123356_10203969 3300010049 Bacteria 2020
55 Ga0123356_10229331 3300010049 Bacteria 1920
56 Ga0123356_11620655 3300010049 Bacteria 801
57 Ga0123353_10005933 3300010167 Bacteria 16161
58 Ga0123353_10080924 3300010167 Unclassified 5223
59 Ga0123353_11446239 3300010167 Bacteria 880
60 Ga0466714_053604 3300042603 Unclassified 2068
61 Ga0466717_270058 3300042604 Bacteria 2288
62 Ga0466721_251509 3300042608 Bacteria 170691
63 Ga0264413_153162 3300024493 Unclassified 6565
64 Ga0466726_307375 3300042619 Bacteria 1739
65 Ga0072941_1365288 3300005201 Bacteria 2109
66 Ga0123357_10000925 3300009784 Bacteria 29848
67 Ga0123355_10013704 3300009826 Bacteria 12632
68 Ga0123355_11571622 3300009826 Bacteria 636
69 Ga0123356_10076587 3300010049 Bacteria 3153
70 Ga0123353_10002918 3300010167 Bacteria 21408
71 Ga0123353_10598590 3300010167 Bacteria 1576
72 Ga0123353_11989846 3300010167 Bacteria 712
73 Ga0123354_10014948 3300010882 Bacteria 12096
74 Ga0466729_271149 3300042621 Bacteria 100204
75 Ga0466702_099185 3300042635 Bacteria 4493
76 Ga0466703_080820 3300042636 Bacteria 1196
77 Ga0466722_249094 3300042609 Bacteria 2708
78 Ga0466698_503874 3300042610 Bacteria 45277
79 Ga0466718_127121 3300042617 Bacteria 4503
80 JGI24702J35022_10178108 3300002462 Unclassified 1206
81 Ga0123355_10780408 3300009826 Bacteria 1072
82 Ga0123356_10002519 3300010049 Bacteria 19571
83 Ga0123356_10492637 3300010049 Bacteria 1380
84 Ga0123353_10070422 3300010167 Bacteria 5619
85 Ga0123353_10080621 3300010167 Bacteria 5234
86 Ga0466734_085830 3300042623 Bacteria 1673
87 Ga0466702_075792 3300042635 Bacteria 1282
88 Ga0466707_350412 3300042601 Bacteria 1264
89 Ga0466714_058082 3300042603 Bacteria 1503
90 Ga0466722_237249 3300042609 Bacteria 156667
91 Ga0466722_255621 3300042609 Bacteria 60979
92 Ga0466692_015366 3300042591 Bacteria 81401
93 Ga0466710_332787 3300042613 Bacteria 1104
94 Ga0466718_131016 3300042617 Bacteria 1983
95 2227013701 2225789003 Bacteria 5497
96 2227408567 2225789004 Bacteria 5731
97 IMNBL1DRAFT_c0005520 3300000062 Bacteria 7208
98 JGI24702J35022_10004475 3300002462 Bacteria 8295
99 JGI24702J35022_10009175 3300002462 Bacteria 5565
100 JGI24705J35276_12238274 3300002504 Bacteria 18399

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300038395 Ga0415639_154588 Ga0415639_154588_19_456 145
2 3300042614 Ga0466712_088434 Ga0466712_088434_613_1053 146
3 3300009826 Ga0123355_11571622 Ga0123355_115716221 149
4 3300042622 Ga0466731_367308 Ga0466731_367308_1781_2233 150
5 3300000062 IMNBL1DRAFT_c0005520 IMNBL1DRAFT_00055209 158
6 iso_pr_bacteria 2820474468 2820476312 158
7 iso_pr_bacteria 2820705605 2820706665 158
8 3300002450 JGI24695J34938_10062312 JGI24695J34938_100623122 159
9 3300009826 Ga0123355_10013704 Ga0123355_1001370416 159
10 3300010167 Ga0123353_10938846 Ga0123353_109388462 159
11 3300042596 Ga0466696_154758 Ga0466696_154758_416_895 159
12 3300042604 Ga0466717_270058 Ga0466717_270058_1478_1957 159
13 3300042608 Ga0466721_251509 Ga0466721_251509_91235_91714 159
14 3300042619 Ga0466726_307375 Ga0466726_307375_1023_1502 159
15 3300042623 Ga0466734_085830 Ga0466734_085830_46_525 159
16 3300042635 Ga0466702_099185 Ga0466702_099185_2434_2913 159
17 3300042636 Ga0466703_080820 Ga0466703_080820_572_1051 159
18 3300042659 Ga0466733_084284 Ga0466733_084284_335_814 159
19 3300042659 Ga0466733_136284 Ga0466733_136284_227_706 159
20 iso_pr_bacteria 2820277137 2820278476 159
21 iso_pr_bacteria 2820507989 2820510249 159
22 3300002449 JGI24698J34947_10260643 JGI24698J34947_102606431 160
23 3300005201 Ga0072941_1438651 Ga0072941_14386512 160
24 3300024493 Ga0264413_153162 Ga0264413_1531624 160
25 3300042591 Ga0466692_015366 Ga0466692_015366_46035_46517 160
26 3300042601 Ga0466707_350412 Ga0466707_350412_439_921 160
27 3300042603 Ga0466714_053604 Ga0466714_053604_131_613 160
28 3300042607 Ga0466720_149003 Ga0466720_149003_1662_2144 160
29 3300042610 Ga0466698_503874 Ga0466698_503874_44140_44622 160
30 3300042617 Ga0466718_127121 Ga0466718_127121_3908_4390 160
31 3300042617 Ga0466718_131016 Ga0466718_131016_1394_1876 160
32 3300042619 Ga0466726_137563 Ga0466726_137563_30_512 160
33 3300042656 Ga0466732_070736 Ga0466732_070736_983_1465 160
34 2225789003 2227013701 2227372750 161
35 3300009784 Ga0123357_10126225 Ga0123357_101262252 161
36 3300042636 Ga0466703_079286 Ga0466703_079286_3962_4447 161
37 3300042603 Ga0466714_109163 Ga0466714_109163_93_581 162
38 3300042603 Ga0466714_138063 Ga0466714_138063_210_698 162
39 3300042609 Ga0466722_255621 Ga0466722_255621_30027_30515 162
40 iso_pr_bacteria 2940241992 2940243568 163
41 iso_pr_bacteria 2940349480 2940351066 163
42 iso_pr_bacteria 2940373808 2940376797 163
43 2225789004 2227408567 2227850807 164
44 3300009826 Ga0123355_10250355 Ga0123355_102503552 164
45 3300010167 Ga0123353_10049613 Ga0123353_100496133 164
46 3300042609 Ga0466722_237249 Ga0466722_237249_43060_43554 164
47 iso_pr_bacteria 2820056190 2820058120 164
48 iso_pr_bacteria 2820080004 2820081234 164
49 iso_pr_bacteria 2820101058 2820103153 164
50 3300000062 IMNBL1DRAFT_c0007602 IMNBL1DRAFT_00076022 165
51 3300002504 JGI24705J35276_12238274 JGI24705J35276_1223827416 165
52 3300009784 Ga0123357_10000925 Ga0123357_100009253 165
53 3300010049 Ga0123356_10033881 Ga0123356_100338813 165
54 3300010167 Ga0123353_10002918 Ga0123353_1000291813 165
55 3300010167 Ga0123353_10598590 Ga0123353_105985902 165
56 3300010882 Ga0123354_10014948 Ga0123354_100149489 165
57 3300042597 Ga0466699_294816 Ga0466699_294816_580_1077 165
58 3300042603 Ga0466714_058082 Ga0466714_058082_277_774 165
59 3300042609 Ga0466722_249094 Ga0466722_249094_209_706 165
60 3300042610 Ga0466698_403695 Ga0466698_403695_1855_2352 165
61 3300042613 Ga0466710_332787 Ga0466710_332787_123_620 165
62 3300042635 Ga0466702_075792 Ga0466702_075792_563_1060 165
63 3300002462 JGI24702J35022_10004475 JGI24702J35022_100044756 166
64 3300002462 JGI24702J35022_10009175 JGI24702J35022_100091752 166
65 3300002462 JGI24702J35022_10012806 JGI24702J35022_100128064 166
66 3300002462 JGI24702J35022_10016368 JGI24702J35022_100163682 166
67 3300002462 JGI24702J35022_10178108 JGI24702J35022_101781081 166
68 3300002462 JGI24702J35022_10368277 JGI24702J35022_103682771 166
69 3300002834 JGI24696J40584_12818880 JGI24696J40584_128188802 166
70 3300002834 JGI24696J40584_12948642 JGI24696J40584_129486422 166
71 3300002834 JGI24696J40584_12954199 JGI24696J40584_129541992 166
72 3300002834 JGI24696J40584_12955433 JGI24696J40584_129554332 166
73 3300005201 Ga0072941_1365288 Ga0072941_13652883 166
74 3300009826 Ga0123355_10780408 Ga0123355_107804082 166
75 3300009826 Ga0123355_11052385 Ga0123355_110523852 166
76 3300010049 Ga0123356_10054761 Ga0123356_100547616 166
77 3300010049 Ga0123356_10076587 Ga0123356_100765873 166
78 3300010049 Ga0123356_10203969 Ga0123356_102039692 166
79 3300010049 Ga0123356_10229331 Ga0123356_102293312 166
80 3300010049 Ga0123356_11478490 Ga0123356_114784901 166
81 3300010049 Ga0123356_11620655 Ga0123356_116206552 166
82 3300010167 Ga0123353_10002841 Ga0123353_100028419 166
83 3300010167 Ga0123353_10025393 Ga0123353_100253937 166
84 3300010167 Ga0123353_10070422 Ga0123353_100704226 166
85 3300010167 Ga0123353_10080621 Ga0123353_100806212 166
86 3300010167 Ga0123353_10080924 Ga0123353_100809242 166
87 3300010167 Ga0123353_10101107 Ga0123353_101011077 166
88 3300010167 Ga0123353_10172647 Ga0123353_101726474 166
89 3300010167 Ga0123353_11072825 Ga0123353_110728252 166
90 3300010167 Ga0123353_11446239 Ga0123353_114462392 166
91 3300010167 Ga0123353_11989846 Ga0123353_119898461 166
92 3300042606 Ga0466719_398712 Ga0466719_398712_44489_44989 166
93 3300042615 Ga0466711_163818 Ga0466711_163818_5404_5904 166
94 3300042636 Ga0466703_353416 Ga0466703_353416_648_1148 166
95 3300010049 Ga0123356_10492637 Ga0123356_104926372 168
96 3300010167 Ga0123353_10005933 Ga0123353_1000593313 168
97 3300010882 Ga0123354_10500113 Ga0123354_105001132 168
98 3300042621 Ga0466729_271149 Ga0466729_271149_73930_74436 168
99 3300010167 Ga0123353_10000937 Ga0123353_1000093718 169
100 3300042603 Ga0466714_164630 Ga0466714_164630_1653_2162 169
101 3300009784 Ga0123357_10210109 Ga0123357_102101093 171
102 3300010167 Ga0123353_10000076 Ga0123353_1000007681 171
103 3300010167 Ga0123353_10152950 Ga0123353_101529505 171
104 3300010882 Ga0123354_10521537 Ga0123354_105215371 171
105 3300010167 Ga0123353_10000682 Ga0123353_1000068220 172
106 3300042616 Ga0466715_551549 Ga0466715_551549_39906_40430 174
107 3300010049 Ga0123356_10002519 Ga0123356_100025194 176
108 3300042609 Ga0466722_239200 Ga0466722_239200_952_1488 178
109 3300010049 Ga0123356_10326720 Ga0123356_103267202 194
110 3300009826 Ga0123355_10034869 Ga0123355_100348697 198

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00383 dCMP_cyt_deam_1 Cytidine and deoxycytidylate deaminase zinc-binding region 37 150 0.97
PF14437 MafB19-deam MafB19-like deaminase 37 157 0.87

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.8 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.