Protein Family IF02806

Metagenome Isolate
133 Members
45 Samples
128 Scaffolds
104.06 Avg Length

🧬 Representative Sequence

ID
3300010049|Ga0123356_10109749|Ga0123356_101097493
Length
124 aa
Sequence
MKFKKQLKFGQNISIKKQQQMKAYTLDEVQDKLIGKIGTPDRDLFEYELQMDLIGKAIKQTRQERNLTQEELGKLIGVQKAQISRLENNTSNVTMVTLLRVFTALKAKIKLQVELPNVNVSLG*

📊 Sample Types

Isolate 3.8%
Metagenome 96.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 53.3%
Unclassified 13.3%
Kalotermitidae 11.1%
Passalidae 6.7%
Termopsidae 6.7%
Rhinotermitidae 2.2%
Drosophilidae 2.2%
Armadillidiidae 2.2%
Culicidae 2.2%

🌳 Taxonomy

Archaea 0
Bacteria 102
Eukaryota 0
Viruses 0
Unclassified 31

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
2 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
3 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
4 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
5 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
6 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
7 2820651690 Unclassified Firmicutes Cu122P3bin6 Isolate Unclassified
8 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
9 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
10 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
11 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
12 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
13 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
14 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
15 2820797595 Unclassified Bacteroidetes Co191P3bin3 Isolate Unclassified
16 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
17 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
18 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
19 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
20 3300007507 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 4 gut Metagenome Drosophilidae
21 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
22 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
23 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
24 2820741847 Unclassified Bacteroidetes Th196P3bin71 Isolate Unclassified
25 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
26 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
27 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
28 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
29 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
30 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
31 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
32 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
33 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
34 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
35 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
36 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
37 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
38 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
39 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
40 2820765201 Unclassified Bacteroidetes Lab288P3bin82 Isolate Unclassified
41 2820789850 Unclassified Bacteroidetes Cu122P3bin3 Isolate Unclassified
42 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
43 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
44 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
45 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123357_10265835 3300009784 Bacteria 1803
2 Ga0123356_11258556 3300010049 Bacteria 904
3 Ga0123354_10657780 3300010882 Bacteria 746
4 Ga0466698_058322 3300042610 Bacteria 1095
5 Ga0466697_002070 3300042611 Bacteria 1037
6 Ga0466702_129722 3300042635 Unclassified 1810
7 Ga0466725_156786 3300042654 Bacteria 6544
8 Ga0466657_137608 3300042582 Bacteria 4731
9 IMNBL1DRAFT_c0013702 3300000062 Bacteria 3615
10 JGI24702J35022_10105828 3300002462 Bacteria 1544
11 Ga0466697_171191 3300042611 Bacteria 1209
12 Ga0123355_10534619 3300009826 Bacteria 1426
13 Ga0123356_10427659 3300010049 Bacteria 1468
14 Ga0123356_12640723 3300010049 Unclassified 629
15 Ga0123356_13217317 3300010049 Unclassified 568
16 Ga0123356_14125330 3300010049 Unclassified 500
17 Ga0123353_10109673 3300010167 Bacteria 4446
18 Ga0123353_10771255 3300010167 Unclassified 1334
19 Ga0123353_11172000 3300010167 Bacteria 1012
20 Ga0123354_10013157 3300010882 Bacteria 12833
21 Ga0123354_10028982 3300010882 Bacteria 8715
22 Ga0466701_045216 3300042598 Bacteria 2552
23 Ga0466710_049839 3300042613 Unclassified 1104
24 Ga0466710_079760 3300042613 Bacteria 1042
25 Ga0466726_167395 3300042619 Bacteria 2452
26 Ga0466735_080930 3300042624 Bacteria 2084
27 Ga0466704_043105 3300042643 Unclassified 1569
28 Ga0466656_188363 3300042550 Bacteria 2321
29 Ga0466656_350463 3300042550 Bacteria 1217
30 IMNBL1DRAFT_c0060810 3300000062 Bacteria 1137
31 JGI24702J35022_10129654 3300002462 Bacteria 1399
32 JGI24702J35022_10660330 3300002462 Bacteria 649
33 Ga0105008_1117411 3300007507 Unclassified 3346
34 Ga0123353_11482339 3300010167 Bacteria 866
35 Ga0466701_057738 3300042598 Bacteria 1695
36 Ga0466710_111256 3300042613 Bacteria 1898
37 Ga0466729_206460 3300042621 Bacteria 1160
38 Ga0466709_043494 3300042648 Unclassified 1661
39 Ga0466725_062615 3300042654 Bacteria 1212
40 Ga0466727_159417 3300042655 Bacteria 6226
41 Ga0466657_278730 3300042582 Bacteria 2287
42 Ga0466690_035613 3300042590 Unclassified 5674
43 Ga0466694_380095 3300042594 Bacteria 1303
44 Ga0466699_187484 3300042597 Bacteria 1160
45 2227519924 2225789004 Unclassified 3361
46 2227605164 2225789004 Bacteria 12380
47 IMNBL1DRAFT_c0014483 3300000062 Bacteria 3478
48 IMNBL1DRAFT_c0054487 3300000062 Bacteria 1238
49 JGI24705J35276_11564046 3300002504 Bacteria 578
50 Ga0123357_10284582 3300009784 Unclassified 1701
51 Ga0123356_11400671 3300010049 Bacteria 859
52 Ga0123356_12639489 3300010049 Bacteria 629
53 Ga0123356_13616993 3300010049 Unclassified 535
54 Ga0123353_11880207 3300010167 Bacteria 740
55 Ga0466698_258463 3300042610 Bacteria 1806
56 Ga0466710_279750 3300042613 Bacteria 3438
57 Ga0466734_017918 3300042623 Bacteria 6867
58 Ga0466734_094736 3300042623 Unclassified 1230
59 Ga0466734_119869 3300042623 Bacteria 2618
60 Ga0466724_68678 3300042649 Bacteria 1171
61 Ga0466725_083232 3300042654 Unclassified 1286
62 Ga0160433_100211 3300012846 Bacteria 45566
63 Ga0466656_034761 3300042550 Bacteria 1145
64 Ga0466693_352888 3300042592 Bacteria 1017
65 Ga0466694_177093 3300042594 Bacteria 2800
66 Ga0466701_000462 3300042598 Bacteria 39838
67 Ga0466701_008343 3300042598 Bacteria 1281
68 IMNBGM34_c003600 3300000036 Bacteria 2127
69 IMNBL1DRAFT_c0002118 3300000062 Bacteria 14131
70 Ga0123355_11919020 3300009826 Unclassified 553
71 Ga0123356_10187953 3300010049 Bacteria 2094
72 Ga0123353_10189312 3300010167 Bacteria 3250
73 Ga0123353_10665465 3300010167 Bacteria 1470
74 Ga0123354_10478091 3300010882 Bacteria 987
75 Ga0123354_10771861 3300010882 Bacteria 654
76 Ga0466731_292986 3300042622 Bacteria 2249
77 Ga0466731_378174 3300042622 Unclassified 1293
78 Ga0466734_003021 3300042623 Bacteria 1237
79 Ga0160433_100049 3300012846 Bacteria 134813
80 Ga0466657_110573 3300042582 Bacteria 1096
81 Ga0105008_1100175 3300007507 Bacteria 3934
82 Ga0123357_10384813 3300009784 Unclassified 1297
83 Ga0123357_10904798 3300009784 Bacteria 569
84 Ga0123354_10134592 3300010882 Unclassified 3099
85 Ga0123354_10190174 3300010882 Unclassified 2302
86 Ga0123354_10365241 3300010882 Unclassified 1267
87 Ga0466731_159560 3300042622 Bacteria 1946
88 Ga0466702_297552 3300042635 Unclassified 1098
89 JGI24698J34947_10280079 3300002449 Bacteria 610
90 Ga0123355_10163874 3300009826 Bacteria 3341
91 Ga0123356_10399093 3300010049 Bacteria 1512
92 Ga0123356_13786755 3300010049 Unclassified 522
93 Ga0123353_10873837 3300010167 Unclassified 1228
94 Ga0466701_036384 3300042598 Bacteria 1331
95 Ga0466707_229155 3300042601 Bacteria 2659
96 Ga0466710_317240 3300042613 Unclassified 1896
97 Ga0466734_066928 3300042623 Bacteria 1921
98 Ga0466734_078117 3300042623 Bacteria 1184
99 Ga0466704_015153 3300042643 Unclassified 1871
100 Ga0466657_239488 3300042582 Bacteria 3034
101 Ga0466657_363572 3300042582 Bacteria 6720
102 Ga0466693_379996 3300042592 Unclassified 1492
103 Ga0466694_251512 3300042594 Unclassified 1533
104 Ga0466699_436543 3300042597 Bacteria 1008
105 2227502413 2225789004 Bacteria 19081
106 IMNBL1DRAFT_c0082165 3300000062 Unclassified 901
107 JGI24702J35022_10062630 3300002462 Bacteria 1992
108 JGI24702J35022_10228586 3300002462 Bacteria 1075
109 JGI24702J35022_10983747 3300002462 Bacteria 525
110 Ga0466705_056593 3300042612 Bacteria 4346
111 Ga0123357_10043751 3300009784 Bacteria 6082
112 Ga0123357_10442766 3300009784 Bacteria 1135
113 Ga0123356_10096006 3300010049 Bacteria 2834
114 Ga0123356_10109749 3300010049 Bacteria 2663
115 Ga0123356_10170766 3300010049 Bacteria 2185
116 Ga0123356_10603975 3300010049 Unclassified 1262
117 Ga0123353_10068841 3300010167 Bacteria 5684
118 Ga0466717_220604 3300042604 Bacteria 1487
119 Ga0466716_142950 3300042605 Bacteria 3336
120 Ga0466698_485584 3300042610 Unclassified 2140
121 Ga0466731_020297 3300042622 Bacteria 1151
122 Ga0160459_120178 3300012831 Bacteria 717
123 Ga0466656_283362 3300042550 Bacteria 2759
124 Ga0466699_389037 3300042597 Bacteria 1132
125 2227105802 2225789004 Bacteria 9509
126 IMNBL1DRAFT_c0040440 3300000062 Bacteria 1578
127 AustNasuHG_c1075343 3300000089 Bacteria 590
128 JGI24702J35022_10002564 3300002462 Bacteria 11046

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300009784 Ga0123357_10904798 Ga0123357_109047981 101
2 3300042598 Ga0466701_045216 Ga0466701_045216_1679_1987 102
3 3300042613 Ga0466710_279750 Ga0466710_279750_2870_3178 102
4 3300042622 Ga0466731_292986 Ga0466731_292986_852_1160 102
5 3300042654 Ga0466725_062615 Ga0466725_062615_422_730 102
6 iso_pr_bacteria 2820651690 2820654463 102
7 2225789004 2227502413 2227986676 103
8 2225789004 2227519924 2228022305 103
9 2225789004 2227605164 2228173397 103
10 3300000089 AustNasuHG_c1075343 AustNasuHG_10753432 103
11 3300002462 JGI24702J35022_10660330 JGI24702J35022_106603301 103
12 3300009784 Ga0123357_10284582 Ga0123357_102845822 103
13 3300010167 Ga0123353_11172000 Ga0123353_111720001 103
14 3300010882 Ga0123354_10013157 Ga0123354_100131576 103
15 3300042550 Ga0466656_034761 Ga0466656_034761_621_932 103
16 3300042550 Ga0466656_188363 Ga0466656_188363_1653_1964 103
17 3300042550 Ga0466656_283362 Ga0466656_283362_2090_2401 103
18 3300042582 Ga0466657_110573 Ga0466657_110573_287_598 103
19 3300042582 Ga0466657_137608 Ga0466657_137608_3960_4271 103
20 3300042582 Ga0466657_239488 Ga0466657_239488_1159_1470 103
21 3300042582 Ga0466657_278730 Ga0466657_278730_776_1087 103
22 3300042590 Ga0466690_035613 Ga0466690_035613_1819_2130 103
23 3300042592 Ga0466693_352888 Ga0466693_352888_161_472 103
24 3300042592 Ga0466693_379996 Ga0466693_379996_740_1051 103
25 3300042594 Ga0466694_251512 Ga0466694_251512_1114_1425 103
26 3300042594 Ga0466694_380095 Ga0466694_380095_480_791 103
27 3300042597 Ga0466699_436543 Ga0466699_436543_129_440 103
28 3300042598 Ga0466701_000462 Ga0466701_000462_15848_16159 103
29 3300042598 Ga0466701_036384 Ga0466701_036384_628_939 103
30 3300042604 Ga0466717_220604 Ga0466717_220604_843_1154 103
31 3300042610 Ga0466698_485584 Ga0466698_485584_552_863 103
32 3300042611 Ga0466697_002070 Ga0466697_002070_534_845 103
33 3300042611 Ga0466697_171191 Ga0466697_171191_285_596 103
34 3300042613 Ga0466710_079760 Ga0466710_079760_12_323 103
35 3300042613 Ga0466710_317240 Ga0466710_317240_1147_1458 103
36 3300042621 Ga0466729_206460 Ga0466729_206460_290_601 103
37 3300042622 Ga0466731_020297 Ga0466731_020297_685_996 103
38 3300042622 Ga0466731_378174 Ga0466731_378174_241_552 103
39 3300042623 Ga0466734_003021 Ga0466734_003021_115_426 103
40 3300042623 Ga0466734_017918 Ga0466734_017918_3377_3688 103
41 3300042623 Ga0466734_078117 Ga0466734_078117_437_748 103
42 3300042623 Ga0466734_119869 Ga0466734_119869_345_656 103
43 3300042624 Ga0466735_080930 Ga0466735_080930_1617_1928 103
44 3300042635 Ga0466702_129722 Ga0466702_129722_550_861 103
45 3300042635 Ga0466702_297552 Ga0466702_297552_532_843 103
46 3300042649 Ga0466724_68678 Ga0466724_68678_397_708 103
47 3300000036 IMNBGM34_c003600 IMNBGM34_0036002 104
48 3300000062 IMNBL1DRAFT_c0002118 IMNBL1DRAFT_00021189 104
49 3300000062 IMNBL1DRAFT_c0013702 IMNBL1DRAFT_00137024 104
50 3300000062 IMNBL1DRAFT_c0014483 IMNBL1DRAFT_00144833 104
51 3300000062 IMNBL1DRAFT_c0054487 IMNBL1DRAFT_00544873 104
52 3300000062 IMNBL1DRAFT_c0082165 IMNBL1DRAFT_00821653 104
53 3300002462 JGI24702J35022_10002564 JGI24702J35022_100025649 104
54 3300002462 JGI24702J35022_10062630 JGI24702J35022_100626302 104
55 3300002462 JGI24702J35022_10105828 JGI24702J35022_101058283 104
56 3300002462 JGI24702J35022_10129654 JGI24702J35022_101296542 104
57 3300002462 JGI24702J35022_10228586 JGI24702J35022_102285863 104
58 3300002462 JGI24702J35022_10983747 JGI24702J35022_109837471 104
59 3300009784 Ga0123357_10043751 Ga0123357_100437517 104
60 3300009784 Ga0123357_10384813 Ga0123357_103848131 104
61 3300009784 Ga0123357_10442766 Ga0123357_104427661 104
62 3300010049 Ga0123356_10096006 Ga0123356_100960062 104
63 3300010049 Ga0123356_10399093 Ga0123356_103990934 104
64 3300010049 Ga0123356_10427659 Ga0123356_104276592 104
65 3300010049 Ga0123356_11258556 Ga0123356_112585562 104
66 3300010049 Ga0123356_11400671 Ga0123356_114006712 104
67 3300010049 Ga0123356_12639489 Ga0123356_126394892 104
68 3300010049 Ga0123356_13217317 Ga0123356_132173171 104
69 3300010049 Ga0123356_13616993 Ga0123356_136169931 104
70 3300010049 Ga0123356_13786755 Ga0123356_137867551 104
71 3300010049 Ga0123356_14125330 Ga0123356_141253302 104
72 3300010167 Ga0123353_10068841 Ga0123353_100688414 104
73 3300010167 Ga0123353_10109673 Ga0123353_101096733 104
74 3300010167 Ga0123353_10771255 Ga0123353_107712553 104
75 3300010167 Ga0123353_11482339 Ga0123353_114823393 104
76 3300010167 Ga0123353_11880207 Ga0123353_118802071 104
77 3300010882 Ga0123354_10028982 Ga0123354_100289823 104
78 3300010882 Ga0123354_10134592 Ga0123354_101345922 104
79 3300010882 Ga0123354_10190174 Ga0123354_101901745 104
80 3300010882 Ga0123354_10365241 Ga0123354_103652412 104
81 3300010882 Ga0123354_10478091 Ga0123354_104780912 104
82 3300010882 Ga0123354_10657780 Ga0123354_106577802 104
83 3300042550 Ga0466656_350463 Ga0466656_350463_155_469 104
84 3300042594 Ga0466694_177093 Ga0466694_177093_1573_1887 104
85 3300042597 Ga0466699_187484 Ga0466699_187484_531_845 104
86 3300042597 Ga0466699_389037 Ga0466699_389037_389_703 104
87 3300042598 Ga0466701_008343 Ga0466701_008343_247_561 104
88 3300042598 Ga0466701_057738 Ga0466701_057738_1200_1514 104
89 3300042601 Ga0466707_229155 Ga0466707_229155_2186_2500 104
90 3300042605 Ga0466716_142950 Ga0466716_142950_2146_2460 104
91 3300042610 Ga0466698_258463 Ga0466698_258463_129_443 104
92 3300042612 Ga0466705_056593 Ga0466705_056593_3180_3494 104
93 3300042613 Ga0466710_049839 Ga0466710_049839_685_999 104
94 3300042613 Ga0466710_111256 Ga0466710_111256_857_1171 104
95 3300042623 Ga0466734_066928 Ga0466734_066928_982_1296 104
96 3300042623 Ga0466734_094736 Ga0466734_094736_214_528 104
97 3300042643 Ga0466704_015153 Ga0466704_015153_909_1223 104
98 3300042643 Ga0466704_043105 Ga0466704_043105_238_552 104
99 3300042648 Ga0466709_043494 Ga0466709_043494_211_525 104
100 3300042654 Ga0466725_083232 Ga0466725_083232_454_768 104
101 iso_pr_bacteria 2820741847 2820742234 104
102 iso_pr_bacteria 2820765201 2820766892 104
103 iso_pr_bacteria 2820789850 2820790062 104
104 3300002449 JGI24698J34947_10280079 JGI24698J34947_102800792 105
105 3300002504 JGI24705J35276_11564046 JGI24705J35276_115640462 105
106 3300007507 Ga0105008_1100175 Ga0105008_11001755 105
107 3300007507 Ga0105008_1117411 Ga0105008_11174115 105
108 3300009784 Ga0123357_10265835 Ga0123357_102658352 105
109 3300009826 Ga0123355_10163874 Ga0123355_101638742 105
110 3300009826 Ga0123355_10534619 Ga0123355_105346192 105
111 3300009826 Ga0123355_11919020 Ga0123355_119190201 105
112 3300010049 Ga0123356_10170766 Ga0123356_101707662 105
113 3300010049 Ga0123356_10187953 Ga0123356_101879533 105
114 3300010049 Ga0123356_10603975 Ga0123356_106039751 105
115 3300010049 Ga0123356_12640723 Ga0123356_126407232 105
116 3300010167 Ga0123353_10189312 Ga0123353_101893123 105
117 3300010167 Ga0123353_10665465 Ga0123353_106654652 105
118 3300010167 Ga0123353_10873837 Ga0123353_108738372 105
119 3300010882 Ga0123354_10771861 Ga0123354_107718611 105
120 3300012831 Ga0160459_120178 Ga0160459_1201782 105
121 3300012846 Ga0160433_100049 Ga0160433_10004923 105
122 3300012846 Ga0160433_100211 Ga0160433_1002118 105
123 3300042582 Ga0466657_363572 Ga0466657_363572_2861_3178 105
124 3300042610 Ga0466698_058322 Ga0466698_058322_705_1022 105
125 3300042619 Ga0466726_167395 Ga0466726_167395_1118_1435 105
126 3300042654 Ga0466725_156786 Ga0466725_156786_5013_5330 105
127 3300042655 Ga0466727_159417 Ga0466727_159417_36_353 105
128 2225789004 2227105802 2227491359 106
129 3300000062 IMNBL1DRAFT_c0060810 IMNBL1DRAFT_00608101 107
130 3300000062 IMNBL1DRAFT_c0040440 IMNBL1DRAFT_00404401 108
131 3300042622 Ga0466731_159560 Ga0466731_159560_759_1085 108
132 iso_pr_bacteria 2820797595 2820798998 108
133 3300010049 Ga0123356_10109749 Ga0123356_101097493 124

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01381 HTH_3 Helix-turn-helix 58 106 0.94
PF13443 HTH_26 Cro/C1-type HTH DNA-binding domain 58 109 0.91
PF13744 HTH_37 Helix-turn-helix domain 55 114 0.91
PF12844 HTH_19 Helix-turn-helix domain 55 100 0.89
PF13560 HTH_31 Helix-turn-helix domain 55 107 0.88

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.6 0.78 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.