Protein Family IF02822
Metagenome
Isolate
171
Members
84
Samples
136
Scaffolds
314.68
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_10135057|Ga0123356_101350572
- Length
- 331 aa
- Sequence
- VDKKIVLGDALMNANLAKMSGKKYRLVTRSDFDGLVCGMLLTELDLVDDIKFVHPKDMQDGIIELSERDITTNLPYQPVCSFVFDHHESELLRIAAVNAENYIVDPHAPSAARVVYDWLGGRETFPRIDVEMMAAVDKADSAQFNREDILDAKAWELLSFLMDSRTGLGRFREFRISNYLLMMELIAYCKTHTIDEILKHPDVDERVQIYRAHEKQFREQVLRCTKMHNKVAVLDLRNEKTIWAGNRFMVYALFPEANVSIHVLWGLRMQNTVFAVGKSIFDRSSNTNIGALMLKYGGGGHAAAGTCQIPNEDADKILNELVEAIKLDEP*
Sample Types
Isolate
20.5%
Metagenome
79.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
35.9%
Termitidae
30.8%
Kalotermitidae
16.7%
Elmidae
6.4%
Termopsidae
5.1%
Rhinotermitidae
3.8%
Hodotermitidae
1.3%
Taxonomy
Archaea
1
Bacteria
153
Eukaryota
0
Viruses
0
Unclassified
17
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 2 | 2627854002 | Vibrio nigripulchritudo ENn2 | Isolate | Unclassified |
| 3 | 2820042117 | Unclassified Proteobacteria Th196P4bin58 | Isolate | Unclassified |
| 4 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 5 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 6 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 7 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 8 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 9 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 10 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 11 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 12 | 2820947865 | Unclassified Acidobacteria Nt197P3bin133 | Isolate | Unclassified |
| 13 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 14 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 15 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 16 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 17 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 18 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 19 | 2609459958 | Vibrio nigripulchritudo Wn13 | Isolate | Unclassified |
| 20 | 2630968716 | Vibrio nigripulchritudo AM115 | Isolate | Unclassified |
| 21 | 2636415542 | Vibrio nigripulchritudo SFn135 | Isolate | Unclassified |
| 22 | 2778260937 | Unclassified Fibrobacteres Co191P3bin40 | Isolate | Unclassified |
| 23 | 2820716747 | Unclassified Fibrobacteres Nc150P3bin18 | Isolate | Unclassified |
| 24 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 25 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 26 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 27 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 28 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 29 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 30 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 31 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 32 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 33 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 34 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 35 | 2833478085 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 36 | 2864812326 | Chitinimonas taiwanensis S00057 | Isolate | Elmidae |
| 37 | 2648501820 | Vibrio nigripulchritudo BLFn1 | Isolate | Unclassified |
| 38 | 2778260941 | Unclassified Fibrobacteres Th196P3bin8 | Isolate | Unclassified |
| 39 | 2864808494 | Chitinimonas taiwanensis S00056 | Isolate | Elmidae |
| 40 | 2636416028 | Pelosinus propionicus DSM 13327 | Isolate | Unclassified |
| 41 | 2740892546 | Fibrobacteria bacterium GUT307 IN01_307 | Isolate | Unclassified |
| 42 | 2778260939 | Unclassified Fibrobacteres Co191P4bin13 | Isolate | Unclassified |
| 43 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 44 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 45 | 8051551332 | Vibrio vulnificus Vv003 | Isolate | |
| 46 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 47 | 2902896024 | Pseudoalteromonas sp. S1612 | Isolate | Unclassified |
| 48 | 2565956518 | Vibrio pacinii DSM 19139 | Isolate | Unclassified |
| 49 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 50 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 51 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 52 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 53 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 54 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 55 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 56 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 57 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 58 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 59 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 60 | 2896925746 | Vibrio nigripulchritudo SFn27 | Isolate | Unclassified |
| 61 | 2609459925 | Vibrio nigripulchritudo SO65 | Isolate | Unclassified |
| 62 | 2627853677 | Vibrio nigripulchritudo FTn2 | Isolate | Unclassified |
| 63 | 2740892545 | Fibrobacteria bacterium GUT31 IN01_31 | Isolate | Unclassified |
| 64 | 8051461712 | Vibrio vulnificus Vv002 | Isolate | |
| 65 | 8060845732 | Vibrio vulnificus Vv006 | Isolate | |
| 66 | 2989793055 | Vibrio atypicus DSM 25292 | Isolate | Unclassified |
| 67 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 68 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 69 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 70 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 71 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 72 | 8116627632 | Vibrio penaeicida NBRC 15640 | Isolate | Unclassified |
| 73 | 2582581321 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 74 | 2773857779 | Unclassified Fibrobacteres Co191P1bin69 | Isolate | Unclassified |
| 75 | 2791355471 | Vibrio bivalvicida 605 | Isolate | Unclassified |
| 76 | 8051534459 | Vibrio vulnificus Vv004 | Isolate | |
| 77 | 3006242587 | Vibrio sp. RE86 | Isolate | Unclassified |
| 78 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 79 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 80 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 81 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 82 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 83 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 84 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466735_105790 | 3300042624 | Bacteria | 1738 |
| 2 | Ga0466703_200433 | 3300042636 | Bacteria | 92642 |
| 3 | Ga0466706_267620 | 3300042599 | Bacteria | 1758 |
| 4 | Ga0466713_134795 | 3300042602 | Bacteria | 45954 |
| 5 | Ga0466719_054375 | 3300042606 | Bacteria | 8870 |
| 6 | Ga0466720_008608 | 3300042607 | Bacteria | 5673 |
| 7 | Ga0466720_073442 | 3300042607 | Bacteria | 33648 |
| 8 | Ga0466720_199346 | 3300042607 | Bacteria | 20736 |
| 9 | Ga0466712_251659 | 3300042614 | Bacteria | 16399 |
| 10 | Ga0466726_207695 | 3300042619 | Bacteria | 3350 |
| 11 | Ga0264413_103795 | 3300024493 | Bacteria | 9573 |
| 12 | Ga0264413_106200 | 3300024493 | Bacteria | 18818 |
| 13 | Ga0466691_154829 | 3300042593 | Bacteria | 6621 |
| 14 | Ga0466694_176105 | 3300042594 | Bacteria | 11633 |
| 15 | Ga0466694_266003 | 3300042594 | Bacteria | 12058 |
| 16 | Ga0466699_166612 | 3300042597 | Bacteria | 3372 |
| 17 | Ga0466699_397526 | 3300042597 | Unclassified | 1326 |
| 18 | AustNasuHG_c1013138 | 3300000089 | Bacteria | 2845 |
| 19 | JGI24698J34947_10031540 | 3300002449 | Unclassified | 2789 |
| 20 | Ga0072940_1002479 | 3300005200 | Unclassified | 2630 |
| 21 | Ga0072941_1024566 | 3300005201 | Bacteria | 11934 |
| 22 | Ga0072941_1035976 | 3300005201 | Bacteria | 4496 |
| 23 | Ga0466702_112554 | 3300042635 | Bacteria | 3415 |
| 24 | Ga0466702_112945 | 3300042635 | Bacteria | 6123 |
| 25 | Ga0466702_279436 | 3300042635 | Bacteria | 1447 |
| 26 | Ga0466703_009344 | 3300042636 | Bacteria | 4243 |
| 27 | Ga0466707_122855 | 3300042601 | Bacteria | 7809 |
| 28 | Ga0466717_112287 | 3300042604 | Bacteria | 3400 |
| 29 | Ga0466721_131963 | 3300042608 | Bacteria | 17466 |
| 30 | Ga0123356_10146406 | 3300010049 | Bacteria | 2338 |
| 31 | Ga0466712_028062 | 3300042614 | Bacteria | 12262 |
| 32 | Ga0466712_057506 | 3300042614 | Unclassified | 20799 |
| 33 | Ga0466718_154819 | 3300042617 | Bacteria | 2845 |
| 34 | Ga0466728_117140 | 3300042620 | Bacteria | 17716 |
| 35 | Ga0466691_010586 | 3300042593 | Bacteria | 11947 |
| 36 | Ga0466694_003225 | 3300042594 | Bacteria | 17623 |
| 37 | AustNasuHG_c1025851 | 3300000089 | Unclassified | 1839 |
| 38 | JGI24698J34947_10047167 | 3300002449 | Unclassified | 2188 |
| 39 | JGI24698J34947_10047287 | 3300002449 | Unclassified | 2184 |
| 40 | Ga0072941_1008181 | 3300005201 | Bacteria | 38845 |
| 41 | Ga0466731_370355 | 3300042622 | Bacteria | 19402 |
| 42 | Ga0466734_060918 | 3300042623 | Bacteria | 7082 |
| 43 | Ga0466724_53534 | 3300042649 | Bacteria | 112484 |
| 44 | Ga0466717_055194 | 3300042604 | Bacteria | 1748 |
| 45 | Ga0466717_073375 | 3300042604 | Bacteria | 5206 |
| 46 | Ga0466712_014686 | 3300042614 | Bacteria | 5407 |
| 47 | Ga0466712_085595 | 3300042614 | Bacteria | 21425 |
| 48 | Ga0466715_211896 | 3300042616 | Bacteria | 3435 |
| 49 | Ga0466718_038919 | 3300042617 | Bacteria | 7944 |
| 50 | Ga0466718_103967 | 3300042617 | Bacteria | 4402 |
| 51 | Ga0466718_165980 | 3300042617 | Bacteria | 8480 |
| 52 | Ga0264413_112916 | 3300024493 | Bacteria | 26433 |
| 53 | Ga0466657_207140 | 3300042582 | Bacteria | 4100 |
| 54 | Ga0466690_098318 | 3300042590 | Bacteria | 80234 |
| 55 | Ga0466694_051760 | 3300042594 | Bacteria | 8360 |
| 56 | Ga0466694_125449 | 3300042594 | Bacteria | 2191 |
| 57 | Ga0466699_138226 | 3300042597 | Bacteria | 10221 |
| 58 | AustNasuHG_c1020842 | 3300000089 | Unclassified | 2129 |
| 59 | JGI24695J34938_10004719 | 3300002450 | Bacteria | 8822 |
| 60 | Ga0072941_1008798 | 3300005201 | Bacteria | 23192 |
| 61 | Ga0072941_1043845 | 3300005201 | Bacteria | 18908 |
| 62 | Ga0466708_082941 | 3300042652 | Bacteria | 8755 |
| 63 | Ga0466719_119629 | 3300042606 | Bacteria | 7843 |
| 64 | Ga0466710_063006 | 3300042613 | Unclassified | 10673 |
| 65 | Ga0466715_215034 | 3300042616 | Bacteria | 9692 |
| 66 | Ga0466718_044909 | 3300042617 | Archaea | 8062 |
| 67 | Ga0466656_210922 | 3300042550 | Bacteria | 2567 |
| 68 | Ga0466657_279223 | 3300042582 | Bacteria | 4757 |
| 69 | Ga0466692_093041 | 3300042591 | Bacteria | 64950 |
| 70 | Ga0466694_015070 | 3300042594 | Bacteria | 1225 |
| 71 | Ga0466699_001128 | 3300042597 | Bacteria | 1853 |
| 72 | JGI24702J35022_10013803 | 3300002462 | Bacteria | 4466 |
| 73 | JGI24696J40584_12961091 | 3300002834 | Bacteria | 10614 |
| 74 | Ga0466708_096528 | 3300042652 | Bacteria | 8886 |
| 75 | Ga0466727_268155 | 3300042655 | Bacteria | 1382 |
| 76 | Ga0466727_298393 | 3300042655 | Bacteria | 32097 |
| 77 | Ga0466707_229644 | 3300042601 | Bacteria | 27629 |
| 78 | Ga0466716_342212 | 3300042605 | Bacteria | 2701 |
| 79 | Ga0466720_210172 | 3300042607 | Bacteria | 21809 |
| 80 | Ga0123356_10135057 | 3300010049 | Bacteria | 2423 |
| 81 | Ga0466712_228978 | 3300042614 | Bacteria | 2768 |
| 82 | Ga0466715_036583 | 3300042616 | Bacteria | 1693 |
| 83 | Ga0264413_104663 | 3300024493 | Unclassified | 15728 |
| 84 | Ga0466657_190183 | 3300042582 | Bacteria | 21425 |
| 85 | Ga0466690_080971 | 3300042590 | Bacteria | 19280 |
| 86 | Ga0466690_285923 | 3300042590 | Bacteria | 9352 |
| 87 | JGI24698J34947_10017172 | 3300002449 | Bacteria | 3924 |
| 88 | Ga0072940_1013921 | 3300005200 | Unclassified | 19190 |
| 89 | Ga0072940_1027102 | 3300005200 | Unclassified | 4332 |
| 90 | Ga0466704_110726 | 3300042643 | Bacteria | 63753 |
| 91 | Ga0466709_183739 | 3300042648 | Bacteria | 18578 |
| 92 | Ga0466713_039758 | 3300042602 | Bacteria | 12168 |
| 93 | Ga0466720_034111 | 3300042607 | Bacteria | 32474 |
| 94 | Ga0466722_209072 | 3300042609 | Bacteria | 2201 |
| 95 | Ga0466705_438604 | 3300042612 | Bacteria | 49382 |
| 96 | Ga0466712_097756 | 3300042614 | Bacteria | 15571 |
| 97 | Ga0466718_013678 | 3300042617 | Bacteria | 3992 |
| 98 | Ga0466723_027695 | 3300042618 | Unclassified | 12205 |
| 99 | Ga0466723_374449 | 3300042618 | Bacteria | 21994 |
| 100 | Ga0466657_117791 | 3300042582 | Bacteria | 208686 |
| 101 | Ga0466690_403450 | 3300042590 | Bacteria | 2629 |
| 102 | JGI24695J34938_10003605 | 3300002450 | Bacteria | 10637 |
| 103 | JGI24695J34938_10012182 | 3300002450 | Bacteria | 4577 |
| 104 | Ga0072941_1002949 | 3300005201 | Bacteria | 53444 |
| 105 | Ga0466732_251266 | 3300042656 | Unclassified | 2008 |
| 106 | Ga0466709_007718 | 3300042648 | Bacteria | 17770 |
| 107 | Ga0466700_065927 | 3300042600 | Bacteria | 1854 |
| 108 | Ga0466707_137105 | 3300042601 | Bacteria | 1611 |
| 109 | Ga0466716_047081 | 3300042605 | Bacteria | 1287 |
| 110 | Ga0466720_058965 | 3300042607 | Bacteria | 29374 |
| 111 | Ga0466710_100458 | 3300042613 | Bacteria | 42158 |
| 112 | Ga0466711_232701 | 3300042615 | Bacteria | 3527 |
| 113 | Ga0466718_069395 | 3300042617 | Unclassified | 1637 |
| 114 | Ga0264413_103794 | 3300024493 | Bacteria | 10613 |
| 115 | Ga0466692_088165 | 3300042591 | Bacteria | 54526 |
| 116 | Ga0466694_093356 | 3300042594 | Unclassified | 1261 |
| 117 | Ga0466694_354590 | 3300042594 | Bacteria | 8540 |
| 118 | Ga0466695_368226 | 3300042595 | Bacteria | 4073 |
| 119 | JGI24698J34947_10004111 | 3300002449 | Bacteria | 7895 |
| 120 | JGI24702J35022_10161193 | 3300002462 | Bacteria | 1263 |
| 121 | Ga0068302_10241610 | 3300005071 | Bacteria | 1840 |
| 122 | Ga0072940_1005008 | 3300005200 | Bacteria | 15036 |
| 123 | Ga0466734_027892 | 3300042623 | Bacteria | 13295 |
| 124 | Ga0466722_126961 | 3300042609 | Bacteria | 16044 |
| 125 | Ga0466712_152217 | 3300042614 | Bacteria | 1650 |
| 126 | Ga0466715_643614 | 3300042616 | Bacteria | 20877 |
| 127 | Ga0466718_007150 | 3300042617 | Bacteria | 22876 |
| 128 | Ga0466729_125020 | 3300042621 | Bacteria | 34147 |
| 129 | Ga0466694_152867 | 3300042594 | Bacteria | 5375 |
| 130 | Ga0466699_444228 | 3300042597 | Bacteria | 6720 |
| 131 | AustNasuHG_c1000495 | 3300000089 | Bacteria | 13783 |
| 132 | AustNasuHG_c1003256 | 3300000089 | Bacteria | 5867 |
| 133 | JGI24698J34947_10015435 | 3300002449 | Bacteria | 4157 |
| 134 | JGI24698J34947_10019523 | 3300002449 | Unclassified | 3656 |
| 135 | JGI24695J34938_10007265 | 3300002450 | Bacteria | 6523 |
| 136 | Ga0072941_1012592 | 3300005201 | Bacteria | 9526 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300005201 | Ga0072941_1035976 | Ga0072941_10359763 | 277 |
| 2 | 3300042617 | Ga0466718_069395 | Ga0466718_069395_741_1616 | 291 |
| 3 | 3300042612 | Ga0466705_438604 | Ga0466705_438604_12651_13586 | 296 |
| 4 | 3300042636 | Ga0466703_200433 | Ga0466703_200433_54191_55099 | 302 |
| 5 | 3300042590 | Ga0466690_403450 | Ga0466690_403450_1622_2554 | 305 |
| 6 | 3300042609 | Ga0466722_209072 | Ga0466722_209072_812_1744 | 305 |
| 7 | 3300042602 | Ga0466713_134795 | Ga0466713_134795_26039_26962 | 307 |
| 8 | 3300042591 | Ga0466692_093041 | Ga0466692_093041_19410_20336 | 308 |
| 9 | 3300042606 | Ga0466719_054375 | Ga0466719_054375_5660_6589 | 309 |
| 10 | 3300042619 | Ga0466726_207695 | Ga0466726_207695_365_1294 | 309 |
| 11 | 3300042620 | Ga0466728_117140 | Ga0466728_117140_6589_7518 | 309 |
| 12 | 3300042652 | Ga0466708_082941 | Ga0466708_082941_927_1856 | 309 |
| 13 | iso_pr_bacteria | 2582581321 | 2585353037 | 309 |
| 14 | iso_pr_bacteria | 2833478085 | 2833480371 | 309 |
| 15 | iso_pr_bacteria | 2864808494 | 2864811044 | 309 |
| 16 | iso_pr_bacteria | 2864812326 | 2864814993 | 309 |
| 17 | iso_pr_bacteria | 2864914039 | 2864918431 | 309 |
| 18 | iso_pr_bacteria | 2864988360 | 2864992645 | 309 |
| 19 | 3300024493 | Ga0264413_112916 | Ga0264413_11291612 | 310 |
| 20 | 3300042582 | Ga0466657_117791 | Ga0466657_117791_142983_143915 | 310 |
| 21 | 3300042582 | Ga0466657_207140 | Ga0466657_207140_1393_2325 | 310 |
| 22 | 3300042591 | Ga0466692_088165 | Ga0466692_088165_53094_54026 | 310 |
| 23 | 3300042594 | Ga0466694_152867 | Ga0466694_152867_2945_3877 | 310 |
| 24 | 3300042595 | Ga0466695_368226 | Ga0466695_368226_1004_1936 | 310 |
| 25 | 3300042597 | Ga0466699_001128 | Ga0466699_001128_755_1687 | 310 |
| 26 | 3300042597 | Ga0466699_166612 | Ga0466699_166612_183_1115 | 310 |
| 27 | 3300042597 | Ga0466699_397526 | Ga0466699_397526_330_1262 | 310 |
| 28 | 3300042599 | Ga0466706_267620 | Ga0466706_267620_570_1502 | 310 |
| 29 | 3300042601 | Ga0466707_137105 | Ga0466707_137105_263_1195 | 310 |
| 30 | 3300042601 | Ga0466707_229644 | Ga0466707_229644_9916_10848 | 310 |
| 31 | 3300042604 | Ga0466717_055194 | Ga0466717_055194_281_1213 | 310 |
| 32 | 3300042604 | Ga0466717_112287 | Ga0466717_112287_1063_1995 | 310 |
| 33 | 3300042605 | Ga0466716_047081 | Ga0466716_047081_157_1089 | 310 |
| 34 | 3300042605 | Ga0466716_342212 | Ga0466716_342212_1450_2382 | 310 |
| 35 | 3300042607 | Ga0466720_008608 | Ga0466720_008608_4200_5132 | 310 |
| 36 | 3300042607 | Ga0466720_210172 | Ga0466720_210172_3861_4793 | 310 |
| 37 | 3300042613 | Ga0466710_063006 | Ga0466710_063006_5767_6699 | 310 |
| 38 | 3300042614 | Ga0466712_097756 | Ga0466712_097756_1845_2777 | 310 |
| 39 | 3300042614 | Ga0466712_152217 | Ga0466712_152217_229_1161 | 310 |
| 40 | 3300042615 | Ga0466711_232701 | Ga0466711_232701_31_963 | 310 |
| 41 | 3300042616 | Ga0466715_036583 | Ga0466715_036583_496_1428 | 310 |
| 42 | 3300042616 | Ga0466715_211896 | Ga0466715_211896_596_1528 | 310 |
| 43 | 3300042616 | Ga0466715_643614 | Ga0466715_643614_8567_9499 | 310 |
| 44 | 3300042617 | Ga0466718_013678 | Ga0466718_013678_39_971 | 310 |
| 45 | 3300042617 | Ga0466718_103967 | Ga0466718_103967_1018_1950 | 310 |
| 46 | 3300042618 | Ga0466723_374449 | Ga0466723_374449_10938_11870 | 310 |
| 47 | 3300042621 | Ga0466729_125020 | Ga0466729_125020_5987_6919 | 310 |
| 48 | 3300042623 | Ga0466734_027892 | Ga0466734_027892_9114_10046 | 310 |
| 49 | 3300042624 | Ga0466735_105790 | Ga0466735_105790_541_1473 | 310 |
| 50 | 3300042636 | Ga0466703_009344 | Ga0466703_009344_3046_3978 | 310 |
| 51 | 3300042652 | Ga0466708_096528 | Ga0466708_096528_5495_6427 | 310 |
| 52 | 3300042655 | Ga0466727_268155 | Ga0466727_268155_254_1186 | 310 |
| 53 | iso_pr_bacteria | 2565956518 | 2566026246 | 310 |
| 54 | iso_pr_bacteria | 2609459925 | 2610645395 | 310 |
| 55 | iso_pr_bacteria | 2609459958 | 2610824663 | 310 |
| 56 | iso_pr_bacteria | 2627853677 | 2628496793 | 310 |
| 57 | iso_pr_bacteria | 2627854002 | 2629836214 | 310 |
| 58 | iso_pr_bacteria | 2630968716 | 2632958529 | 310 |
| 59 | iso_pr_bacteria | 2636415542 | 2636992972 | 310 |
| 60 | iso_pr_bacteria | 2648501820 | 2651397951 | 310 |
| 61 | iso_pr_bacteria | 2791355471 | 2794376786 | 310 |
| 62 | iso_pr_bacteria | 2820947865 | 2820948839 | 310 |
| 63 | iso_pr_bacteria | 2896925746 | 2896928285 | 310 |
| 64 | iso_pr_bacteria | 2902896024 | 2902897214 | 310 |
| 65 | iso_pr_bacteria | 2989793055 | 2989794947 | 310 |
| 66 | iso_pr_bacteria | 3006242587 | 3006243400 | 310 |
| 67 | iso_pr_bacteria | 8051461712 | 8051464405 | 310 |
| 68 | iso_pr_bacteria | 8051534459 | 8051536791 | 310 |
| 69 | iso_pr_bacteria | 8051551332 | 8051551947 | 310 |
| 70 | iso_pr_bacteria | 8060845732 | 8060847195 | 310 |
| 71 | iso_pr_bacteria | 8116627632 | 8116629732 | 310 |
| 72 | 3300002449 | JGI24698J34947_10019523 | JGI24698J34947_100195234 | 311 |
| 73 | 3300042550 | Ga0466656_210922 | Ga0466656_210922_426_1361 | 311 |
| 74 | 3300042582 | Ga0466657_190183 | Ga0466657_190183_803_1738 | 311 |
| 75 | 3300042582 | Ga0466657_279223 | Ga0466657_279223_3244_4179 | 311 |
| 76 | 3300042590 | Ga0466690_080971 | Ga0466690_080971_10721_11656 | 311 |
| 77 | 3300042593 | Ga0466691_010586 | Ga0466691_010586_6168_7103 | 311 |
| 78 | 3300042597 | Ga0466699_138226 | Ga0466699_138226_2688_3623 | 311 |
| 79 | 3300042600 | Ga0466700_065927 | Ga0466700_065927_606_1541 | 311 |
| 80 | 3300042601 | Ga0466707_122855 | Ga0466707_122855_3760_4695 | 311 |
| 81 | 3300042602 | Ga0466713_039758 | Ga0466713_039758_41_976 | 311 |
| 82 | 3300042609 | Ga0466722_126961 | Ga0466722_126961_8151_9086 | 311 |
| 83 | 3300042614 | Ga0466712_028062 | Ga0466712_028062_4360_5295 | 311 |
| 84 | 3300042623 | Ga0466734_060918 | Ga0466734_060918_1830_2765 | 311 |
| 85 | 3300042643 | Ga0466704_110726 | Ga0466704_110726_6806_7741 | 311 |
| 86 | 3300042648 | Ga0466709_183739 | Ga0466709_183739_9897_10832 | 311 |
| 87 | 3300042655 | Ga0466727_298393 | Ga0466727_298393_26911_27846 | 311 |
| 88 | iso_pr_bacteria | 2820042117 | 2820043058 | 311 |
| 89 | iso_pr_bacteria | 2864937364 | 2864940772 | 311 |
| 90 | 3300002462 | JGI24702J35022_10013803 | JGI24702J35022_100138032 | 312 |
| 91 | 3300005071 | Ga0068302_10241610 | Ga0068302_102416101 | 312 |
| 92 | 3300042590 | Ga0466690_098318 | Ga0466690_098318_23364_24302 | 312 |
| 93 | 3300042648 | Ga0466709_007718 | Ga0466709_007718_3518_4456 | 312 |
| 94 | iso_pr_bacteria | 2636416028 | 2638996264 | 312 |
| 95 | 3300042594 | Ga0466694_266003 | Ga0466694_266003_4227_5168 | 313 |
| 96 | 3300042606 | Ga0466719_119629 | Ga0466719_119629_5418_6359 | 313 |
| 97 | 3300010049 | Ga0123356_10146406 | Ga0123356_101464062 | 314 |
| 98 | 3300042649 | Ga0466724_53534 | Ga0466724_53534_11959_12909 | 316 |
| 99 | 3300042613 | Ga0466710_100458 | Ga0466710_100458_4505_5458 | 317 |
| 100 | 3300042594 | Ga0466694_003225 | Ga0466694_003225_9395_10351 | 318 |
| 101 | iso_pr_bacteria | 2740892546 | 2743912100 | 318 |
| 102 | 3300002449 | JGI24698J34947_10017172 | JGI24698J34947_100171724 | 319 |
| 103 | 3300005201 | Ga0072941_1008798 | Ga0072941_100879816 | 319 |
| 104 | 3300042608 | Ga0466721_131963 | Ga0466721_131963_6896_7855 | 319 |
| 105 | 3300042614 | Ga0466712_251659 | Ga0466712_251659_8311_9270 | 319 |
| 106 | iso_pr_bacteria | 2778260939 | 2778353387 | 319 |
| 107 | 3300002834 | JGI24696J40584_12961091 | JGI24696J40584_129610912 | 320 |
| 108 | 3300005201 | Ga0072941_1043845 | Ga0072941_104384515 | 320 |
| 109 | 3300024493 | Ga0264413_103794 | Ga0264413_1037948 | 320 |
| 110 | 3300024493 | Ga0264413_103795 | Ga0264413_1037958 | 320 |
| 111 | 3300024493 | Ga0264413_104663 | Ga0264413_10466314 | 320 |
| 112 | 3300024493 | Ga0264413_106200 | Ga0264413_10620014 | 320 |
| 113 | 3300042594 | Ga0466694_015070 | Ga0466694_015070_164_1126 | 320 |
| 114 | 3300042594 | Ga0466694_051760 | Ga0466694_051760_4228_5190 | 320 |
| 115 | 3300042594 | Ga0466694_093356 | Ga0466694_093356_200_1162 | 320 |
| 116 | 3300042594 | Ga0466694_125449 | Ga0466694_125449_521_1483 | 320 |
| 117 | 3300042594 | Ga0466694_176105 | Ga0466694_176105_6892_7854 | 320 |
| 118 | 3300042594 | Ga0466694_354590 | Ga0466694_354590_212_1174 | 320 |
| 119 | 3300042607 | Ga0466720_073442 | Ga0466720_073442_25843_26805 | 320 |
| 120 | 3300042607 | Ga0466720_199346 | Ga0466720_199346_12894_13856 | 320 |
| 121 | 3300042614 | Ga0466712_014686 | Ga0466712_014686_1452_2414 | 320 |
| 122 | 3300042614 | Ga0466712_057506 | Ga0466712_057506_12833_13795 | 320 |
| 123 | 3300042614 | Ga0466712_085595 | Ga0466712_085595_7010_7972 | 320 |
| 124 | 3300042614 | Ga0466712_228978 | Ga0466712_228978_25_987 | 320 |
| 125 | 3300042617 | Ga0466718_007150 | Ga0466718_007150_14607_15569 | 320 |
| 126 | 3300042617 | Ga0466718_038919 | Ga0466718_038919_20_982 | 320 |
| 127 | 3300042617 | Ga0466718_044909 | Ga0466718_044909_295_1257 | 320 |
| 128 | 3300042617 | Ga0466718_165980 | Ga0466718_165980_6365_7327 | 320 |
| 129 | 3300042622 | Ga0466731_370355 | Ga0466731_370355_6951_7913 | 320 |
| 130 | 3300042635 | Ga0466702_112554 | Ga0466702_112554_2302_3264 | 320 |
| 131 | 3300042635 | Ga0466702_112945 | Ga0466702_112945_836_1798 | 320 |
| 132 | 3300042635 | Ga0466702_279436 | Ga0466702_279436_238_1200 | 320 |
| 133 | 3300042656 | Ga0466732_251266 | Ga0466732_251266_818_1780 | 320 |
| 134 | iso_pr_bacteria | 2740892545 | 2743909439 | 320 |
| 135 | iso_pr_bacteria | 2773857779 | 2774477878 | 320 |
| 136 | iso_pr_bacteria | 2778260937 | 2778348666 | 320 |
| 137 | iso_pr_bacteria | 2778260941 | 2778358623 | 320 |
| 138 | 3300000089 | AustNasuHG_c1000495 | AustNasuHG_10004955 | 321 |
| 139 | 3300000089 | AustNasuHG_c1003256 | AustNasuHG_10032565 | 321 |
| 140 | 3300000089 | AustNasuHG_c1013138 | AustNasuHG_10131383 | 321 |
| 141 | 3300000089 | AustNasuHG_c1020842 | AustNasuHG_10208422 | 321 |
| 142 | 3300000089 | AustNasuHG_c1025851 | AustNasuHG_10258512 | 321 |
| 143 | 3300002449 | JGI24698J34947_10004111 | JGI24698J34947_100041111 | 321 |
| 144 | 3300002449 | JGI24698J34947_10015435 | JGI24698J34947_100154354 | 321 |
| 145 | 3300002449 | JGI24698J34947_10031540 | JGI24698J34947_100315403 | 321 |
| 146 | 3300002449 | JGI24698J34947_10047167 | JGI24698J34947_100471673 | 321 |
| 147 | 3300002449 | JGI24698J34947_10047287 | JGI24698J34947_100472871 | 321 |
| 148 | 3300002450 | JGI24695J34938_10003605 | JGI24695J34938_100036054 | 321 |
| 149 | 3300002450 | JGI24695J34938_10004719 | JGI24695J34938_100047196 | 321 |
| 150 | 3300002450 | JGI24695J34938_10007265 | JGI24695J34938_100072655 | 321 |
| 151 | 3300002450 | JGI24695J34938_10012182 | JGI24695J34938_100121825 | 321 |
| 152 | 3300002462 | JGI24702J35022_10161193 | JGI24702J35022_101611932 | 321 |
| 153 | 3300005200 | Ga0072940_1002479 | Ga0072940_10024792 | 321 |
| 154 | 3300005200 | Ga0072940_1005008 | Ga0072940_100500813 | 321 |
| 155 | 3300005200 | Ga0072940_1013921 | Ga0072940_10139212 | 321 |
| 156 | 3300005200 | Ga0072940_1027102 | Ga0072940_10271024 | 321 |
| 157 | 3300005201 | Ga0072941_1002949 | Ga0072941_10029498 | 321 |
| 158 | 3300005201 | Ga0072941_1008181 | Ga0072941_100818131 | 321 |
| 159 | 3300005201 | Ga0072941_1012592 | Ga0072941_10125924 | 321 |
| 160 | 3300005201 | Ga0072941_1024566 | Ga0072941_10245665 | 321 |
| 161 | 3300042607 | Ga0466720_034111 | Ga0466720_034111_24551_25516 | 321 |
| 162 | iso_pr_bacteria | 2820716747 | 2820718357 | 321 |
| 163 | 3300042607 | Ga0466720_058965 | Ga0466720_058965_21565_22533 | 322 |
| 164 | 3300042617 | Ga0466718_154819 | Ga0466718_154819_574_1548 | 324 |
| 165 | 3300042593 | Ga0466691_154829 | Ga0466691_154829_4513_5493 | 326 |
| 166 | 3300042597 | Ga0466699_444228 | Ga0466699_444228_1382_2362 | 326 |
| 167 | 3300042604 | Ga0466717_073375 | Ga0466717_073375_3643_4623 | 326 |
| 168 | 3300010049 | Ga0123356_10135057 | Ga0123356_101350572 | 331 |
| 169 | 3300042618 | Ga0466723_027695 | Ga0466723_027695_6722_7756 | 344 |
| 170 | 3300042590 | Ga0466690_285923 | Ga0466690_285923_3973_5010 | 345 |
| 171 | 3300042616 | Ga0466715_215034 | Ga0466715_215034_6038_7084 | 348 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.88 | 0.9 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.