Protein Family IF02758

Metagenome Isolate
118 Members
38 Samples
110 Scaffolds
397.14 Avg Length

🧬 Representative Sequence

ID
3300010049|Ga0123356_10051012|Ga0123356_100510123
Length
425 aa
Sequence
VRIAILGGGFNPIHLGHLYLADTVLSLGFVDRVVFVPAYRSPLKLAAKGMEKSANDRLLMIAVSIAGNPRLSLDACEINREGTSYTIDTLEDIITRYCPDGKPSLIIGDDLAPEFPKWNKYEKITKLADVIIARRNAKTEIKYPFQNIQITNDVLDISSAMVRERINDGSDWRSLVPEAVCNIIEDRQLYGLTAGCSDKREHSDENPGKCAIIKKENGLPELTHSMQASINEPRNAVILRIEEAVRENTGFQRFLHSRNTAVLAWDLCRHFGLDPDLGYLAGIAHDLAKTIKADILFELVKNDGYGISKLEMSKPSLLHGRASAVLLKEQFNIHNEDVLEAVAFHTGGREGMCQLAKVVYIADKLEVTRDGVDPDMRKMCYKEKNLDSLLFTVLENTISGLQTKKLELSEDTFKLLARMKEKNI*

πŸ“Š Sample Types

Isolate 6.8%
Metagenome 93.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 41.7%
Kalotermitidae 27.8%
Unclassified 22.2%
Rhinotermitidae 5.6%
Termopsidae 2.8%

🌳 Taxonomy

Archaea 0
Bacteria 113
Eukaryota 0
Viruses 0
Unclassified 5

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
2 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
3 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
4 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
5 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
6 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
7 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
8 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
9 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
10 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
11 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
12 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
13 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
14 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
15 2781125695 Treponema sp. Th196P4bin30 Isolate Unclassified
16 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
17 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
18 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
19 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
20 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
21 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
22 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
23 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
24 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
25 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
26 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
27 2781125651 Treponema sp. Co191P3bin8 Isolate Unclassified
28 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
29 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
30 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
31 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
32 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
33 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
34 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
35 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
36 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
37 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
38 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466735_066995 3300042624 Bacteria 3011
2 Ga0466704_286649 3300042643 Bacteria 10797
3 Ga0466712_191349 3300042614 Bacteria 2303
4 Ga0466692_187429 3300042591 Bacteria 5037
5 Ga0466694_268885 3300042594 Bacteria 17270
6 Ga0466699_076644 3300042597 Bacteria 9216
7 Ga0466699_274412 3300042597 Bacteria 7094
8 Ga0466699_314935 3300042597 Bacteria 35477
9 Ga0466699_364451 3300042597 Bacteria 5728
10 Ga0466699_403262 3300042597 Bacteria 3217
11 Ga0123356_10001174 3300010049 Bacteria 28989
12 Ga0123356_10004193 3300010049 Bacteria 14942
13 Ga0123353_10244106 3300010167 Bacteria 2788
14 Ga0466732_078911 3300042656 Bacteria 3173
15 Ga0466720_027935 3300042607 Bacteria 23895
16 Ga0466720_107645 3300042607 Bacteria 4275
17 Ga0466720_220932 3300042607 Bacteria 2542
18 Ga0466698_472965 3300042610 Bacteria 1570
19 Ga0466703_023711 3300042636 Bacteria 21658
20 Ga0466715_436350 3300042616 Bacteria 24104
21 Ga0466723_085936 3300042618 Bacteria 4250
22 Ga0466728_103464 3300042620 Bacteria 27893
23 Ga0466699_001667 3300042597 Bacteria 4556
24 Ga0466699_029977 3300042597 Bacteria 17208
25 Ga0466699_371288 3300042597 Bacteria 3522
26 JGI24698J34947_10029995 3300002449 Unclassified 2870
27 JGI24695J34938_10000523 3300002450 Bacteria 37385
28 JGI24695J34938_10007527 3300002450 Bacteria 6359
29 Ga0072941_1054854 3300005201 Bacteria 5030
30 Ga0072941_1255798 3300005201 Bacteria 2411
31 Ga0466732_011324 3300042656 Bacteria 3888
32 Ga0466704_434890 3300042643 Bacteria 41687
33 Ga0466712_013410 3300042614 Bacteria 3609
34 Ga0466712_065835 3300042614 Bacteria 6561
35 Ga0415639_191874 3300038395 Bacteria 1824
36 Ga0466692_086230 3300042591 Bacteria 7172
37 Ga0466691_032823 3300042593 Bacteria 18574
38 Ga0466694_044047 3300042594 Bacteria 4569
39 Ga0466699_055698 3300042597 Bacteria 7941
40 Ga0466699_123446 3300042597 Bacteria 8666
41 Ga0123356_10000673 3300010049 Bacteria 37817
42 Ga0123356_10004344 3300010049 Bacteria 14657
43 Ga0123353_10085671 3300010167 Bacteria 5074
44 JGI24698J34947_10005898 3300002449 Bacteria 6714
45 JGI24698J34947_10008849 3300002449 Bacteria 5526
46 JGI24695J34938_10000637 3300002450 Bacteria 33482
47 JGI24695J34938_10037169 3300002450 Bacteria 2215
48 Ga0466705_127843 3300042612 Bacteria 14569
49 Ga0466720_026260 3300042607 Bacteria 25590
50 Ga0466712_116315 3300042614 Bacteria 1578
51 Ga0466712_127955 3300042614 Bacteria 54818
52 Ga0466718_078288 3300042617 Bacteria 22152
53 Ga0466692_170504 3300042591 Bacteria 1791
54 Ga0466691_118331 3300042593 Bacteria 63226
55 Ga0466694_043622 3300042594 Bacteria 5303
56 Ga0466694_349415 3300042594 Bacteria 3934
57 Ga0123356_10002837 3300010049 Bacteria 18343
58 Ga0123353_10015338 3300010167 Bacteria 11124
59 JGI24695J34938_10013679 3300002450 Unclassified 4249
60 Ga0466715_150692 3300042616 Bacteria 17974
61 Ga0466728_034112 3300042620 Bacteria 27725
62 Ga0264413_102585 3300024493 Bacteria 4948
63 Ga0466692_078847 3300042591 Bacteria 7398
64 Ga0466694_028560 3300042594 Bacteria 27113
65 Ga0466695_290770 3300042595 Bacteria 97007
66 Ga0123356_10009820 3300010049 Bacteria 9428
67 Ga0123356_10051012 3300010049 Bacteria 3849
68 JGI24695J34938_10009583 3300002450 Bacteria 5374
69 Ga0072941_1075112 3300005201 Bacteria 4838
70 Ga0466722_138095 3300042609 Bacteria 43949
71 Ga0466718_023428 3300042617 Bacteria 58531
72 Ga0264413_115759 3300024493 Bacteria 6730
73 Ga0415639_149539 3300038395 Bacteria 3047
74 Ga0466692_153769 3300042591 Bacteria 29297
75 Ga0466699_068034 3300042597 Bacteria 3614
76 Ga0466699_101922 3300042597 Bacteria 1715
77 Ga0466699_227303 3300042597 Bacteria 3983
78 Ga0466699_261512 3300042597 Bacteria 3477
79 JGI24698J34947_10006517 3300002449 Bacteria 6406
80 JGI24695J34938_10002280 3300002450 Bacteria 14811
81 JGI24695J34938_10012952 3300002450 Bacteria 4396
82 Ga0072941_1000702 3300005201 Bacteria 30804
83 Ga0072941_1016935 3300005201 Bacteria 5280
84 Ga0466698_328841 3300042610 Bacteria 2559
85 Ga0466703_160467 3300042636 Bacteria 5341
86 Ga0466712_002114 3300042614 Bacteria 9969
87 Ga0466712_137759 3300042614 Bacteria 3643
88 Ga0466712_144144 3300042614 Bacteria 19900
89 Ga0466723_022580 3300042618 Bacteria 17889
90 Ga0466690_036722 3300042590 Bacteria 5105
91 Ga0466694_078502 3300042594 Bacteria 33638
92 Ga0466699_146529 3300042597 Bacteria 18494
93 Ga0123356_10011162 3300010049 Unclassified 8771
94 JGI24698J34947_10010696 3300002449 Bacteria 5036
95 Ga0074263_112446 3300005485 Bacteria 2387
96 Ga0466722_063479 3300042609 Bacteria 17581
97 Ga0466722_190971 3300042609 Bacteria 12252
98 Ga0466703_292399 3300042636 Bacteria 55753
99 Ga0466709_321768 3300042648 Bacteria 2600
100 Ga0466712_079852 3300042614 Bacteria 15334
101 Ga0466718_065755 3300042617 Unclassified 14643
102 Ga0264413_103002 3300024493 Bacteria 5070
103 Ga0466690_118746 3300042590 Bacteria 29260
104 Ga0466691_190345 3300042593 Bacteria 4089
105 Ga0466696_119168 3300042596 Bacteria 73376
106 Ga0466699_067065 3300042597 Bacteria 1467
107 Ga0466699_255510 3300042597 Bacteria 8120
108 JGI24698J34947_10006644 3300002449 Bacteria 6351
109 JGI24698J34947_10057263 3300002449 Bacteria 1934
110 JGI24702J35022_10012820 3300002462 Unclassified 4651

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042597 Ga0466699_101922 Ga0466699_101922_10_1038 342
2 3300042594 Ga0466694_044047 Ga0466694_044047_13_1053 346
3 3300042597 Ga0466699_067065 Ga0466699_067065_77_1297 360
4 3300042594 Ga0466694_349415 Ga0466694_349415_391_1557 367
5 3300042597 Ga0466699_227303 Ga0466699_227303_1252_2457 369
6 3300042609 Ga0466722_063479 Ga0466722_063479_14927_16174 373
7 3300042617 Ga0466718_078288 Ga0466718_078288_14198_15325 375
8 3300010167 Ga0123353_10085671 Ga0123353_100856712 377
9 3300042607 Ga0466720_220932 Ga0466720_220932_1372_2505 377
10 3300042636 Ga0466703_023711 Ga0466703_023711_9610_10743 377
11 3300042643 Ga0466704_286649 Ga0466704_286649_7098_8321 380
12 3300002449 JGI24698J34947_10005898 JGI24698J34947_100058987 381
13 3300042618 Ga0466723_085936 Ga0466723_085936_2021_3202 381
14 3300042591 Ga0466692_170504 Ga0466692_170504_441_1664 382
15 3300042597 Ga0466699_371288 Ga0466699_371288_770_1969 382
16 3300042597 Ga0466699_403262 Ga0466699_403262_1680_2903 383
17 3300042643 Ga0466704_434890 Ga0466704_434890_2118_3272 384
18 3300002450 JGI24695J34938_10009583 JGI24695J34938_100095833 385
19 3300042591 Ga0466692_187429 Ga0466692_187429_3705_4898 385
20 3300042614 Ga0466712_116315 Ga0466712_116315_15_1172 385
21 3300002449 JGI24698J34947_10006517 JGI24698J34947_100065175 388
22 3300042594 Ga0466694_078502 Ga0466694_078502_1819_2991 390
23 3300042614 Ga0466712_127955 Ga0466712_127955_19102_20274 390
24 3300042617 Ga0466718_065755 Ga0466718_065755_4449_5621 390
25 3300042597 Ga0466699_055698 Ga0466699_055698_5598_6773 391
26 3300042597 Ga0466699_076644 Ga0466699_076644_3216_4391 391
27 3300042597 Ga0466699_123446 Ga0466699_123446_5074_6249 391
28 3300042597 Ga0466699_364451 Ga0466699_364451_2941_4116 391
29 3300042597 Ga0466699_029977 Ga0466699_029977_2942_4159 392
30 3300042597 Ga0466699_255510 Ga0466699_255510_6114_7292 392
31 3300042597 Ga0466699_314935 Ga0466699_314935_28760_29938 392
32 3300042610 Ga0466698_328841 Ga0466698_328841_182_1423 392
33 3300010167 Ga0123353_10244106 Ga0123353_102441063 393
34 3300042591 Ga0466692_078847 Ga0466692_078847_5789_6973 394
35 3300042609 Ga0466722_138095 Ga0466722_138095_28064_29248 394
36 3300042612 Ga0466705_127843 Ga0466705_127843_6647_7831 394
37 3300042617 Ga0466718_023428 Ga0466718_023428_27180_28364 394
38 3300042656 Ga0466732_078911 Ga0466732_078911_628_1812 394
39 3300038395 Ga0415639_149539 Ga0415639_149539_1021_2208 395
40 3300042594 Ga0466694_043622 Ga0466694_043622_693_1880 395
41 3300042594 Ga0466694_268885 Ga0466694_268885_14610_15797 395
42 3300042595 Ga0466695_290770 Ga0466695_290770_50537_51724 395
43 3300042616 Ga0466715_150692 Ga0466715_150692_15720_16907 395
44 3300042636 Ga0466703_292399 Ga0466703_292399_51547_52734 395
45 3300042591 Ga0466692_153769 Ga0466692_153769_16052_17242 396
46 3300042614 Ga0466712_065835 Ga0466712_065835_2203_3393 396
47 iso_pr_bacteria 2781125659 2781327325 396
48 3300002449 JGI24698J34947_10010696 JGI24698J34947_100106965 397
49 3300002450 JGI24695J34938_10012952 JGI24695J34938_100129524 397
50 3300010049 Ga0123356_10002837 Ga0123356_100028372 397
51 3300010049 Ga0123356_10011162 Ga0123356_100111622 397
52 3300002450 JGI24695J34938_10037169 JGI24695J34938_100371692 398
53 3300010049 Ga0123356_10001174 Ga0123356_1000117418 398
54 3300024493 Ga0264413_102585 Ga0264413_1025852 398
55 3300024493 Ga0264413_115759 Ga0264413_1157598 398
56 3300042594 Ga0466694_028560 Ga0466694_028560_20936_22132 398
57 3300002450 JGI24695J34938_10002280 JGI24695J34938_1000228017 399
58 3300042593 Ga0466691_032823 Ga0466691_032823_7163_8362 399
59 3300042590 Ga0466690_036722 Ga0466690_036722_1105_2307 400
60 3300042597 Ga0466699_274412 Ga0466699_274412_2939_4141 400
61 3300042616 Ga0466715_436350 Ga0466715_436350_16414_17616 400
62 3300042618 Ga0466723_022580 Ga0466723_022580_15075_16277 400
63 3300042620 Ga0466728_034112 Ga0466728_034112_3271_4473 400
64 iso_pr_bacteria 2781125650 2781308488 400
65 3300002450 JGI24695J34938_10000523 JGI24695J34938_100005236 401
66 3300042597 Ga0466699_001667 Ga0466699_001667_163_1368 401
67 3300042597 Ga0466699_068034 Ga0466699_068034_2309_3514 401
68 3300042597 Ga0466699_146529 Ga0466699_146529_3510_4715 401
69 3300042607 Ga0466720_026260 Ga0466720_026260_22949_24154 401
70 3300042607 Ga0466720_107645 Ga0466720_107645_2945_4150 401
71 3300042609 Ga0466722_190971 Ga0466722_190971_8440_9645 401
72 3300005201 Ga0072941_1016935 Ga0072941_10169356 402
73 3300042597 Ga0466699_261512 Ga0466699_261512_659_1942 402
74 3300042610 Ga0466698_472965 Ga0466698_472965_178_1386 402
75 3300042614 Ga0466712_002114 Ga0466712_002114_3373_4581 402
76 3300042614 Ga0466712_144144 Ga0466712_144144_4771_5979 402
77 3300042614 Ga0466712_191349 Ga0466712_191349_158_1366 402
78 3300002449 JGI24698J34947_10029995 JGI24698J34947_100299953 403
79 3300002449 JGI24698J34947_10057263 JGI24698J34947_100572632 403
80 3300002450 JGI24695J34938_10007527 JGI24695J34938_100075278 403
81 3300010049 Ga0123356_10000673 Ga0123356_1000067319 403
82 3300010049 Ga0123356_10004193 Ga0123356_100041939 403
83 3300042593 Ga0466691_190345 Ga0466691_190345_391_1602 403
84 iso_pr_bacteria 2781125651 2781310512 403
85 3300002450 JGI24695J34938_10013679 JGI24695J34938_100136794 404
86 3300042614 Ga0466712_013410 Ga0466712_013410_536_1750 404
87 3300002449 JGI24698J34947_10006644 JGI24698J34947_100066443 405
88 3300042636 Ga0466703_160467 Ga0466703_160467_70_1287 405
89 iso_pr_bacteria 2781125663 2781338134 405
90 3300005201 Ga0072941_1000702 Ga0072941_100070220 406
91 3300005201 Ga0072941_1054854 Ga0072941_10548542 406
92 3300005201 Ga0072941_1075112 Ga0072941_10751125 406
93 3300010049 Ga0123356_10004344 Ga0123356_100043448 406
94 3300038395 Ga0415639_191874 Ga0415639_191874_370_1590 406
95 3300002449 JGI24698J34947_10008849 JGI24698J34947_100088493 407
96 3300010049 Ga0123356_10009820 Ga0123356_100098202 407
97 3300010167 Ga0123353_10015338 Ga0123353_100153386 407
98 3300042591 Ga0466692_086230 Ga0466692_086230_3570_4793 407
99 3300042620 Ga0466728_103464 Ga0466728_103464_1843_3066 407
100 3300042648 Ga0466709_321768 Ga0466709_321768_677_1900 407
101 iso_pr_bacteria 2781125693 2781434490 407
102 3300042596 Ga0466696_119168 Ga0466696_119168_49128_50396 408
103 3300042624 Ga0466735_066995 Ga0466735_066995_1238_2467 409
104 3300042614 Ga0466712_079852 Ga0466712_079852_1667_2899 410
105 3300002462 JGI24702J35022_10012820 JGI24702J35022_100128202 411
106 3300042590 Ga0466690_118746 Ga0466690_118746_12955_14190 411
107 3300042656 Ga0466732_011324 Ga0466732_011324_1150_2433 411
108 3300005485 Ga0074263_112446 Ga0074263_1124462 412
109 3300042607 Ga0466720_027935 Ga0466720_027935_2502_3740 412
110 3300024493 Ga0264413_103002 Ga0264413_1030024 414
111 iso_pr_bacteria 2781125635 2781276763 415
112 iso_pr_bacteria 2781125645 2781299174 415
113 3300002450 JGI24695J34938_10000637 JGI24695J34938_1000063726 416
114 3300042614 Ga0466712_137759 Ga0466712_137759_1080_2330 416
115 iso_pr_bacteria 2781125695 2781438956 417
116 3300005201 Ga0072941_1255798 Ga0072941_12557982 419
117 3300042593 Ga0466691_118331 Ga0466691_118331_5379_6647 422
118 3300010049 Ga0123356_10051012 Ga0123356_100510123 425

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01467 CTP_transf_like Cytidylyltransferase-like 5 165 0.94
PF01966 HD HD domain 253 366 0.89

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.88 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.