Protein Family IF02891
Metagenome
Isolate
112
Members
44
Samples
105
Scaffolds
184.02
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_10320110|Ga0123356_103201102
- Length
- 204 aa
- Sequence
- MSMLAEKINLDGPDFNHSLVEPRFERILGTEYAMSSPGFKHQSILLAIGIQLKEKLQASACTPIIAPFDVYPFYDKNDKTTLVQPDILLACDKSKLKEKSYNGAPKFIIEILSPSNPYHDTLTKLQLYEKAGVSEYWIVNPEEQTISVFVLVESSPNLKELPEHLKIAKWDSKYICRDYSGEDEVPLVTIPGCTIDFKRIFAF*
Sample Types
Isolate
5.4%
Metagenome
94.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
42.9%
Kalotermitidae
28.6%
Unclassified
14.3%
Rhinotermitidae
9.5%
Termopsidae
4.8%
Taxonomy
Archaea
0
Bacteria
108
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 2 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 11 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 12 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 13 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 14 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 15 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 16 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 17 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 18 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 19 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 20 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 21 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 22 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 23 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 24 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 25 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 26 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 27 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 28 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 29 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 30 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 31 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 32 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 33 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 34 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 35 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 36 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 37 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 38 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 39 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 40 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 41 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 42 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 43 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 44 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466711_024928 | 3300042615 | Bacteria | 2222 |
| 2 | Ga0466702_313505 | 3300042635 | Bacteria | 1129 |
| 3 | Ga0466708_371659 | 3300042652 | Bacteria | 1478 |
| 4 | Ga0466722_042435 | 3300042609 | Bacteria | 2444 |
| 5 | Ga0466722_254141 | 3300042609 | Bacteria | 5317 |
| 6 | Ga0466699_072196 | 3300042597 | Bacteria | 50938 |
| 7 | JGI24695J34938_10009284 | 3300002450 | Bacteria | 5483 |
| 8 | Ga0072940_1004190 | 3300005200 | Bacteria | 1009 |
| 9 | Ga0072941_1197123 | 3300005201 | Bacteria | 1059 |
| 10 | Ga0466732_058235 | 3300042656 | Bacteria | 1263 |
| 11 | Ga0466732_224211 | 3300042656 | Bacteria | 3795 |
| 12 | Ga0466733_056743 | 3300042659 | Bacteria | 5346 |
| 13 | Ga0466726_020784 | 3300042619 | Bacteria | 1654 |
| 14 | Ga0466726_179388 | 3300042619 | Bacteria | 1441 |
| 15 | Ga0466726_181985 | 3300042619 | Bacteria | 1922 |
| 16 | Ga0466703_094970 | 3300042636 | Bacteria | 18155 |
| 17 | Ga0466720_053992 | 3300042607 | Bacteria | 2788 |
| 18 | Ga0466694_379696 | 3300042594 | Bacteria | 1325 |
| 19 | Ga0466699_298057 | 3300042597 | Bacteria | 1649 |
| 20 | JGI24695J34938_10001282 | 3300002450 | Bacteria | 22021 |
| 21 | Ga0466705_413768 | 3300042612 | Bacteria | 3555 |
| 22 | Ga0466726_394506 | 3300042619 | Bacteria | 2635 |
| 23 | Ga0466728_006285 | 3300042620 | Bacteria | 1801 |
| 24 | Ga0123356_10000838 | 3300010049 | Bacteria | 34198 |
| 25 | Ga0466729_270399 | 3300042621 | Bacteria | 1138 |
| 26 | Ga0466727_021757 | 3300042655 | Bacteria | 2717 |
| 27 | Ga0456237_0027692 | 3300041968 | Bacteria | 767 |
| 28 | Ga0466691_062514 | 3300042593 | Bacteria | 2970 |
| 29 | Ga0466699_413294 | 3300042597 | Bacteria | 25958 |
| 30 | JGI24698J34947_10017370 | 3300002449 | Bacteria | 3899 |
| 31 | JGI24695J34938_10002232 | 3300002450 | Bacteria | 15038 |
| 32 | Ga0466723_168112 | 3300042618 | Bacteria | 13051 |
| 33 | Ga0123353_11629863 | 3300010167 | Bacteria | 813 |
| 34 | Ga0466702_130742 | 3300042635 | Bacteria | 1677 |
| 35 | Ga0466720_154729 | 3300042607 | Bacteria | 2694 |
| 36 | Ga0415639_109620 | 3300038395 | Unclassified | 5524 |
| 37 | Ga0466692_090779 | 3300042591 | Bacteria | 5915 |
| 38 | JGI24695J34938_10000888 | 3300002450 | Bacteria | 27633 |
| 39 | Ga0466705_027320 | 3300042612 | Bacteria | 6282 |
| 40 | Ga0466715_201015 | 3300042616 | Bacteria | 1891 |
| 41 | Ga0466726_020306 | 3300042619 | Bacteria | 1829 |
| 42 | Ga0466726_170601 | 3300042619 | Bacteria | 1253 |
| 43 | Ga0466726_397569 | 3300042619 | Bacteria | 1367 |
| 44 | Ga0123356_10320110 | 3300010049 | Bacteria | 1664 |
| 45 | Ga0123356_10606010 | 3300010049 | Bacteria | 1260 |
| 46 | Ga0466722_078926 | 3300042609 | Unclassified | 3533 |
| 47 | Ga0466698_189415 | 3300042610 | Bacteria | 2984 |
| 48 | Ga0466690_095254 | 3300042590 | Bacteria | 2471 |
| 49 | Ga0466690_196481 | 3300042590 | Unclassified | 1683 |
| 50 | JGI24695J34938_10000812 | 3300002450 | Bacteria | 29016 |
| 51 | JGI24695J34938_10001301 | 3300002450 | Bacteria | 21804 |
| 52 | JGI24695J34938_10054519 | 3300002450 | Bacteria | 1733 |
| 53 | Ga0466712_022029 | 3300042614 | Bacteria | 1288 |
| 54 | Ga0466712_041345 | 3300042614 | Bacteria | 10603 |
| 55 | Ga0466712_047633 | 3300042614 | Bacteria | 1310 |
| 56 | Ga0466712_139761 | 3300042614 | Bacteria | 10657 |
| 57 | Ga0466715_167147 | 3300042616 | Bacteria | 1033 |
| 58 | Ga0466718_078038 | 3300042617 | Bacteria | 7799 |
| 59 | Ga0466723_007674 | 3300042618 | Bacteria | 5140 |
| 60 | Ga0466726_423058 | 3300042619 | Bacteria | 3123 |
| 61 | Ga0123353_10222492 | 3300010167 | Bacteria | 2950 |
| 62 | Ga0466703_004622 | 3300042636 | Bacteria | 4513 |
| 63 | Ga0466704_163942 | 3300042643 | Bacteria | 2317 |
| 64 | Ga0466709_275042 | 3300042648 | Bacteria | 8776 |
| 65 | Ga0466727_279124 | 3300042655 | Bacteria | 3832 |
| 66 | Ga0466698_495724 | 3300042610 | Bacteria | 2449 |
| 67 | Ga0456237_0035530 | 3300041968 | Unclassified | 662 |
| 68 | Ga0466692_021014 | 3300042591 | Bacteria | 5470 |
| 69 | Ga0466692_025741 | 3300042591 | Bacteria | 2007 |
| 70 | Ga0466692_102840 | 3300042591 | Bacteria | 1945 |
| 71 | Ga0466694_146682 | 3300042594 | Bacteria | 1573 |
| 72 | Ga0466694_361319 | 3300042594 | Bacteria | 1154 |
| 73 | Ga0466699_017555 | 3300042597 | Bacteria | 1846 |
| 74 | Ga0466699_101817 | 3300042597 | Bacteria | 2964 |
| 75 | AustNasuHG_c1000942 | 3300000089 | Bacteria | 10535 |
| 76 | JGI24695J34938_10001346 | 3300002450 | Bacteria | 21222 |
| 77 | JGI24705J35276_12084383 | 3300002504 | Bacteria | 980 |
| 78 | Ga0466711_280813 | 3300042615 | Bacteria | 31488 |
| 79 | Ga0466715_165766 | 3300042616 | Bacteria | 7401 |
| 80 | Ga0123356_11245750 | 3300010049 | Bacteria | 909 |
| 81 | Ga0466704_075050 | 3300042643 | Bacteria | 1394 |
| 82 | Ga0466704_144043 | 3300042643 | Bacteria | 2655 |
| 83 | Ga0466727_022127 | 3300042655 | Bacteria | 2103 |
| 84 | Ga0466727_266543 | 3300042655 | Bacteria | 2073 |
| 85 | Ga0466700_341623 | 3300042600 | Bacteria | 3248 |
| 86 | Ga0466722_135996 | 3300042609 | Bacteria | 1438 |
| 87 | Ga0264413_128922 | 3300024493 | Bacteria | 1094 |
| 88 | Ga0466694_126985 | 3300042594 | Bacteria | 1310 |
| 89 | AustNasuHG_c1051453 | 3300000089 | Bacteria | 875 |
| 90 | JGI24698J34947_10071923 | 3300002449 | Bacteria | 1658 |
| 91 | JGI24695J34938_10001554 | 3300002450 | Bacteria | 19336 |
| 92 | Ga0466732_150364 | 3300042656 | Bacteria | 1906 |
| 93 | Ga0466715_308836 | 3300042616 | Bacteria | 4131 |
| 94 | Ga0466718_160065 | 3300042617 | Bacteria | 2554 |
| 95 | Ga0466726_079418 | 3300042619 | Bacteria | 1695 |
| 96 | Ga0466728_452311 | 3300042620 | Bacteria | 2736 |
| 97 | Ga0123356_10053905 | 3300010049 | Bacteria | 3744 |
| 98 | Ga0466702_091401 | 3300042635 | Bacteria | 2326 |
| 99 | Ga0466708_160572 | 3300042652 | Bacteria | 3272 |
| 100 | Ga0466727_211346 | 3300042655 | Bacteria | 1544 |
| 101 | Ga0466719_442109 | 3300042606 | Bacteria | 2360 |
| 102 | Ga0466722_025573 | 3300042609 | Bacteria | 19941 |
| 103 | Ga0466698_124079 | 3300042610 | Bacteria | 1107 |
| 104 | Ga0466699_002418 | 3300042597 | Bacteria | 16049 |
| 105 | JGI24698J34947_10009318 | 3300002449 | Bacteria | 5391 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042590 | Ga0466690_095254 | Ga0466690_095254_1946_2446 | 166 |
| 2 | 3300002504 | JGI24705J35276_12084383 | JGI24705J35276_120843832 | 171 |
| 3 | iso_pr_bacteria | 2781125658 | 2781324952 | 174 |
| 4 | 3300010049 | Ga0123356_10000838 | Ga0123356_1000083823 | 175 |
| 5 | 3300041968 | Ga0456237_0035530 | Ga0456237_0035530_80_625 | 175 |
| 6 | 3300042619 | Ga0466726_020784 | Ga0466726_020784_254_781 | 175 |
| 7 | 3300024493 | Ga0264413_128922 | Ga0264413_1289221 | 176 |
| 8 | 3300042607 | Ga0466720_053992 | Ga0466720_053992_499_1029 | 176 |
| 9 | 3300042607 | Ga0466720_154729 | Ga0466720_154729_696_1226 | 176 |
| 10 | 3300042656 | Ga0466732_058235 | Ga0466732_058235_459_989 | 176 |
| 11 | 3300000089 | AustNasuHG_c1051453 | AustNasuHG_10514532 | 177 |
| 12 | 3300038395 | Ga0415639_109620 | Ga0415639_109620_4637_5170 | 177 |
| 13 | 3300010167 | Ga0123353_10222492 | Ga0123353_102224923 | 178 |
| 14 | 3300042600 | Ga0466700_341623 | Ga0466700_341623_2277_2813 | 178 |
| 15 | 3300042610 | Ga0466698_124079 | Ga0466698_124079_17_556 | 179 |
| 16 | 3300042610 | Ga0466698_189415 | Ga0466698_189415_321_860 | 179 |
| 17 | 3300042614 | Ga0466712_139761 | Ga0466712_139761_7992_8531 | 179 |
| 18 | 3300042619 | Ga0466726_020306 | Ga0466726_020306_254_793 | 179 |
| 19 | 3300042655 | Ga0466727_021757 | Ga0466727_021757_1636_2175 | 179 |
| 20 | 3300042655 | Ga0466727_266543 | Ga0466727_266543_1309_1848 | 179 |
| 21 | 3300042656 | Ga0466732_224211 | Ga0466732_224211_1594_2133 | 179 |
| 22 | 3300002449 | JGI24698J34947_10071923 | JGI24698J34947_100719232 | 180 |
| 23 | 3300005200 | Ga0072940_1004190 | Ga0072940_10041902 | 180 |
| 24 | 3300010167 | Ga0123353_11629863 | Ga0123353_116298631 | 180 |
| 25 | 3300042609 | Ga0466722_078926 | Ga0466722_078926_2535_3077 | 180 |
| 26 | 3300042617 | Ga0466718_078038 | Ga0466718_078038_3550_4092 | 180 |
| 27 | 3300042619 | Ga0466726_170601 | Ga0466726_170601_135_677 | 180 |
| 28 | 3300042655 | Ga0466727_279124 | Ga0466727_279124_2563_3105 | 180 |
| 29 | 3300002450 | JGI24695J34938_10001282 | JGI24695J34938_100012826 | 181 |
| 30 | 3300041968 | Ga0456237_0027692 | Ga0456237_0027692_99_644 | 181 |
| 31 | 3300042591 | Ga0466692_021014 | Ga0466692_021014_592_1137 | 181 |
| 32 | 3300042591 | Ga0466692_090779 | Ga0466692_090779_5074_5619 | 181 |
| 33 | 3300042593 | Ga0466691_062514 | Ga0466691_062514_2374_2919 | 181 |
| 34 | 3300042594 | Ga0466694_126985 | Ga0466694_126985_720_1265 | 181 |
| 35 | 3300042594 | Ga0466694_361319 | Ga0466694_361319_208_753 | 181 |
| 36 | 3300042609 | Ga0466722_025573 | Ga0466722_025573_2933_3478 | 181 |
| 37 | 3300042609 | Ga0466722_042435 | Ga0466722_042435_1397_1942 | 181 |
| 38 | 3300042618 | Ga0466723_007674 | Ga0466723_007674_3840_4385 | 181 |
| 39 | 3300042618 | Ga0466723_168112 | Ga0466723_168112_1777_2322 | 181 |
| 40 | 3300042619 | Ga0466726_179388 | Ga0466726_179388_106_651 | 181 |
| 41 | 3300042619 | Ga0466726_181985 | Ga0466726_181985_1052_1597 | 181 |
| 42 | 3300042619 | Ga0466726_394506 | Ga0466726_394506_1970_2515 | 181 |
| 43 | 3300042620 | Ga0466728_452311 | Ga0466728_452311_16_561 | 181 |
| 44 | 3300042643 | Ga0466704_144043 | Ga0466704_144043_2056_2601 | 181 |
| 45 | 3300042648 | Ga0466709_275042 | Ga0466709_275042_246_791 | 181 |
| 46 | 3300042652 | Ga0466708_160572 | Ga0466708_160572_73_618 | 181 |
| 47 | 3300002450 | JGI24695J34938_10000812 | JGI24695J34938_100008126 | 182 |
| 48 | 3300002450 | JGI24695J34938_10054519 | JGI24695J34938_100545191 | 182 |
| 49 | 3300042594 | Ga0466694_379696 | Ga0466694_379696_227_775 | 182 |
| 50 | 3300042597 | Ga0466699_017555 | Ga0466699_017555_574_1122 | 182 |
| 51 | 3300042609 | Ga0466722_135996 | Ga0466722_135996_436_984 | 182 |
| 52 | 3300042616 | Ga0466715_165766 | Ga0466715_165766_273_821 | 182 |
| 53 | 3300042616 | Ga0466715_167147 | Ga0466715_167147_437_985 | 182 |
| 54 | 3300042616 | Ga0466715_201015 | Ga0466715_201015_1098_1646 | 182 |
| 55 | 3300042620 | Ga0466728_006285 | Ga0466728_006285_179_727 | 182 |
| 56 | 3300042636 | Ga0466703_004622 | Ga0466703_004622_1435_1983 | 182 |
| 57 | 3300042636 | Ga0466703_094970 | Ga0466703_094970_1574_2122 | 182 |
| 58 | 3300042636 | Ga0466703_094970 | Ga0466703_094970_948_1496 | 182 |
| 59 | 3300042655 | Ga0466727_022127 | Ga0466727_022127_305_853 | 182 |
| 60 | iso_pr_bacteria | 2781125631 | 2781267787 | 182 |
| 61 | iso_pr_bacteria | 2781125634 | 2781275209 | 182 |
| 62 | iso_pr_bacteria | 2781125637 | 2781281771 | 182 |
| 63 | iso_pr_bacteria | 2781125638 | 2781284525 | 182 |
| 64 | 3300002450 | JGI24695J34938_10001301 | JGI24695J34938_1000130117 | 183 |
| 65 | 3300002450 | JGI24695J34938_10001554 | JGI24695J34938_100015543 | 183 |
| 66 | 3300002450 | JGI24695J34938_10002232 | JGI24695J34938_100022323 | 183 |
| 67 | 3300042610 | Ga0466698_495724 | Ga0466698_495724_1574_2125 | 183 |
| 68 | 3300042617 | Ga0466718_160065 | Ga0466718_160065_1657_2208 | 183 |
| 69 | 3300042619 | Ga0466726_397569 | Ga0466726_397569_93_644 | 183 |
| 70 | 3300042619 | Ga0466726_423058 | Ga0466726_423058_1468_2019 | 183 |
| 71 | 3300042656 | Ga0466732_150364 | Ga0466732_150364_1241_1792 | 183 |
| 72 | 3300042659 | Ga0466733_056743 | Ga0466733_056743_4730_5281 | 183 |
| 73 | iso_pr_bacteria | 2781125652 | 2781311528 | 183 |
| 74 | 3300002450 | JGI24695J34938_10001346 | JGI24695J34938_1000134616 | 184 |
| 75 | 3300042616 | Ga0466715_308836 | Ga0466715_308836_174_728 | 184 |
| 76 | 3300042619 | Ga0466726_079418 | Ga0466726_079418_518_1072 | 184 |
| 77 | 3300002449 | JGI24698J34947_10017370 | JGI24698J34947_100173701 | 185 |
| 78 | 3300010049 | Ga0123356_11245750 | Ga0123356_112457502 | 185 |
| 79 | 3300042597 | Ga0466699_072196 | Ga0466699_072196_50258_50815 | 185 |
| 80 | 3300042597 | Ga0466699_101817 | Ga0466699_101817_1863_2420 | 185 |
| 81 | 3300042597 | Ga0466699_413294 | Ga0466699_413294_11495_12052 | 185 |
| 82 | 3300042609 | Ga0466722_254141 | Ga0466722_254141_1688_2245 | 185 |
| 83 | 3300005201 | Ga0072941_1197123 | Ga0072941_11971232 | 186 |
| 84 | 3300042614 | Ga0466712_041345 | Ga0466712_041345_4406_4966 | 186 |
| 85 | 3300042615 | Ga0466711_280813 | Ga0466711_280813_6491_7051 | 186 |
| 86 | 3300000089 | AustNasuHG_c1000942 | AustNasuHG_10009428 | 188 |
| 87 | 3300042594 | Ga0466694_146682 | Ga0466694_146682_829_1395 | 188 |
| 88 | 3300042621 | Ga0466729_270399 | Ga0466729_270399_79_645 | 188 |
| 89 | 3300042655 | Ga0466727_211346 | Ga0466727_211346_89_655 | 188 |
| 90 | 3300042614 | Ga0466712_022029 | Ga0466712_022029_357_926 | 189 |
| 91 | 3300042614 | Ga0466712_047633 | Ga0466712_047633_661_1230 | 189 |
| 92 | 3300042643 | Ga0466704_075050 | Ga0466704_075050_551_1120 | 189 |
| 93 | 3300002449 | JGI24698J34947_10009318 | JGI24698J34947_100093183 | 190 |
| 94 | 3300042591 | Ga0466692_025741 | Ga0466692_025741_1252_1824 | 190 |
| 95 | 3300042597 | Ga0466699_002418 | Ga0466699_002418_5390_5962 | 190 |
| 96 | 3300042597 | Ga0466699_298057 | Ga0466699_298057_268_840 | 190 |
| 97 | 3300002450 | JGI24695J34938_10009284 | JGI24695J34938_100092842 | 191 |
| 98 | 3300042591 | Ga0466692_102840 | Ga0466692_102840_1117_1692 | 191 |
| 99 | 3300042635 | Ga0466702_130742 | Ga0466702_130742_906_1481 | 191 |
| 100 | 3300042635 | Ga0466702_091401 | Ga0466702_091401_166_744 | 192 |
| 101 | 3300042590 | Ga0466690_196481 | Ga0466690_196481_639_1220 | 193 |
| 102 | 3300042635 | Ga0466702_313505 | Ga0466702_313505_242_823 | 193 |
| 103 | 3300042612 | Ga0466705_027320 | Ga0466705_027320_4705_5289 | 194 |
| 104 | 3300042612 | Ga0466705_413768 | Ga0466705_413768_402_989 | 195 |
| 105 | 3300042615 | Ga0466711_024928 | Ga0466711_024928_1458_2051 | 197 |
| 106 | 3300010049 | Ga0123356_10053905 | Ga0123356_100539054 | 201 |
| 107 | 3300042606 | Ga0466719_442109 | Ga0466719_442109_828_1433 | 201 |
| 108 | 3300002450 | JGI24695J34938_10000888 | JGI24695J34938_1000088825 | 203 |
| 109 | 3300010049 | Ga0123356_10320110 | Ga0123356_103201102 | 204 |
| 110 | 3300042643 | Ga0466704_163942 | Ga0466704_163942_1122_1736 | 204 |
| 111 | 3300042652 | Ga0466708_371659 | Ga0466708_371659_254_868 | 204 |
| 112 | 3300010049 | Ga0123356_10606010 | Ga0123356_106060102 | 212 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF05685 | Uma2 | Putative restriction endonuclease | 21 | 154 | 0.87 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.77 | 0.83 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.