Protein Family IF02792

Metagenome Isolate
132 Members
68 Samples
112 Scaffolds
337.56 Avg Length

🧬 Representative Sequence

ID
3300010049|Ga0123356_10094050|Ga0123356_100940501
Length
383 aa
Sequence
MMKKKAKIYVAGHTGLVGSAILKNLQQRGYKNFVLRTIEELDLTDQNAVAAFFECEKPEYVILAAAKVGGIVANNTYRADFIYENLMIQNNVIHQSYRNGVKKLVFLGSTCIYPKEANQPMKETELLTNPLEYTNEPYAIAKIAGIKMCESYNLQYGTNFIAVMPTNLYGPNDNFNLETSHVLPALIRKIHLGKCLENRDMRAIKIDLDKRPIEGIDGKSPESEIFDILEKYGMKRLPNGKVQIEIWGTGNPRREFLWSEEMADATVYIMERINFSDITASAHNVRAGLAPAPIRNTHINVGTGKDISIVEIACLIKEKTGFNGNLWFNSEKPDGTMKKLTDVSKLHSLGWRHKIEIDEGVELLYDWYLCASTSVNTTDTAR*

📊 Sample Types

Isolate 15.2%
Metagenome 84.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 33.3%
Kalotermitidae 18.2%
Blattidae 13.6%
Unclassified 10.6%
Rhinotermitidae 4.5%
Termopsidae 4.5%
Culicidae 3.0%
Hydrophilidae 3.0%
Drosophilidae 1.5%
Daphniidae 1.5%
Passalidae 1.5%
Tenebrionidae 1.5%
Muscidae 1.5%
Armadillidiidae 1.5%

🌳 Taxonomy

Archaea 0
Bacteria 125
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
2 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
3 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
4 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
5 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
6 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
7 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
8 2590828803 Pedobacter glucosidilyticus DD6b Isolate Daphniidae
9 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
10 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
11 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
12 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
13 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
14 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
15 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
16 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
17 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
18 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
19 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
20 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
21 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
22 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
23 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
24 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
25 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
26 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
27 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
28 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
29 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
30 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
31 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
32 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
33 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
34 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
35 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
36 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
37 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
38 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
39 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
40 2820178484 Unclassified Planctomycetes Th196P3bin110 Isolate Unclassified
41 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
42 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
43 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
44 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
45 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
46 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
47 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
48 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
49 8067483258 Ochrobactrum soli MTP-C0764 Isolate Muscidae
50 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
51 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
52 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
53 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
54 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
55 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
56 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
57 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
58 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
59 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
60 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
61 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
62 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
63 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
64 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
65 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
66 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
67 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
68 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466728_225673 3300042620 Bacteria 6340
2 Ga0264413_144475 3300024493 Bacteria 6139
3 Ga0415639_080526 3300038395 Bacteria 10285
4 Ga0466691_075164 3300042593 Bacteria 3771
5 Ga0466701_011297 3300042598 Bacteria 12166
6 Ga0466700_017485 3300042600 Bacteria 1688
7 Ga0466713_070638 3300042602 Bacteria 14478
8 Ga0466714_011055 3300042603 Bacteria 2037
9 Ga0466717_270802 3300042604 Bacteria 3205
10 Ga0466729_294209 3300042621 Bacteria 1256
11 Ga0466704_065939 3300042643 Bacteria 10142
12 Ga0466709_349119 3300042648 Bacteria 16327
13 Ga0123357_10093020 3300009784 Bacteria 3920
14 Ga0123357_10106610 3300009784 Bacteria 3591
15 Ga0123356_10100968 3300010049 Bacteria 2767
16 Ga0123353_10006045 3300010167 Bacteria 16039
17 Ga0123354_10053811 3300010882 Bacteria 6049
18 Ga0466705_115205 3300042612 Bacteria 20678
19 Ga0466733_078995 3300042659 Bacteria 4690
20 Ga0466711_264493 3300042615 Bacteria 3179
21 Ga0466715_160067 3300042616 Bacteria 3578
22 Ga0466690_307633 3300042590 Bacteria 1524
23 Ga0466690_311035 3300042590 Bacteria 2255
24 Ga0466713_020269 3300042602 Bacteria 1166
25 Ga0466713_094496 3300042602 Bacteria 333875
26 Ga0466713_119550 3300042602 Bacteria 166583
27 Ga0466713_141379 3300042602 Bacteria 226907
28 Ga0466735_160523 3300042624 Bacteria 1741
29 Ga0466704_312982 3300042643 Bacteria 1663
30 Ga0466704_473464 3300042643 Unclassified 2464
31 Ga0466709_402849 3300042648 Bacteria 45308
32 Ga0123356_10152436 3300010049 Bacteria 2297
33 Ga0160471_100014 3300012812 Bacteria 410119
34 Ga0160471_101272 3300012812 Bacteria 5221
35 Ga0068305_10004723 3300005083 Bacteria 26648
36 Ga0072941_1036272 3300005201 Unclassified 8963
37 Ga0466705_384234 3300042612 Bacteria 2163
38 Ga0562377_0004 3300056842 Bacteria 3525959
39 Ga0466726_224367 3300042619 Bacteria 2976
40 Ga0466698_406875 3300042610 Unclassified 1618
41 Ga0466734_054818 3300042623 Bacteria 2290
42 Ga0466704_156297 3300042643 Bacteria 3302
43 IMNBL1DRAFT_c0027745 3300000062 Unclassified 2123
44 JGI24702J35022_10024358 3300002462 Bacteria 3271
45 Ga0104045_1019850 3300007085 Bacteria 2733
46 Ga0466705_048987 3300042612 Bacteria 8011
47 Ga0466711_013308 3300042615 Bacteria 11812
48 Ga0466696_328638 3300042596 Bacteria 21209
49 Ga0466713_102919 3300042602 Bacteria 4108
50 Ga0466708_437948 3300042652 Bacteria 2925
51 Ga0123355_10071872 3300009826 Bacteria 5552
52 JGI24698J34947_10000739 3300002449 Bacteria 16118
53 JGI24698J34947_10002776 3300002449 Bacteria 9481
54 JGI24696J40584_12961543 3300002834 Bacteria 20311
55 Ga0466697_127737 3300042611 Bacteria 3390
56 Ga0466705_437719 3300042612 Bacteria 1458
57 Ga0466715_268887 3300042616 Bacteria 6599
58 Ga0160443_100200 3300012848 Bacteria 77772
59 Ga0466657_386327 3300042582 Bacteria 2845
60 Ga0466696_304445 3300042596 Bacteria 2212
61 Ga0466700_303231 3300042600 Bacteria 1854
62 Ga0466713_101204 3300042602 Bacteria 5601
63 Ga0466734_135833 3300042623 Bacteria 1814
64 Ga0466730_053547 3300042625 Bacteria 2164
65 Ga0466704_582273 3300042643 Bacteria 41967
66 Ga0466725_007379 3300042654 Bacteria 6632
67 Ga0466727_083821 3300042655 Bacteria 1233
68 JGI24698J34947_10001956 3300002449 Bacteria 10988
69 Ga0466705_181342 3300042612 Bacteria 10357
70 Ga0466711_411906 3300042615 Bacteria 26972
71 Ga0466723_103742 3300042618 Bacteria 2237
72 Ga0466707_163876 3300042601 Bacteria 13368
73 Ga0466707_172760 3300042601 Bacteria 3215
74 Ga0466713_029889 3300042602 Bacteria 53582
75 Ga0466703_233541 3300042636 Bacteria 4978
76 Ga0123356_10250326 3300010049 Bacteria 1849
77 IMNBL1DRAFT_c0017153 3300000062 Bacteria 3064
78 Ga0068305_10598301 3300005083 Unclassified 3295
79 Ga0466705_295415 3300042612 Bacteria 9760
80 Ga0466733_023171 3300042659 Bacteria 6220
81 Ga0466733_219421 3300042659 Bacteria 19732
82 Ga0466705_480992 3300042612 Bacteria 29080
83 Ga0466715_168143 3300042616 Bacteria 23764
84 Ga0466715_514350 3300042616 Bacteria 10134
85 Ga0466723_113612 3300042618 Bacteria 2237
86 Ga0466690_021486 3300042590 Bacteria 6610
87 Ga0466691_035750 3300042593 Bacteria 8416
88 Ga0466700_048707 3300042600 Bacteria 13808
89 Ga0466707_126179 3300042601 Bacteria 55735
90 Ga0466714_101779 3300042603 Bacteria 2270
91 Ga0466735_196511 3300042624 Bacteria 2846
92 Ga0123357_10026224 3300009784 Bacteria 7872
93 Ga0123353_10296437 3300010167 Bacteria 2472
94 Ga0123354_10000946 3300010882 Bacteria 32774
95 JGI24705J35276_12236200 3300002504 Bacteria 7637
96 Ga0466705_126639 3300042612 Unclassified 1765
97 Ga0466705_377004 3300042612 Bacteria 1875
98 Ga0466733_146809 3300042659 Bacteria 1883
99 Ga0466715_120204 3300042616 Bacteria 9711
100 Ga0160436_1002830 3300012861 Bacteria 4328
101 Ga0466691_094895 3300042593 Bacteria 7062
102 Ga0466696_360462 3300042596 Bacteria 1487
103 Ga0466713_045333 3300042602 Bacteria 40925
104 Ga0466713_090788 3300042602 Bacteria 2400
105 Ga0466703_070159 3300042636 Bacteria 9157
106 Ga0466709_372905 3300042648 Bacteria 38102
107 Ga0123356_10094050 3300010049 Bacteria 2862
108 Ga0123353_10033470 3300010167 Bacteria 8005
109 Ga0123353_10071820 3300010167 Bacteria 5562
110 Ga0123354_10014826 3300010882 Bacteria 12141
111 IMNBL1DRAFT_c0027856 3300000062 Bacteria 2118
112 Ga0072941_1398277 3300005201 Unclassified 1765

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042615 Ga0466711_013308 Ga0466711_013308_10615_11493 292
2 3300005083 Ga0068305_10598301 Ga0068305_105983014 297
3 3300042659 Ga0466733_219421 Ga0466733_219421_9683_10600 305
4 3300042590 Ga0466690_021486 Ga0466690_021486_1914_2837 307
5 3300042616 Ga0466715_160067 Ga0466715_160067_2385_3308 307
6 3300042643 Ga0466704_156297 Ga0466704_156297_1119_2042 307
7 3300042648 Ga0466709_372905 Ga0466709_372905_28695_29618 307
8 3300000062 IMNBL1DRAFT_c0017153 IMNBL1DRAFT_00171534 308
9 3300000062 IMNBL1DRAFT_c0027745 IMNBL1DRAFT_00277453 308
10 3300042593 Ga0466691_094895 Ga0466691_094895_99_1025 308
11 3300042618 Ga0466723_113612 Ga0466723_113612_1276_2202 308
12 3300042655 Ga0466727_083821 Ga0466727_083821_217_1146 309
13 3300007085 Ga0104045_1019850 Ga0104045_10198502 310
14 3300012861 Ga0160436_1002830 Ga0160436_10028305 310
15 3300042602 Ga0466713_119550 Ga0466713_119550_142847_143779 310
16 3300042615 Ga0466711_264493 Ga0466711_264493_686_1618 310
17 3300042643 Ga0466704_473464 Ga0466704_473464_518_1450 310
18 3300042652 Ga0466708_437948 Ga0466708_437948_802_1734 310
19 3300010049 Ga0123356_10100968 Ga0123356_101009682 311
20 3300042590 Ga0466690_311035 Ga0466690_311035_521_1456 311
21 3300042600 Ga0466700_017485 Ga0466700_017485_164_1099 311
22 3300042643 Ga0466704_312982 Ga0466704_312982_424_1359 311
23 iso_pr_bacteria 2820178484 2820178754 311
24 3300009784 Ga0123357_10106610 Ga0123357_101066104 312
25 3300010167 Ga0123353_10071820 Ga0123353_100718206 312
26 3300042601 Ga0466707_172760 Ga0466707_172760_1011_1949 312
27 3300042610 Ga0466698_406875 Ga0466698_406875_123_1061 312
28 3300024493 Ga0264413_144475 Ga0264413_1444755 313
29 3300042598 Ga0466701_011297 Ga0466701_011297_9843_10784 313
30 3300042612 Ga0466705_181342 Ga0466705_181342_8359_9300 313
31 3300042623 Ga0466734_135833 Ga0466734_135833_435_1376 313
32 iso_pr_bacteria 2590828803 2592928051 313
33 3300002449 JGI24698J34947_10000739 JGI24698J34947_100007395 314
34 3300002449 JGI24698J34947_10001956 JGI24698J34947_100019566 314
35 3300042593 Ga0466691_075164 Ga0466691_075164_1313_2257 314
36 3300042612 Ga0466705_126639 Ga0466705_126639_651_1595 314
37 3300042612 Ga0466705_437719 Ga0466705_437719_231_1175 314
38 3300042612 Ga0466705_480992 Ga0466705_480992_2141_3085 314
39 3300042616 Ga0466715_168143 Ga0466715_168143_15162_16106 314
40 3300042618 Ga0466723_103742 Ga0466723_103742_611_1555 314
41 3300042620 Ga0466728_225673 Ga0466728_225673_4932_5876 314
42 3300042643 Ga0466704_065939 Ga0466704_065939_1388_2332 314
43 iso_pr_bacteria 2529293168 2531455730 314
44 3300005083 Ga0068305_10004723 Ga0068305_1000472313 315
45 3300012812 Ga0160471_100014 Ga0160471_10001495 315
46 3300012848 Ga0160443_100200 Ga0160443_10020017 315
47 3300042596 Ga0466696_360462 Ga0466696_360462_161_1108 315
48 3300042612 Ga0466705_048987 Ga0466705_048987_4516_5463 315
49 3300009784 Ga0123357_10093020 Ga0123357_100930204 317
50 3300042623 Ga0466734_054818 Ga0466734_054818_1260_2213 317
51 3300009826 Ga0123355_10071872 Ga0123355_100718726 318
52 3300010049 Ga0123356_10152436 Ga0123356_101524363 318
53 3300042582 Ga0466657_386327 Ga0466657_386327_170_1126 318
54 3300042654 Ga0466725_007379 Ga0466725_007379_4729_5685 318
55 3300005201 Ga0072941_1036272 Ga0072941_10362725 319
56 3300012812 Ga0160471_101272 Ga0160471_1012723 319
57 3300042590 Ga0466690_307633 Ga0466690_307633_399_1358 319
58 3300042616 Ga0466715_268887 Ga0466715_268887_3328_4287 319
59 3300038395 Ga0415639_080526 Ga0415639_080526_2184_3146 320
60 3300042593 Ga0466691_035750 Ga0466691_035750_1745_2707 320
61 3300002449 JGI24698J34947_10002776 JGI24698J34947_100027764 321
62 3300042596 Ga0466696_328638 Ga0466696_328638_16007_16972 321
63 3300042602 Ga0466713_020269 Ga0466713_020269_135_1100 321
64 3300010882 Ga0123354_10053811 Ga0123354_100538114 322
65 3300042596 Ga0466696_304445 Ga0466696_304445_202_1251 323
66 3300009784 Ga0123357_10026224 Ga0123357_100262247 326
67 3300010882 Ga0123354_10014826 Ga0123354_100148268 327
68 iso_pr_bacteria 8067483258 8067484281 327
69 3300042600 Ga0466700_303231 Ga0466700_303231_438_1433 331
70 3300042601 Ga0466707_126179 Ga0466707_126179_8461_9531 342
71 3300042602 Ga0466713_090788 Ga0466713_090788_242_1324 346
72 3300002834 JGI24696J40584_12961543 JGI24696J40584_1296154316 348
73 3300000062 IMNBL1DRAFT_c0027856 IMNBL1DRAFT_00278562 349
74 3300042619 Ga0466726_224367 Ga0466726_224367_1586_2635 349
75 3300005201 Ga0072941_1398277 Ga0072941_13982772 350
76 3300042616 Ga0466715_514350 Ga0466715_514350_8266_9327 353
77 3300042602 Ga0466713_029889 Ga0466713_029889_26014_27084 356
78 3300042600 Ga0466700_048707 Ga0466700_048707_6740_7822 360
79 3300042604 Ga0466717_270802 Ga0466717_270802_1992_3080 362
80 3300042611 Ga0466697_127737 Ga0466697_127737_255_1343 362
81 3300042624 Ga0466735_196511 Ga0466735_196511_1065_2153 362
82 3300042636 Ga0466703_070159 Ga0466703_070159_2847_3959 362
83 3300002504 JGI24705J35276_12236200 JGI24705J35276_122362002 363
84 3300042612 Ga0466705_115205 Ga0466705_115205_15632_16723 363
85 3300042612 Ga0466705_295415 Ga0466705_295415_4091_5182 363
86 3300042643 Ga0466704_582273 Ga0466704_582273_24109_25200 363
87 3300042648 Ga0466709_349119 Ga0466709_349119_6132_7223 363
88 3300002462 JGI24702J35022_10024358 JGI24702J35022_100243583 364
89 3300010167 Ga0123353_10033470 Ga0123353_100334707 364
90 3300042601 Ga0466707_163876 Ga0466707_163876_10578_11672 364
91 3300042602 Ga0466713_141379 Ga0466713_141379_15550_16644 364
92 3300042612 Ga0466705_384234 Ga0466705_384234_199_1293 364
93 3300042621 Ga0466729_294209 Ga0466729_294209_80_1174 364
94 3300042625 Ga0466730_053547 Ga0466730_053547_657_1751 364
95 3300042659 Ga0466733_023171 Ga0466733_023171_2176_3270 364
96 iso_pr_bacteria 2910949487 2910952695 364
97 3300010882 Ga0123354_10000946 Ga0123354_1000094628 365
98 3300042602 Ga0466713_045333 Ga0466713_045333_8112_9209 365
99 3300042602 Ga0466713_094496 Ga0466713_094496_197043_198140 365
100 3300042624 Ga0466735_160523 Ga0466735_160523_566_1663 365
101 3300042659 Ga0466733_146809 Ga0466733_146809_106_1203 365
102 3300010167 Ga0123353_10006045 Ga0123353_1000604514 366
103 3300042602 Ga0466713_070638 Ga0466713_070638_1861_2961 366
104 3300042603 Ga0466714_011055 Ga0466714_011055_100_1200 366
105 3300042603 Ga0466714_101779 Ga0466714_101779_221_1321 366
106 3300042615 Ga0466711_411906 Ga0466711_411906_1387_2487 366
107 3300042616 Ga0466715_120204 Ga0466715_120204_8137_9237 366
108 3300042636 Ga0466703_233541 Ga0466703_233541_2429_3529 366
109 3300042648 Ga0466709_402849 Ga0466709_402849_39411_40511 366
110 3300042659 Ga0466733_078995 Ga0466733_078995_3542_4642 366
111 iso_pr_bacteria 2695420314 2695471751 366
112 iso_pr_bacteria 2695420317 2695483866 366
113 iso_pr_bacteria 2910959314 2910960778 366
114 iso_pr_bacteria 2940193328 2940195115 366
115 iso_pr_bacteria 2940244548 2940245798 366
116 iso_pr_bacteria 2940248789 2940250049 366
117 iso_pr_bacteria 2940253009 2940254224 366
118 iso_pr_bacteria 2940257232 2940258291 366
119 iso_pr_bacteria 2940336608 2940338389 366
120 iso_pr_bacteria 8100157865 8100160835 366
121 iso_pr_bacteria 8100166142 8100166756 366
122 3300010049 Ga0123356_10250326 Ga0123356_102503262 367
123 3300010167 Ga0123353_10296437 Ga0123353_102964372 367
124 3300042612 Ga0466705_377004 Ga0466705_377004_657_1760 367
125 iso_pr_bacteria 2873600114 2873600808 367
126 iso_pr_bacteria 2873610414 2873611131 367
127 3300042602 Ga0466713_101204 Ga0466713_101204_3414_4520 368
128 3300042602 Ga0466713_102919 Ga0466713_102919_1116_2222 368
129 3300056842 Ga0562377_0004 Ga0562377_0004_2154490_2155596 368
130 iso_pr_bacteria 2695420931 2698112109 369
131 iso_pr_bacteria 2910930387 2910931878 369
132 3300010049 Ga0123356_10094050 Ga0123356_100940501 383

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01370 Epimerase NAD dependent epimerase/dehydratase family 8 194 0.95
PF04321 RmlD_sub_bind RmlD substrate binding domain 7 133 0.81
PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase 39 194 0.75

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.87 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.