Protein Family IF02778

Metagenome Isolate
326 Members
217 Samples
189 Scaffolds
279.56 Avg Length

🧬 Representative Sequence

ID
3300010049|Ga0123356_10080241|Ga0123356_100802412
Length
309 aa
Sequence
VPRARSARPSSRGRREPERGGAHGRWRQPQVMQLAGHEVGTGQPLFLIAGPCVIESPTLTQEIAGRLKEVTARLRIPYIFKASYDKANRSSQGSFRGPGIDAGLKVLEGVRRAVGVPVLTDVHEDTPLGEVAAVVDVLQTPAFLCRQTNFIVNTASQGKPVNIKKGQFLSPWEMQNVVDKARSTGNEHIMVCERGFSFGYNNLVSDMRSLSILRATGCPVVFDATHSVQLPGGRGSSSGGQREFIPVLARAAVAAGVAGLFMETHPRPEEALSDGPNAWPLARMEPLLTTLTELDRAVKKVPFEESLL*

📊 Sample Types

Isolate 42.0%
Metagenome 58.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Coreidae 38.3%
Termitidae 11.5%
Formicidae 9.1%
Unclassified 7.7%
Kalotermitidae 5.7%
Elmidae 5.3%
Culicidae 4.3%
Ixodidae 3.3%
Armadillidiidae 3.3%
Argasidae 1.9%
Curculionidae 1.4%
Hydrophilidae 1.4%
Largidae 1.0%
Berytidae 1.0%
Rhinotermitidae 1.0%
Termopsidae 1.0%
Alydidae 1.0%
Cixiidae 0.5%
Stratiomyidae 0.5%
Sarcophagidae 0.5%
Passalidae 0.5%

🌳 Taxonomy

Archaea 0
Bacteria 315
Eukaryota 0
Viruses 0
Unclassified 11

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2718217749 Coxiella mudrowiae CRt Isolate Ixodidae
2 2864812326 Chitinimonas taiwanensis S00057 Isolate Elmidae
3 2864859030 Chromobacterium alkanivorans S00115 Isolate Elmidae
4 2864960361 Comamonas odontotermitis S00229 Isolate Elmidae
5 2868169047 Comamonas aquatica S00077 Isolate Elmidae
6 2871564055 Francisella tularensis holarctica FT9C-G7 Isolate Ixodidae
7 2874203443 Francisella tularensis holarctica FT8C-4F Isolate Ixodidae
8 8023757577 Caballeronia peredens LP006 Isolate Coreidae
9 8023764196 Caballeronia peredens LZ001 Isolate Coreidae
10 8025678175 Caballeronia hypogeia LZ043 Isolate Coreidae
11 8025728939 Caballeronia telluris LZ024 Isolate Coreidae
12 8025747911 Caballeronia peredens LZ003 Isolate Coreidae
13 8069755105 Caballeronia sp. LZ003 Isolate Coreidae
14 8069775773 Caballeronia sp. LZ062 Isolate Coreidae
15 8100461708 Delftia sp. S65 Isolate Curculionidae
16 8101951471 Caballeronia sp. AAUFL_F1_KS45 Isolate Coreidae
17 8101974301 Caballeronia sp. ASUFL_F2_KS49 Isolate Coreidae
18 8101981714 Caballeronia sp. ATUFL_F1_KS39 Isolate Coreidae
19 8102020860 Caballeronia sp. AZ10_KS36 Isolate Coreidae
20 8102026984 Caballeronia sp. AZ1_KS37 Isolate Coreidae
21 8102067727 Caballeronia sp. GAFFF3 Isolate Coreidae
22 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
23 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
24 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
25 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
26 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
27 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
28 2506210010 Francisella tularensis tularensis FSC041 Isolate
29 2506210015 Francisella tularensis holarctica FSC185 Isolate
30 2864755708 Massilia timonae S00006 Isolate Elmidae
31 2874209778 Francisella tularensis holarctica FT16C-B1 Isolate Ixodidae
32 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
33 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
34 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
35 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
36 637000113 Francisella tularensis tularensis FSC 198 Isolate
37 8023747282 Caballeronia zhejiangensis LZ019 Isolate Coreidae
38 8024025509 Caballeronia grimmiae Lep1A1 Isolate Coreidae
39 8024037630 Caballeronia zhejiangensis A33_M4_a Isolate Coreidae
40 8025685901 Caballeronia fortuita LZ035 Isolate Coreidae
41 8025723035 Caballeronia grimmiae LZ025 Isolate Coreidae
42 8025756023 Caballeronia peredens LZ002 Isolate Coreidae
43 8078130113 Caballeronia sp. INDeC2 Isolate Coreidae
44 8100455565 Delftia sp. S67 Isolate Curculionidae
45 8102054868 Caballeronia sp. GAFFF1 Isolate Coreidae
46 8102102351 Caballeronia sp. INML1 Isolate Coreidae
47 8102161003 Caballeronia sp. LZ002 Isolate Coreidae
48 8102174626 Caballeronia sp. LZ024 Isolate Coreidae
49 8102246966 Caballeronia sp. LZ050 Isolate Coreidae
50 3003869270 Paraburkholderia sp. PGU16 Isolate Largidae
51 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
52 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
53 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
54 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
55 2832201259 Rickettsiella grylli TrM1 Isolate Unclassified
56 2838140227 Dyella sp. OAE510 Isolate Unclassified
57 8024014383 Caballeronia sp. SL2Y3 Isolate Berytidae
58 8025740903 Caballeronia zhejiangensis LZ008 Isolate Coreidae
59 8069748016 Caballeronia sp. LP003 Isolate Coreidae
60 8102033761 Caballeronia sp. AZ7_KS35 Isolate Coreidae
61 8102094248 Caballeronia sp. GaOx3 Isolate Coreidae
62 8102109360 Caballeronia sp. INML2 Isolate Coreidae
63 8102145433 Caballeronia sp. LP006 Isolate Coreidae
64 8102186987 Caballeronia sp. LZ028 Isolate Coreidae
65 8102223607 Caballeronia sp. LZ034LL Isolate Coreidae
66 8102286609 Caballeronia sp. NCTM5 Isolate Coreidae
67 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
68 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
69 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
70 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
71 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
72 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
73 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
74 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
75 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
76 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
77 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
78 2648501628 Xanthomonas sp. Cag60 Isolate Unclassified
79 2791354884 Francisella endosymbiont of Amblyomma maculatum FLE-Am Isolate Ixodidae
80 2820103659 Unclassified Proteobacteria Emb289P4bin67 Isolate Unclassified
81 2820164216 Unclassified Proteobacteria Cu122P1bin22 Isolate Unclassified
82 2848339753 Ephemeroptericola cinctiostellae F02 Isolate Unclassified
83 2864914039 Chromobacterium alkanivorans S00172 Isolate Elmidae
84 2864988360 Chromobacterium alkanivorans S00296 Isolate Elmidae
85 8023724303 Caballeronia zhejiangensis LP003 Isolate Coreidae
86 8024001094 Caballeronia sp. TF1N1 Isolate Berytidae
87 8025666332 Caballeronia grimmiae LZ050 Isolate Coreidae
88 8025694439 Caballeronia cordobensis LZ033 Isolate Coreidae
89 8025701579 Caballeronia telluris LZ031 Isolate Coreidae
90 8101967387 Caballeronia sp. AAUFL_F3_KS11A Isolate Coreidae
91 8102007614 Caballeronia sp. ATUFL_M1_KS5A Isolate Coreidae
92 8102041249 Caballeronia sp. GACF4 Isolate Coreidae
93 8102087471 Caballeronia sp. GAWG2-1 Isolate Coreidae
94 8102201977 Caballeronia sp. LZ031 Isolate Coreidae
95 8102264549 Caballeronia sp. NCF2 Isolate Coreidae
96 3002773460 Coxiella endosymbiont of Amblyomma nuttalli Craf2019 Isolate Ixodidae
97 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
98 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
99 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
100 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
101 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
102 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
103 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
104 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
105 2518285616 Brachymonas chironomi DSM 19884 Isolate Unclassified
106 2617270844 Dyella sp. HyOG Isolate Cixiidae
107 2772190782 Francisella persica ATCC VR-331 Isolate Argasidae
108 2775506951 Candidatus Coxiella mudrowiae CRS-CAT Isolate Unclassified
109 2820110010 Unclassified Proteobacteria Emb289P4bin35 Isolate Unclassified
110 2873565274 Diaphorobacter sp. HDW4A Isolate Hydrophilidae
111 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
112 8025658853 Caballeronia temeraria LZ065 Isolate Coreidae
113 8025708040 Caballeronia jiangsuensis LZ029 Isolate Coreidae
114 8069770227 Caballeronia sp. LZ019 Isolate Coreidae
115 8101994502 Caballeronia sp. ATUFL_F2_KS42 Isolate Coreidae
116 8102124461 Caballeronia sp. INML3B Isolate Coreidae
117 8102193924 Caballeronia sp. LZ029 Isolate Coreidae
118 8102312426 Caballeronia sp. AAUFL_F1_KS47 Isolate Coreidae
119 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
120 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
121 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
122 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
123 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
124 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
125 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
126 2788500057 Francisella-like endosymbiont F-Om Isolate Argasidae
127 2791354930 Wohlfahrtiimonas larvae kbl006 Isolate Stratiomyidae
128 2820080004 Unclassified Proteobacteria Lab288P4bin34 Isolate Unclassified
129 2820157249 Unclassified Proteobacteria Cu122P4bin11 Isolate Unclassified
130 2820161938 Unclassified Proteobacteria Cu122P3bin14 Isolate Unclassified
131 2864870719 Comamonas odontotermitis S00124 Isolate Elmidae
132 2864937364 Acidovorax soli S00198 Isolate Elmidae
133 2871595141 Francisella tularensis 503 Isolate Ixodidae
134 2963630348 Burkholderiales bacterium 3487_49 Isolate Formicidae
135 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
136 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
137 8025650824 Caballeronia hypogeia LZ032 Isolate Coreidae
138 8025671076 Caballeronia cordobensis LZ034LL Isolate Coreidae
139 8025735396 Caballeronia zhejiangensis LZ016 Isolate Coreidae
140 8102047609 Caballeronia sp. GACF5 Isolate Coreidae
141 8102074813 Caballeronia sp. GAWG1-1 Isolate Coreidae
142 8102081745 Caballeronia sp. GAWG1-5s-s Isolate Coreidae
143 8102117041 Caballeronia sp. INML3 Isolate Coreidae
144 8102131453 Caballeronia sp. INML5 Isolate Coreidae
145 8102138357 Caballeronia sp. INSB1 Isolate Coreidae
146 8102216467 Caballeronia sp. LZ033 Isolate Coreidae
147 8102230706 Caballeronia sp. LZ035 Isolate Coreidae
148 8102239244 Caballeronia sp. LZ043 Isolate Coreidae
149 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
150 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
151 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
152 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
153 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
154 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
155 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
156 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
157 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
158 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
159 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
160 2517487021 Wohlfahrtiimonas chitiniclastica DSM 18708 Isolate Sarcophagidae
161 2791354885 Francisella endosymbiont of Ornithodoros moubata FLE-Om Isolate Argasidae
162 2806310685 Francisella persica ATCC VR-331 Isolate Argasidae
163 2820056190 Unclassified Proteobacteria Nt197P4bin9 Isolate Unclassified
164 2864826666 Acidovorax konjaci S00067 Isolate Elmidae
165 2873562573 Thermomonas sp. HDW16 Isolate Hydrophilidae
166 2873571580 Diaphorobacter sp. HDW4B Isolate Hydrophilidae
167 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
168 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
169 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
170 8025716094 Caballeronia zhejiangensis LZ028 Isolate Coreidae
171 8101960468 Caballeronia sp. AAUFL_F2_KS46 Isolate Coreidae
172 8101988189 Caballeronia sp. ATUFL_F1_KS4A Isolate Coreidae
173 8102014801 Caballeronia sp. ATUFL_M2_KS44 Isolate Coreidae
174 8102060671 Caballeronia sp. GAFFF2 Isolate Coreidae
175 8102152052 Caballeronia sp. LZ001 Isolate Coreidae
176 8102208438 Caballeronia sp. LZ032 Isolate Coreidae
177 8102251710 Caballeronia sp. LZ065 Isolate Coreidae
178 8102279326 Caballeronia sp. NCTM1 Isolate Coreidae
179 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
180 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
181 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
182 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
183 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
184 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
185 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
186 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
187 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
188 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
189 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
190 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
191 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
192 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
193 2562617066 Rickettsiella grylli AAQJ Isolate Armadillidiidae
194 2597489944 Caballeronia insecticola RPE64 Isolate Alydidae
195 2820077244 Unclassified Proteobacteria Lab288P4bin72 Isolate Unclassified
196 2834230000 Pandoraea novymonadis E262 Isolate Unclassified
197 2864808494 Chitinimonas taiwanensis S00056 Isolate Elmidae
198 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
199 8023752828 Caballeronia grimmiae LZ062 Isolate Coreidae
200 8024019580 Caballeronia sp. Lep1P3 Isolate Coreidae
201 8024031916 Cupriavidus pauculus BHJ32i Isolate Alydidae
202 8024044713 Caballeronia sp. Sq4a Isolate Coreidae
203 8069763219 Caballeronia sp. LZ008 Isolate Coreidae
204 8100449422 Delftia sp. S66 Isolate Curculionidae
205 8102001125 Caballeronia sp. ATUFL_F2_KS9A Isolate Coreidae
206 8102169119 Caballeronia sp. LZ016 Isolate Coreidae
207 8102181083 Caballeronia sp. LZ025 Isolate Coreidae
208 8102271933 Caballeronia sp. NCF4 Isolate Coreidae
209 3003878002 Paraburkholderia sp. PGU19 Isolate Largidae
210 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
211 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
212 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
213 3300007733 Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean Metagenome
214 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
215 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
216 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
217 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466701_077653 3300042598 Bacteria 304895
2 Ga0466701_096100 3300042598 Bacteria 3279
3 Ga0466717_003492 3300042604 Bacteria 5023
4 Ga0466722_247357 3300042609 Bacteria 288950
5 Ga0466697_045293 3300042611 Bacteria 2250
6 Ga0123355_10061357 3300009826 Bacteria 6071
7 Ga0123353_10332162 3300010167 Bacteria 2300
8 Ga0123353_10415405 3300010167 Bacteria 1996
9 Ga0160471_100016 3300012812 Bacteria 402972
10 Ga0160432_100725 3300012818 Bacteria 16458
11 Ga0160472_100371 3300012839 Bacteria 38656
12 Ga0160434_102083 3300012850 Bacteria 3520
13 Ga0415639_278816 3300038395 Bacteria 2944
14 Ga0466690_139684 3300042590 Bacteria 11475
15 CVPL010W_10001564 3300002931 Bacteria 26866
16 Ga0102740_1000129 3300007140 Bacteria 19930
17 Ga0102738_1014067 3300007141 Bacteria 1109
18 Ga0103264_1000567 3300007188 Bacteria 18626
19 Ga0466734_078952 3300042623 Bacteria 8331
20 Ga0466703_051818 3300042636 Bacteria 6790
21 Ga0466703_432287 3300042636 Bacteria 3135
22 Ga0466724_42462 3300042649 Bacteria 351483
23 Ga0466725_116312 3300042654 Bacteria 6907
24 Ga0466701_021249 3300042598 Bacteria 30446
25 Ga0466701_044683 3300042598 Bacteria 27504
26 Ga0466710_072988 3300042613 Bacteria 5702
27 Ga0466710_076766 3300042613 Bacteria 16294
28 Ga0466715_047484 3300042616 Bacteria 34891
29 Ga0123357_10088391 3300009784 Bacteria 4049
30 Ga0123353_10667521 3300010167 Bacteria 1467
31 Ga0123353_10856401 3300010167 Bacteria 1245
32 Ga0123354_10000052 3300010882 Bacteria 88097
33 Ga0123354_10026529 3300010882 Bacteria 9138
34 Ga0160472_101048 3300012839 Bacteria 9669
35 Ga0160445_100005 3300012847 Bacteria 401996
36 Ga0160430_106051 3300012852 Bacteria 2653
37 Ga0160436_1000133 3300012861 Bacteria 37976
38 Ga0466657_199262 3300042582 Bacteria 14589
39 Ga0466657_233508 3300042582 Bacteria 1418
40 CVPL010W_10005276 3300002931 Unclassified 13900
41 Ga0102735_1001153 3300007080 Bacteria 4671
42 Ga0103261_1000371 3300007083 Bacteria 6903
43 Ga0102739_1000022 3300007095 Bacteria 83604
44 Ga0102734_1027581 3300007129 Bacteria 1449
45 Ga0102738_1000012 3300007141 Bacteria 104606
46 Ga0466724_16812 3300042649 Bacteria 126976
47 Ga0466725_102756 3300042654 Bacteria 11673
48 Ga0466727_085772 3300042655 Bacteria 22474
49 Ga0466705_070465 3300042612 Bacteria 16060
50 Ga0466705_111194 3300042612 Bacteria 28569
51 Ga0466710_061683 3300042613 Bacteria 2128
52 Ga0466728_046653 3300042620 Bacteria 14589
53 Ga0123355_10403242 3300009826 Bacteria 1762
54 Ga0123353_10165295 3300010167 Bacteria 3518
55 Ga0160470_103328 3300012813 Bacteria 2623
56 Ga0160440_100002 3300012815 Bacteria 1234951
57 Ga0160444_100896 3300012841 Bacteria 7975
58 Ga0160430_100434 3300012852 Bacteria 24417
59 Ga0466657_306800 3300042582 Bacteria 3042
60 Ga0466693_337227 3300042592 Bacteria 2505
61 JGI24695J34938_10093226 3300002450 Bacteria 1234
62 CVPL010W_10000661 3300002931 Bacteria 37920
63 Ga0103263_100312 3300007042 Bacteria 6817
64 Ga0103266_1000311 3300007067 Bacteria 11689
65 Ga0103261_1000035 3300007083 Bacteria 82381
66 Ga0102737_1000483 3300007142 Bacteria 13028
67 Ga0103268_1019627 3300007192 Bacteria 1517
68 Ga0466730_006458 3300042625 Bacteria 2279
69 Ga0466709_080644 3300042648 Bacteria 1516
70 Ga0466724_02620 3300042649 Bacteria 10317
71 Ga0466724_41048 3300042649 Bacteria 7429
72 Ga0466725_059116 3300042654 Bacteria 97832
73 Ga0466733_029354 3300042659 Bacteria 2369
74 Ga0466733_088899 3300042659 Bacteria 1464
75 Ga0466701_016197 3300042598 Bacteria 39239
76 Ga0466701_031552 3300042598 Bacteria 1169
77 Ga0466697_025137 3300042611 Bacteria 2848
78 Ga0466710_060774 3300042613 Bacteria 6383
79 Ga0466715_479096 3300042616 Bacteria 2000
80 Ga0160470_106734 3300012813 Unclassified 1298
81 Ga0160472_105769 3300012839 Bacteria 1940
82 Ga0160460_103635 3300012845 Bacteria 2644
83 Ga0160435_1000532 3300012857 Bacteria 11936
84 Ga0160435_1005927 3300012857 Bacteria 2735
85 Ga0466657_204968 3300042582 Bacteria 2659
86 Ga0466690_142660 3300042590 Bacteria 40464
87 Ga0466692_016490 3300042591 Bacteria 11922
88 Ga0466693_189608 3300042592 Bacteria 1810
89 Ga0466691_127293 3300042593 Bacteria 19896
90 JGI24699J35502_10928434 3300002509 Bacteria 1112
91 Ga0102738_1002354 3300007141 Bacteria 2825
92 Ga0102737_1000180 3300007142 Bacteria 36236
93 Ga0123357_10000248 3300009784 Bacteria 51506
94 Ga0466734_127123 3300042623 Bacteria 6128
95 Ga0466724_35850 3300042649 Bacteria 120573
96 Ga0466725_009848 3300042654 Bacteria 2700
97 Ga0466705_178621 3300042612 Bacteria 90956
98 Ga0466732_076278 3300042656 Bacteria 95751
99 Ga0466701_076363 3300042598 Bacteria 43029
100 Ga0466707_103383 3300042601 Bacteria 21094
101 Ga0466711_059368 3300042615 Bacteria 2364
102 Ga0466726_143850 3300042619 Bacteria 4164
103 Ga0123356_10086296 3300010049 Bacteria 2979
104 Ga0160467_100001 3300012829 Bacteria 1734829
105 Ga0160459_100089 3300012831 Bacteria 102263
106 Ga0160443_101424 3300012848 Bacteria 8129
107 Ga0160457_1000027 3300012858 Bacteria 297202
108 Ga0160457_1000042 3300012858 Bacteria 211595
109 Ga0160457_1000734 3300012858 Bacteria 12141
110 Ga0466657_050740 3300042582 Bacteria 2897
111 Ga0466657_249994 3300042582 Bacteria 28084
112 Ga0466691_082553 3300042593 Bacteria 46868
113 Ga0103263_100729 3300007042 Bacteria 4480
114 Ga0102736_1000549 3300007052 Bacteria 7525
115 Ga0103265_1000407 3300007068 Bacteria 7312
116 Ga0103260_1001076 3300007139 Unclassified 5006
117 Ga0102738_1000081 3300007141 Bacteria 36237
118 Ga0103267_1000027 3300007190 Bacteria 53284
119 Ga0105524_100650 3300007733 Bacteria 5429
120 Ga0466734_070958 3300042623 Bacteria 8225
121 Ga0466734_098091 3300042623 Bacteria 6001
122 Ga0466734_102458 3300042623 Bacteria 1816
123 Ga0466730_031103 3300042625 Unclassified 4003
124 Ga0466703_290279 3300042636 Bacteria 16011
125 Ga0466704_273906 3300042643 Bacteria 6599
126 Ga0466701_023499 3300042598 Bacteria 2338
127 Ga0466716_133844 3300042605 Bacteria 9554
128 Ga0466719_232588 3300042606 Bacteria 3959
129 Ga0123357_10005748 3300009784 Bacteria 14939
130 Ga0123356_10080241 3300010049 Bacteria 3084
131 Ga0123356_10262739 3300010049 Bacteria 1811
132 Ga0160466_105124 3300012809 Bacteria 1781
133 Ga0160440_100119 3300012815 Bacteria 78831
134 Ga0160433_100314 3300012846 Bacteria 30998
135 IMNBGM34_c000927 3300000036 Bacteria 6365
136 JGI24705J35276_12236565 3300002504 Bacteria 8334
137 CVPL005L_10042462 3300002938 Unclassified 1282
138 Ga0103260_1000299 3300007139 Bacteria 9810
139 Ga0102738_1014710 3300007141 Bacteria 1088
140 Ga0102737_1000610 3300007142 Bacteria 11596
141 Ga0103264_1000748 3300007188 Bacteria 15219
142 Ga0103264_1052991 3300007188 Bacteria 1546
143 Ga0466725_081387 3300042654 Bacteria 22327
144 Ga0466697_093277 3300042611 Bacteria 2569
145 Ga0466705_311150 3300042612 Bacteria 166746
146 Ga0466701_069503 3300042598 Bacteria 91243
147 Ga0466710_107916 3300042613 Bacteria 1094
148 Ga0466718_010427 3300042617 Bacteria 4610
149 Ga0160466_100023 3300012809 Bacteria 285785
150 Ga0160471_106194 3300012812 Bacteria 1518
151 Ga0160467_100860 3300012829 Unclassified 19335
152 Ga0160447_108274 3300012849 Bacteria 2507
153 Ga0160447_108412 3300012849 Unclassified 2471
154 Ga0160436_1000644 3300012861 Unclassified 12005
155 Ga0415639_004022 3300038395 Bacteria 2626
156 Ga0466693_400643 3300042592 Bacteria 4650
157 Ga0466695_105802 3300042595 Bacteria 5846
158 IMNBGM34_c000673 3300000036 Bacteria 8300
159 Ga0102735_1000064 3300007080 Bacteria 53865
160 Ga0102739_1005580 3300007095 Bacteria 1715
161 Ga0102734_1029275 3300007129 Bacteria 2190
162 Ga0102740_1001868 3300007140 Bacteria 5101
163 Ga0102737_1001428 3300007142 Bacteria 6652
164 Ga0103264_1000007 3300007188 Bacteria 144836
165 Ga0103264_1000894 3300007188 Bacteria 13451
166 Ga0466730_055720 3300042625 Bacteria 4117
167 Ga0466725_241563 3300042654 Bacteria 75848
168 Ga0466725_317547 3300042654 Bacteria 12290
169 Ga0466697_121726 3300042611 Bacteria 6359
170 Ga0466701_082473 3300042598 Bacteria 1345
171 Ga0466721_216144 3300042608 Bacteria 3958
172 Ga0466715_357484 3300042616 Bacteria 57051
173 Ga0123355_10204899 3300009826 Unclassified 2872
174 Ga0123356_10099337 3300010049 Bacteria 2789
175 Ga0123354_10000087 3300010882 Bacteria 68259
176 Ga0160467_100464 3300012829 Bacteria 39612
177 Ga0466657_039117 3300042582 Bacteria 1316
178 CVPL010W_10006262 3300002931 Bacteria 14321
179 CVPL005W_1000327 3300002934 Unclassified 20701
180 Ga0102736_1000023 3300007052 Bacteria 70447
181 Ga0103260_1000923 3300007139 Bacteria 5448
182 Ga0102737_1011525 3300007142 Unclassified 1463
183 Ga0103268_1000948 3300007192 Bacteria 7834
184 Ga0466734_098996 3300042623 Bacteria 21366
185 Ga0466734_162269 3300042623 Bacteria 3331
186 Ga0466730_029404 3300042625 Bacteria 69048
187 Ga0466730_078531 3300042625 Bacteria 132731
188 Ga0466703_238599 3300042636 Bacteria 7902
189 Ga0466708_096807 3300042652 Bacteria 14346

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300007129 Ga0102734_1029275 Ga0102734_10292752 241
2 3300042582 Ga0466657_233508 Ga0466657_233508_86_832 248
3 3300042592 Ga0466693_337227 Ga0466693_337227_1458_2288 248
4 3300042615 Ga0466711_059368 Ga0466711_059368_1005_1838 248
5 3300042656 Ga0466732_076278 Ga0466732_076278_30688_31434 248
6 3300042598 Ga0466701_082473 Ga0466701_082473_159_1040 249
7 3300042616 Ga0466715_047484 Ga0466715_047484_29830_30666 249
8 3300042654 Ga0466725_059116 Ga0466725_059116_45539_46378 250
9 3300042620 Ga0466728_046653 Ga0466728_046653_4853_5704 252
10 3300042613 Ga0466710_060774 Ga0466710_060774_3983_4828 253
11 3300042625 Ga0466730_055720 Ga0466730_055720_2806_3573 255
12 3300010167 Ga0123353_10667521 Ga0123353_106675211 257
13 3300010882 Ga0123354_10026529 Ga0123354_1002652910 257
14 3300042598 Ga0466701_076363 Ga0466701_076363_1138_1995 257
15 3300010049 Ga0123356_10262739 Ga0123356_102627392 259
16 3300042616 Ga0466715_479096 Ga0466715_479096_1096_1929 259
17 3300007095 Ga0102739_1005580 Ga0102739_10055802 260
18 3300042590 Ga0466690_139684 Ga0466690_139684_2272_3105 260
19 3300002931 CVPL010W_10000661 CVPL010W_1000066122 261
20 3300042636 Ga0466703_051818 Ga0466703_051818_2623_3408 261
21 3300042636 Ga0466703_238599 Ga0466703_238599_2155_2940 261
22 3300002931 CVPL010W_10001564 CVPL010W_100015647 262
23 3300002934 CVPL005W_1000327 CVPL005W_100032717 262
24 3300042604 Ga0466717_003492 Ga0466717_003492_1876_2733 262
25 3300010882 Ga0123354_10000087 Ga0123354_1000008737 264
26 3300042619 Ga0466726_143850 Ga0466726_143850_616_1458 264
27 iso_pr_bacteria 2873571580 2873572574 264
28 3300002938 CVPL005L_10042462 CVPL005L_100424622 266
29 3300042598 Ga0466701_069503 Ga0466701_069503_76375_77232 266
30 3300042623 Ga0466734_098996 Ga0466734_098996_2297_3136 266
31 3300010167 Ga0123353_10856401 Ga0123353_108564011 267
32 3300042582 Ga0466657_199262 Ga0466657_199262_10947_11813 267
33 3300042601 Ga0466707_103383 Ga0466707_103383_158_976 267
34 3300042625 Ga0466730_029404 Ga0466730_029404_16141_16998 267
35 3300042636 Ga0466703_432287 Ga0466703_432287_126_929 267
36 3300042652 Ga0466708_096807 Ga0466708_096807_6491_7363 268
37 3300042655 Ga0466727_085772 Ga0466727_085772_18431_19282 268
38 3300042625 Ga0466730_031103 Ga0466730_031103_1078_1935 269
39 3300042649 Ga0466724_35850 Ga0466724_35850_498_1355 269
40 3300042649 Ga0466724_41048 Ga0466724_41048_6150_7007 269
41 3300002450 JGI24695J34938_10093226 JGI24695J34938_100932262 270
42 3300042612 Ga0466705_178621 Ga0466705_178621_38728_39540 270
43 3300042612 Ga0466705_311150 Ga0466705_311150_45006_45818 270
44 3300000036 IMNBGM34_c000673 IMNBGM34_0006733 272
45 3300007142 Ga0102737_1001428 Ga0102737_10014289 272
46 iso_pr_bacteria 2517487021 2517563732 272
47 iso_pr_bacteria 2791354930 2792023751 272
48 iso_pr_bacteria 2820110010 2820110953 272
49 3300009784 Ga0123357_10005748 Ga0123357_1000574820 273
50 3300010049 Ga0123356_10086296 Ga0123356_100862963 273
51 3300010167 Ga0123353_10165295 Ga0123353_101652954 274
52 3300042659 Ga0466733_088899 Ga0466733_088899_88_945 274
53 3300007188 Ga0103264_1000894 Ga0103264_100089410 275
54 3300038395 Ga0415639_004022 Ga0415639_004022_883_1710 275
55 3300042582 Ga0466657_039117 Ga0466657_039117_339_1166 275
56 3300042649 Ga0466724_16812 Ga0466724_16812_125149_126033 275
57 3300042649 Ga0466724_42462 Ga0466724_42462_195157_196014 275
58 iso_pr_bacteria 2506210010 2506291131 275
59 iso_pr_bacteria 2506210015 2506302677 275
60 iso_pr_bacteria 2788500057 2789390649 275
61 iso_pr_bacteria 2791354884 2791841760 275
62 iso_pr_bacteria 2791354885 2791843762 275
63 iso_pr_bacteria 2871564055 2871564662 275
64 iso_pr_bacteria 2871595141 2871596344 275
65 iso_pr_bacteria 2874203443 2874204046 275
66 iso_pr_bacteria 2874209778 2874210475 275
67 3300007188 Ga0103264_1000007 Ga0103264_100000748 276
68 3300042590 Ga0466690_142660 Ga0466690_142660_27229_28059 276
69 3300042613 Ga0466710_107916 Ga0466710_107916_155_985 276
70 iso_pr_bacteria 2617270844 2617733010 276
71 3300007142 Ga0102737_1011525 Ga0102737_10115252 277
72 3300007188 Ga0103264_1052991 Ga0103264_10529912 277
73 3300012809 Ga0160466_100023 Ga0160466_100023148 277
74 3300012829 Ga0160467_100860 Ga0160467_10086015 277
75 3300012848 Ga0160443_101424 Ga0160443_1014243 277
76 3300042605 Ga0466716_133844 Ga0466716_133844_6766_7599 277
77 iso_pr_bacteria 2562617066 2562864892 277
78 iso_pr_bacteria 2648501628 2650560079 277
79 iso_pr_bacteria 2832201259 2832201862 277
80 iso_pr_bacteria 2838140227 2838143084 277
81 iso_pr_bacteria 2873562573 2873564726 277
82 3300002931 CVPL010W_10005276 CVPL010W_100052764 278
83 3300007042 Ga0103263_100729 Ga0103263_1007291 278
84 3300007052 Ga0102736_1000023 Ga0102736_100002374 278
85 3300007052 Ga0102736_1000549 Ga0102736_10005492 278
86 3300007068 Ga0103265_1000407 Ga0103265_10004076 278
87 3300007080 Ga0102735_1001153 Ga0102735_10011535 278
88 3300007083 Ga0103261_1000035 Ga0103261_10000354 278
89 3300007083 Ga0103261_1000371 Ga0103261_10003712 278
90 3300007095 Ga0102739_1000022 Ga0102739_10000224 278
91 3300007129 Ga0102734_1027581 Ga0102734_10275812 278
92 3300007139 Ga0103260_1000299 Ga0103260_10002995 278
93 3300007139 Ga0103260_1000923 Ga0103260_10009235 278
94 3300007141 Ga0102738_1002354 Ga0102738_10023543 278
95 3300007141 Ga0102738_1014067 Ga0102738_10140671 278
96 3300007141 Ga0102738_1014710 Ga0102738_10147102 278
97 3300007142 Ga0102737_1000180 Ga0102737_100018032 278
98 3300007142 Ga0102737_1000483 Ga0102737_10004839 278
99 3300007192 Ga0103268_1019627 Ga0103268_10196272 278
100 3300012829 Ga0160467_100001 Ga0160467_1000011272 278
101 3300012841 Ga0160444_100896 Ga0160444_1008967 278
102 3300012846 Ga0160433_100314 Ga0160433_1003143 278
103 3300012847 Ga0160445_100005 Ga0160445_100005114 278
104 3300012850 Ga0160434_102083 Ga0160434_1020832 278
105 3300012857 Ga0160435_1000532 Ga0160435_100053215 278
106 3300012858 Ga0160457_1000027 Ga0160457_100002783 278
107 3300012858 Ga0160457_1000042 Ga0160457_1000042126 278
108 3300012861 Ga0160436_1000133 Ga0160436_100013327 278
109 3300012861 Ga0160436_1000644 Ga0160436_10006442 278
110 3300042593 Ga0466691_082553 Ga0466691_082553_34025_34861 278
111 3300042616 Ga0466715_357484 Ga0466715_357484_24463_25299 278
112 3300042623 Ga0466734_127123 Ga0466734_127123_4268_5104 278
113 iso_pr_bacteria 2820103659 2820104533 278
114 3300002931 CVPL010W_10006262 CVPL010W_1000626213 279
115 3300009784 Ga0123357_10000248 Ga0123357_1000024850 279
116 3300042611 Ga0466697_121726 Ga0466697_121726_3640_4479 279
117 3300042654 Ga0466725_102756 Ga0466725_102756_1245_2084 279
118 iso_pr_bacteria 2772190782 2772999620 279
119 iso_pr_bacteria 2806310685 2807226895 279
120 iso_pr_bacteria 3002773460 3002774184 279
121 3300007141 Ga0102738_1000012 Ga0102738_10000125 280
122 3300009826 Ga0123355_10403242 Ga0123355_104032422 280
123 3300042612 Ga0466705_070465 Ga0466705_070465_13405_14247 280
124 3300042612 Ga0466705_111194 Ga0466705_111194_2930_3772 280
125 3300042643 Ga0466704_273906 Ga0466704_273906_3255_4097 280
126 3300042648 Ga0466709_080644 Ga0466709_080644_120_962 280
127 3300042649 Ga0466724_02620 Ga0466724_02620_2282_3124 280
128 iso_pr_bacteria 2820161938 2820163683 280
129 iso_pr_bacteria 2820164216 2820164557 280
130 iso_pr_bacteria 2834230000 2834230460 280
131 3300007042 Ga0103263_100312 Ga0103263_1003128 281
132 3300007067 Ga0103266_1000311 Ga0103266_10003118 281
133 3300007140 Ga0102740_1000129 Ga0102740_100012918 281
134 3300009826 Ga0123355_10204899 Ga0123355_102048992 281
135 3300010049 Ga0123356_10099337 Ga0123356_100993372 281
136 3300042598 Ga0466701_016197 Ga0466701_016197_32030_32875 281
137 3300042598 Ga0466701_021249 Ga0466701_021249_4168_5013 281
138 3300042613 Ga0466710_072988 Ga0466710_072988_1832_2677 281
139 3300042613 Ga0466710_076766 Ga0466710_076766_11264_12109 281
140 3300042654 Ga0466725_241563 Ga0466725_241563_3156_4001 281
141 iso_pr_bacteria 2820157249 2820158263 281
142 3300009826 Ga0123355_10061357 Ga0123355_100613572 282
143 3300042609 Ga0466722_247357 Ga0466722_247357_209311_210159 282
144 3300042636 Ga0466703_290279 Ga0466703_290279_6832_7680 282
145 iso_pr_bacteria 2820056190 2820057402 282
146 iso_pr_bacteria 2820080004 2820080039 282
147 iso_pr_bacteria 637000113 638060136 282
148 3300002504 JGI24705J35276_12236565 JGI24705J35276_122365658 283
149 3300007188 Ga0103264_1000748 Ga0103264_100074811 283
150 3300010167 Ga0123353_10415405 Ga0123353_104154053 283
151 3300012815 Ga0160440_100002 Ga0160440_1000021087 283
152 3300042582 Ga0466657_050740 Ga0466657_050740_485_1336 283
153 3300042582 Ga0466657_306800 Ga0466657_306800_1442_2293 283
154 3300042598 Ga0466701_044683 Ga0466701_044683_5641_6492 283
155 3300042611 Ga0466697_025137 Ga0466697_025137_1434_2285 283
156 3300042611 Ga0466697_045293 Ga0466697_045293_1006_1857 283
157 3300042611 Ga0466697_093277 Ga0466697_093277_1173_2024 283
158 3300042654 Ga0466725_009848 Ga0466725_009848_991_1842 283
159 3300042654 Ga0466725_317547 Ga0466725_317547_10003_10854 283
160 iso_pr_bacteria 2864808494 2864809701 283
161 iso_pr_bacteria 2864812326 2864813171 283
162 iso_pr_bacteria 2864859030 2864863095 283
163 iso_pr_bacteria 2864914039 2864918116 283
164 iso_pr_bacteria 2864988360 2864992141 283
165 3300038395 Ga0415639_278816 Ga0415639_278816_972_1826 284
166 3300042592 Ga0466693_189608 Ga0466693_189608_140_994 284
167 3300042593 Ga0466691_127293 Ga0466691_127293_10102_10956 284
168 3300042598 Ga0466701_077653 Ga0466701_077653_20384_21238 284
169 3300042617 Ga0466718_010427 Ga0466718_010427_2119_2973 284
170 3300042623 Ga0466734_102458 Ga0466734_102458_766_1620 284
171 3300042625 Ga0466730_006458 Ga0466730_006458_1330_2184 284
172 3300042659 Ga0466733_029354 Ga0466733_029354_819_1673 284
173 iso_pr_bacteria 2597489944 2598057885 284
174 iso_pr_bacteria 2864755708 2864759459 284
175 iso_pr_bacteria 3003869270 3003870485 284
176 iso_pr_bacteria 3003878002 3003879414 284
177 iso_pr_bacteria 8023724303 8023729879 284
178 iso_pr_bacteria 8023747282 8023750129 284
179 iso_pr_bacteria 8023752828 8023754763 284
180 iso_pr_bacteria 8023757577 8023763153 284
181 iso_pr_bacteria 8023764196 8023770773 284
182 iso_pr_bacteria 8024001094 8024002876 284
183 iso_pr_bacteria 8024014383 8024016049 284
184 iso_pr_bacteria 8024019580 8024020712 284
185 iso_pr_bacteria 8024025509 8024026523 284
186 iso_pr_bacteria 8024037630 8024039454 284
187 iso_pr_bacteria 8024044713 8024046478 284
188 iso_pr_bacteria 8025650824 8025652652 284
189 iso_pr_bacteria 8025658853 8025660955 284
190 iso_pr_bacteria 8025666332 8025668026 284
191 iso_pr_bacteria 8025671076 8025672876 284
192 iso_pr_bacteria 8025678175 8025683023 284
193 iso_pr_bacteria 8025685901 8025688175 284
194 iso_pr_bacteria 8025694439 8025696439 284
195 iso_pr_bacteria 8025701579 8025704929 284
196 iso_pr_bacteria 8025708040 8025709893 284
197 iso_pr_bacteria 8025716094 8025718204 284
198 iso_pr_bacteria 8025723035 8025724698 284
199 iso_pr_bacteria 8025728939 8025729966 284
200 iso_pr_bacteria 8025735396 8025737238 284
201 iso_pr_bacteria 8025740903 8025742625 284
202 iso_pr_bacteria 8025747911 8025749785 284
203 iso_pr_bacteria 8025756023 8025757897 284
204 iso_pr_bacteria 8069748016 8069750137 284
205 iso_pr_bacteria 8069755105 8069756979 284
206 iso_pr_bacteria 8069763219 8069764941 284
207 iso_pr_bacteria 8069770227 8069773074 284
208 iso_pr_bacteria 8069775773 8069777708 284
209 iso_pr_bacteria 8078130113 8078131921 284
210 iso_pr_bacteria 8101951471 8101953282 284
211 iso_pr_bacteria 8101960468 8101962275 284
212 iso_pr_bacteria 8101967387 8101969195 284
213 iso_pr_bacteria 8101974301 8101976101 284
214 iso_pr_bacteria 8101981714 8101983527 284
215 iso_pr_bacteria 8101988189 8101990084 284
216 iso_pr_bacteria 8101994502 8101996536 284
217 iso_pr_bacteria 8102001125 8102002789 284
218 iso_pr_bacteria 8102007614 8102009379 284
219 iso_pr_bacteria 8102014801 8102016585 284
220 iso_pr_bacteria 8102020860 8102022974 284
221 iso_pr_bacteria 8102026984 8102028889 284
222 iso_pr_bacteria 8102033761 8102035928 284
223 iso_pr_bacteria 8102041249 8102043021 284
224 iso_pr_bacteria 8102047609 8102049512 284
225 iso_pr_bacteria 8102054868 8102056609 284
226 iso_pr_bacteria 8102060671 8102062623 284
227 iso_pr_bacteria 8102067727 8102069547 284
228 iso_pr_bacteria 8102074813 8102076694 284
229 iso_pr_bacteria 8102081745 8102083599 284
230 iso_pr_bacteria 8102087471 8102089268 284
231 iso_pr_bacteria 8102094248 8102096333 284
232 iso_pr_bacteria 8102102351 8102104120 284
233 iso_pr_bacteria 8102109360 8102111184 284
234 iso_pr_bacteria 8102117041 8102118784 284
235 iso_pr_bacteria 8102124461 8102126404 284
236 iso_pr_bacteria 8102131453 8102135932 284
237 iso_pr_bacteria 8102138357 8102140167 284
238 iso_pr_bacteria 8102145433 8102151009 284
239 iso_pr_bacteria 8102152052 8102158629 284
240 iso_pr_bacteria 8102161003 8102166687 284
241 iso_pr_bacteria 8102169119 8102170961 284
242 iso_pr_bacteria 8102174626 8102175653 284
243 iso_pr_bacteria 8102181083 8102182746 284
244 iso_pr_bacteria 8102186987 8102189096 284
245 iso_pr_bacteria 8102193924 8102195776 284
246 iso_pr_bacteria 8102201977 8102205327 284
247 iso_pr_bacteria 8102208438 8102210266 284
248 iso_pr_bacteria 8102216467 8102218467 284
249 iso_pr_bacteria 8102223607 8102225407 284
250 iso_pr_bacteria 8102230706 8102232980 284
251 iso_pr_bacteria 8102239244 8102244090 284
252 iso_pr_bacteria 8102246966 8102248660 284
253 iso_pr_bacteria 8102251710 8102253812 284
254 iso_pr_bacteria 8102264549 8102266445 284
255 iso_pr_bacteria 8102271933 8102273906 284
256 iso_pr_bacteria 8102279326 8102281158 284
257 iso_pr_bacteria 8102286609 8102288589 284
258 iso_pr_bacteria 8102312426 8102314238 284
259 3300010167 Ga0123353_10332162 Ga0123353_103321622 285
260 3300012815 Ga0160440_100119 Ga0160440_10011940 285
261 3300012829 Ga0160467_100464 Ga0160467_10046425 285
262 3300012849 Ga0160447_108412 Ga0160447_1084122 285
263 3300042582 Ga0466657_204968 Ga0466657_204968_1627_2484 285
264 3300042582 Ga0466657_249994 Ga0466657_249994_13105_13962 285
265 3300042591 Ga0466692_016490 Ga0466692_016490_3055_3912 285
266 3300042592 Ga0466693_400643 Ga0466693_400643_2090_2947 285
267 3300042598 Ga0466701_023499 Ga0466701_023499_1380_2237 285
268 3300042598 Ga0466701_031552 Ga0466701_031552_10_867 285
269 3300042598 Ga0466701_096100 Ga0466701_096100_2401_3258 285
270 3300042608 Ga0466721_216144 Ga0466721_216144_2361_3218 285
271 3300042613 Ga0466710_061683 Ga0466710_061683_875_1732 285
272 3300042623 Ga0466734_070958 Ga0466734_070958_3098_3955 285
273 3300042623 Ga0466734_162269 Ga0466734_162269_36_893 285
274 3300042654 Ga0466725_081387 Ga0466725_081387_13267_14124 285
275 3300042654 Ga0466725_116312 Ga0466725_116312_910_1767 285
276 iso_pr_bacteria 2718217749 2718705901 285
277 iso_pr_bacteria 2775506951 2776479120 285
278 iso_pr_bacteria 2820077244 2820078647 285
279 iso_pr_bacteria 2864826666 2864830924 285
280 iso_pr_bacteria 2864870719 2864873533 285
281 iso_pr_bacteria 2864937364 2864940474 285
282 iso_pr_bacteria 2864960361 2864963100 285
283 iso_pr_bacteria 2868169047 2868169318 285
284 iso_pr_bacteria 2873565274 2873568583 285
285 iso_pr_bacteria 8100449422 8100453483 285
286 iso_pr_bacteria 8100455565 8100460442 285
287 iso_pr_bacteria 8100461708 8100463084 285
288 3300000036 IMNBGM34_c000927 IMNBGM34_0009276 286
289 3300007080 Ga0102735_1000064 Ga0102735_10000644 286
290 3300007190 Ga0103267_1000027 Ga0103267_100002743 286
291 3300007192 Ga0103268_1000948 Ga0103268_10009488 286
292 3300009784 Ga0123357_10088391 Ga0123357_100883912 286
293 3300010882 Ga0123354_10000052 Ga0123354_1000005239 286
294 3300012809 Ga0160466_105124 Ga0160466_1051241 286
295 3300012812 Ga0160471_106194 Ga0160471_1061942 286
296 3300012813 Ga0160470_106734 Ga0160470_1067342 286
297 3300012818 Ga0160432_100725 Ga0160432_10072515 286
298 3300012831 Ga0160459_100089 Ga0160459_10008955 286
299 3300012839 Ga0160472_101048 Ga0160472_1010489 286
300 3300012849 Ga0160447_108274 Ga0160447_1082742 286
301 3300012852 Ga0160430_100434 Ga0160430_1004342 286
302 3300012852 Ga0160430_106051 Ga0160430_1060512 286
303 3300012857 Ga0160435_1005927 Ga0160435_10059272 286
304 3300012858 Ga0160457_1000734 Ga0160457_10007348 286
305 3300042595 Ga0466695_105802 Ga0466695_105802_3109_3969 286
306 3300007141 Ga0102738_1000081 Ga0102738_10000812 287
307 3300042623 Ga0466734_098091 Ga0466734_098091_1513_2376 287
308 iso_pr_bacteria 2848339753 2848341208 287
309 3300007733 Ga0105524_100650 Ga0105524_1006507 288
310 3300042606 Ga0466719_232588 Ga0466719_232588_980_1846 288
311 iso_pr_bacteria 2963630348 2963632000 289
312 iso_pr_bacteria 8024031916 8024032909 289
313 3300012812 Ga0160471_100016 Ga0160471_100016301 290
314 3300012813 Ga0160470_103328 Ga0160470_1033283 290
315 3300012839 Ga0160472_100371 Ga0160472_10037137 290
316 3300012845 Ga0160460_103635 Ga0160460_1036352 290
317 3300002509 JGI24699J35502_10928434 JGI24699J35502_109284341 291
318 3300007188 Ga0103264_1000567 Ga0103264_10005675 291
319 3300012839 Ga0160472_105769 Ga0160472_1057692 291
320 3300042623 Ga0466734_078952 Ga0466734_078952_2292_3167 291
321 iso_pr_bacteria 2518285616 2518643303 292
322 3300007139 Ga0103260_1001076 Ga0103260_10010765 297
323 3300007140 Ga0102740_1001868 Ga0102740_10018684 297
324 3300007142 Ga0102737_1000610 Ga0102737_100061011 297
325 3300042625 Ga0466730_078531 Ga0466730_078531_41729_42667 300
326 3300010049 Ga0123356_10080241 Ga0123356_100802412 309

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00793 DAHP_synth_1 DAHP synthetase I family 38 299 0.97

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00793 GO:0009058 biosynthetic process BP

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.87 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.