Protein Family IF02891

Metagenome Isolate
112 Members
44 Samples
105 Scaffolds
184.02 Avg Length

🧬 Representative Sequence

ID
3300010049|Ga0123356_10320110|Ga0123356_103201102
Length
204 aa
Sequence
MSMLAEKINLDGPDFNHSLVEPRFERILGTEYAMSSPGFKHQSILLAIGIQLKEKLQASACTPIIAPFDVYPFYDKNDKTTLVQPDILLACDKSKLKEKSYNGAPKFIIEILSPSNPYHDTLTKLQLYEKAGVSEYWIVNPEEQTISVFVLVESSPNLKELPEHLKIAKWDSKYICRDYSGEDEVPLVTIPGCTIDFKRIFAF*

📊 Sample Types

Isolate 5.4%
Metagenome 94.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 42.9%
Kalotermitidae 28.6%
Unclassified 14.3%
Rhinotermitidae 9.5%
Termopsidae 4.8%

🌳 Taxonomy

Archaea 0
Bacteria 108
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
2 2781125652 Treponema sp. Cu122P5bin1 Isolate Unclassified
3 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
4 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
7 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
8 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
9 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
10 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
11 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
12 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
13 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
14 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
15 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
16 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
17 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
18 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
19 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
20 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
21 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
22 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
23 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
24 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
25 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
26 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
27 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
28 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
29 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
30 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
31 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
32 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
33 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
34 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
35 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
36 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
37 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
38 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
39 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
40 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
41 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
42 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
43 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
44 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466711_024928 3300042615 Bacteria 2222
2 Ga0466702_313505 3300042635 Bacteria 1129
3 Ga0466708_371659 3300042652 Bacteria 1478
4 Ga0466722_042435 3300042609 Bacteria 2444
5 Ga0466722_254141 3300042609 Bacteria 5317
6 Ga0466699_072196 3300042597 Bacteria 50938
7 JGI24695J34938_10009284 3300002450 Bacteria 5483
8 Ga0072940_1004190 3300005200 Bacteria 1009
9 Ga0072941_1197123 3300005201 Bacteria 1059
10 Ga0466732_058235 3300042656 Bacteria 1263
11 Ga0466732_224211 3300042656 Bacteria 3795
12 Ga0466733_056743 3300042659 Bacteria 5346
13 Ga0466726_020784 3300042619 Bacteria 1654
14 Ga0466726_179388 3300042619 Bacteria 1441
15 Ga0466726_181985 3300042619 Bacteria 1922
16 Ga0466703_094970 3300042636 Bacteria 18155
17 Ga0466720_053992 3300042607 Bacteria 2788
18 Ga0466694_379696 3300042594 Bacteria 1325
19 Ga0466699_298057 3300042597 Bacteria 1649
20 JGI24695J34938_10001282 3300002450 Bacteria 22021
21 Ga0466705_413768 3300042612 Bacteria 3555
22 Ga0466726_394506 3300042619 Bacteria 2635
23 Ga0466728_006285 3300042620 Bacteria 1801
24 Ga0123356_10000838 3300010049 Bacteria 34198
25 Ga0466729_270399 3300042621 Bacteria 1138
26 Ga0466727_021757 3300042655 Bacteria 2717
27 Ga0456237_0027692 3300041968 Bacteria 767
28 Ga0466691_062514 3300042593 Bacteria 2970
29 Ga0466699_413294 3300042597 Bacteria 25958
30 JGI24698J34947_10017370 3300002449 Bacteria 3899
31 JGI24695J34938_10002232 3300002450 Bacteria 15038
32 Ga0466723_168112 3300042618 Bacteria 13051
33 Ga0123353_11629863 3300010167 Bacteria 813
34 Ga0466702_130742 3300042635 Bacteria 1677
35 Ga0466720_154729 3300042607 Bacteria 2694
36 Ga0415639_109620 3300038395 Unclassified 5524
37 Ga0466692_090779 3300042591 Bacteria 5915
38 JGI24695J34938_10000888 3300002450 Bacteria 27633
39 Ga0466705_027320 3300042612 Bacteria 6282
40 Ga0466715_201015 3300042616 Bacteria 1891
41 Ga0466726_020306 3300042619 Bacteria 1829
42 Ga0466726_170601 3300042619 Bacteria 1253
43 Ga0466726_397569 3300042619 Bacteria 1367
44 Ga0123356_10320110 3300010049 Bacteria 1664
45 Ga0123356_10606010 3300010049 Bacteria 1260
46 Ga0466722_078926 3300042609 Unclassified 3533
47 Ga0466698_189415 3300042610 Bacteria 2984
48 Ga0466690_095254 3300042590 Bacteria 2471
49 Ga0466690_196481 3300042590 Unclassified 1683
50 JGI24695J34938_10000812 3300002450 Bacteria 29016
51 JGI24695J34938_10001301 3300002450 Bacteria 21804
52 JGI24695J34938_10054519 3300002450 Bacteria 1733
53 Ga0466712_022029 3300042614 Bacteria 1288
54 Ga0466712_041345 3300042614 Bacteria 10603
55 Ga0466712_047633 3300042614 Bacteria 1310
56 Ga0466712_139761 3300042614 Bacteria 10657
57 Ga0466715_167147 3300042616 Bacteria 1033
58 Ga0466718_078038 3300042617 Bacteria 7799
59 Ga0466723_007674 3300042618 Bacteria 5140
60 Ga0466726_423058 3300042619 Bacteria 3123
61 Ga0123353_10222492 3300010167 Bacteria 2950
62 Ga0466703_004622 3300042636 Bacteria 4513
63 Ga0466704_163942 3300042643 Bacteria 2317
64 Ga0466709_275042 3300042648 Bacteria 8776
65 Ga0466727_279124 3300042655 Bacteria 3832
66 Ga0466698_495724 3300042610 Bacteria 2449
67 Ga0456237_0035530 3300041968 Unclassified 662
68 Ga0466692_021014 3300042591 Bacteria 5470
69 Ga0466692_025741 3300042591 Bacteria 2007
70 Ga0466692_102840 3300042591 Bacteria 1945
71 Ga0466694_146682 3300042594 Bacteria 1573
72 Ga0466694_361319 3300042594 Bacteria 1154
73 Ga0466699_017555 3300042597 Bacteria 1846
74 Ga0466699_101817 3300042597 Bacteria 2964
75 AustNasuHG_c1000942 3300000089 Bacteria 10535
76 JGI24695J34938_10001346 3300002450 Bacteria 21222
77 JGI24705J35276_12084383 3300002504 Bacteria 980
78 Ga0466711_280813 3300042615 Bacteria 31488
79 Ga0466715_165766 3300042616 Bacteria 7401
80 Ga0123356_11245750 3300010049 Bacteria 909
81 Ga0466704_075050 3300042643 Bacteria 1394
82 Ga0466704_144043 3300042643 Bacteria 2655
83 Ga0466727_022127 3300042655 Bacteria 2103
84 Ga0466727_266543 3300042655 Bacteria 2073
85 Ga0466700_341623 3300042600 Bacteria 3248
86 Ga0466722_135996 3300042609 Bacteria 1438
87 Ga0264413_128922 3300024493 Bacteria 1094
88 Ga0466694_126985 3300042594 Bacteria 1310
89 AustNasuHG_c1051453 3300000089 Bacteria 875
90 JGI24698J34947_10071923 3300002449 Bacteria 1658
91 JGI24695J34938_10001554 3300002450 Bacteria 19336
92 Ga0466732_150364 3300042656 Bacteria 1906
93 Ga0466715_308836 3300042616 Bacteria 4131
94 Ga0466718_160065 3300042617 Bacteria 2554
95 Ga0466726_079418 3300042619 Bacteria 1695
96 Ga0466728_452311 3300042620 Bacteria 2736
97 Ga0123356_10053905 3300010049 Bacteria 3744
98 Ga0466702_091401 3300042635 Bacteria 2326
99 Ga0466708_160572 3300042652 Bacteria 3272
100 Ga0466727_211346 3300042655 Bacteria 1544
101 Ga0466719_442109 3300042606 Bacteria 2360
102 Ga0466722_025573 3300042609 Bacteria 19941
103 Ga0466698_124079 3300042610 Bacteria 1107
104 Ga0466699_002418 3300042597 Bacteria 16049
105 JGI24698J34947_10009318 3300002449 Bacteria 5391

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042590 Ga0466690_095254 Ga0466690_095254_1946_2446 166
2 3300002504 JGI24705J35276_12084383 JGI24705J35276_120843832 171
3 iso_pr_bacteria 2781125658 2781324952 174
4 3300010049 Ga0123356_10000838 Ga0123356_1000083823 175
5 3300041968 Ga0456237_0035530 Ga0456237_0035530_80_625 175
6 3300042619 Ga0466726_020784 Ga0466726_020784_254_781 175
7 3300024493 Ga0264413_128922 Ga0264413_1289221 176
8 3300042607 Ga0466720_053992 Ga0466720_053992_499_1029 176
9 3300042607 Ga0466720_154729 Ga0466720_154729_696_1226 176
10 3300042656 Ga0466732_058235 Ga0466732_058235_459_989 176
11 3300000089 AustNasuHG_c1051453 AustNasuHG_10514532 177
12 3300038395 Ga0415639_109620 Ga0415639_109620_4637_5170 177
13 3300010167 Ga0123353_10222492 Ga0123353_102224923 178
14 3300042600 Ga0466700_341623 Ga0466700_341623_2277_2813 178
15 3300042610 Ga0466698_124079 Ga0466698_124079_17_556 179
16 3300042610 Ga0466698_189415 Ga0466698_189415_321_860 179
17 3300042614 Ga0466712_139761 Ga0466712_139761_7992_8531 179
18 3300042619 Ga0466726_020306 Ga0466726_020306_254_793 179
19 3300042655 Ga0466727_021757 Ga0466727_021757_1636_2175 179
20 3300042655 Ga0466727_266543 Ga0466727_266543_1309_1848 179
21 3300042656 Ga0466732_224211 Ga0466732_224211_1594_2133 179
22 3300002449 JGI24698J34947_10071923 JGI24698J34947_100719232 180
23 3300005200 Ga0072940_1004190 Ga0072940_10041902 180
24 3300010167 Ga0123353_11629863 Ga0123353_116298631 180
25 3300042609 Ga0466722_078926 Ga0466722_078926_2535_3077 180
26 3300042617 Ga0466718_078038 Ga0466718_078038_3550_4092 180
27 3300042619 Ga0466726_170601 Ga0466726_170601_135_677 180
28 3300042655 Ga0466727_279124 Ga0466727_279124_2563_3105 180
29 3300002450 JGI24695J34938_10001282 JGI24695J34938_100012826 181
30 3300041968 Ga0456237_0027692 Ga0456237_0027692_99_644 181
31 3300042591 Ga0466692_021014 Ga0466692_021014_592_1137 181
32 3300042591 Ga0466692_090779 Ga0466692_090779_5074_5619 181
33 3300042593 Ga0466691_062514 Ga0466691_062514_2374_2919 181
34 3300042594 Ga0466694_126985 Ga0466694_126985_720_1265 181
35 3300042594 Ga0466694_361319 Ga0466694_361319_208_753 181
36 3300042609 Ga0466722_025573 Ga0466722_025573_2933_3478 181
37 3300042609 Ga0466722_042435 Ga0466722_042435_1397_1942 181
38 3300042618 Ga0466723_007674 Ga0466723_007674_3840_4385 181
39 3300042618 Ga0466723_168112 Ga0466723_168112_1777_2322 181
40 3300042619 Ga0466726_179388 Ga0466726_179388_106_651 181
41 3300042619 Ga0466726_181985 Ga0466726_181985_1052_1597 181
42 3300042619 Ga0466726_394506 Ga0466726_394506_1970_2515 181
43 3300042620 Ga0466728_452311 Ga0466728_452311_16_561 181
44 3300042643 Ga0466704_144043 Ga0466704_144043_2056_2601 181
45 3300042648 Ga0466709_275042 Ga0466709_275042_246_791 181
46 3300042652 Ga0466708_160572 Ga0466708_160572_73_618 181
47 3300002450 JGI24695J34938_10000812 JGI24695J34938_100008126 182
48 3300002450 JGI24695J34938_10054519 JGI24695J34938_100545191 182
49 3300042594 Ga0466694_379696 Ga0466694_379696_227_775 182
50 3300042597 Ga0466699_017555 Ga0466699_017555_574_1122 182
51 3300042609 Ga0466722_135996 Ga0466722_135996_436_984 182
52 3300042616 Ga0466715_165766 Ga0466715_165766_273_821 182
53 3300042616 Ga0466715_167147 Ga0466715_167147_437_985 182
54 3300042616 Ga0466715_201015 Ga0466715_201015_1098_1646 182
55 3300042620 Ga0466728_006285 Ga0466728_006285_179_727 182
56 3300042636 Ga0466703_004622 Ga0466703_004622_1435_1983 182
57 3300042636 Ga0466703_094970 Ga0466703_094970_1574_2122 182
58 3300042636 Ga0466703_094970 Ga0466703_094970_948_1496 182
59 3300042655 Ga0466727_022127 Ga0466727_022127_305_853 182
60 iso_pr_bacteria 2781125631 2781267787 182
61 iso_pr_bacteria 2781125634 2781275209 182
62 iso_pr_bacteria 2781125637 2781281771 182
63 iso_pr_bacteria 2781125638 2781284525 182
64 3300002450 JGI24695J34938_10001301 JGI24695J34938_1000130117 183
65 3300002450 JGI24695J34938_10001554 JGI24695J34938_100015543 183
66 3300002450 JGI24695J34938_10002232 JGI24695J34938_100022323 183
67 3300042610 Ga0466698_495724 Ga0466698_495724_1574_2125 183
68 3300042617 Ga0466718_160065 Ga0466718_160065_1657_2208 183
69 3300042619 Ga0466726_397569 Ga0466726_397569_93_644 183
70 3300042619 Ga0466726_423058 Ga0466726_423058_1468_2019 183
71 3300042656 Ga0466732_150364 Ga0466732_150364_1241_1792 183
72 3300042659 Ga0466733_056743 Ga0466733_056743_4730_5281 183
73 iso_pr_bacteria 2781125652 2781311528 183
74 3300002450 JGI24695J34938_10001346 JGI24695J34938_1000134616 184
75 3300042616 Ga0466715_308836 Ga0466715_308836_174_728 184
76 3300042619 Ga0466726_079418 Ga0466726_079418_518_1072 184
77 3300002449 JGI24698J34947_10017370 JGI24698J34947_100173701 185
78 3300010049 Ga0123356_11245750 Ga0123356_112457502 185
79 3300042597 Ga0466699_072196 Ga0466699_072196_50258_50815 185
80 3300042597 Ga0466699_101817 Ga0466699_101817_1863_2420 185
81 3300042597 Ga0466699_413294 Ga0466699_413294_11495_12052 185
82 3300042609 Ga0466722_254141 Ga0466722_254141_1688_2245 185
83 3300005201 Ga0072941_1197123 Ga0072941_11971232 186
84 3300042614 Ga0466712_041345 Ga0466712_041345_4406_4966 186
85 3300042615 Ga0466711_280813 Ga0466711_280813_6491_7051 186
86 3300000089 AustNasuHG_c1000942 AustNasuHG_10009428 188
87 3300042594 Ga0466694_146682 Ga0466694_146682_829_1395 188
88 3300042621 Ga0466729_270399 Ga0466729_270399_79_645 188
89 3300042655 Ga0466727_211346 Ga0466727_211346_89_655 188
90 3300042614 Ga0466712_022029 Ga0466712_022029_357_926 189
91 3300042614 Ga0466712_047633 Ga0466712_047633_661_1230 189
92 3300042643 Ga0466704_075050 Ga0466704_075050_551_1120 189
93 3300002449 JGI24698J34947_10009318 JGI24698J34947_100093183 190
94 3300042591 Ga0466692_025741 Ga0466692_025741_1252_1824 190
95 3300042597 Ga0466699_002418 Ga0466699_002418_5390_5962 190
96 3300042597 Ga0466699_298057 Ga0466699_298057_268_840 190
97 3300002450 JGI24695J34938_10009284 JGI24695J34938_100092842 191
98 3300042591 Ga0466692_102840 Ga0466692_102840_1117_1692 191
99 3300042635 Ga0466702_130742 Ga0466702_130742_906_1481 191
100 3300042635 Ga0466702_091401 Ga0466702_091401_166_744 192
101 3300042590 Ga0466690_196481 Ga0466690_196481_639_1220 193
102 3300042635 Ga0466702_313505 Ga0466702_313505_242_823 193
103 3300042612 Ga0466705_027320 Ga0466705_027320_4705_5289 194
104 3300042612 Ga0466705_413768 Ga0466705_413768_402_989 195
105 3300042615 Ga0466711_024928 Ga0466711_024928_1458_2051 197
106 3300010049 Ga0123356_10053905 Ga0123356_100539054 201
107 3300042606 Ga0466719_442109 Ga0466719_442109_828_1433 201
108 3300002450 JGI24695J34938_10000888 JGI24695J34938_1000088825 203
109 3300010049 Ga0123356_10320110 Ga0123356_103201102 204
110 3300042643 Ga0466704_163942 Ga0466704_163942_1122_1736 204
111 3300042652 Ga0466708_371659 Ga0466708_371659_254_868 204
112 3300010049 Ga0123356_10606010 Ga0123356_106060102 212

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF05685 Uma2 Putative restriction endonuclease 21 154 0.87

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.77 0.83 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.