Protein Family IF02743
Metagenome
Metatranscriptome
Isolate
184
Members
63
Samples
178
Scaffolds
182.43
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_10037294|Ga0123356_100372942
- Length
- 205 aa
- Sequence
- LEKRVFSSIFAKKSKIKSFNQSHYSSPMELPVGTRIDHPKYGEGVISRNTQLAYKVIFIRGGEIEFIKSNFDAEVLEENDDMPVKEPRLNVRELEKMLKHVLDKYNGLEHRVELGSKWEGGTLTMKPGKEGLQAKEIPIETFFHKIVMVRDRLRVLEQNINSHKVLSDEDKINLQQYITRVYGSLTTFNVLFSEKEDYFTGSKA*
Sample Types
Isolate
3.3%
Metagenome
96.2%
MAG
0.0%
Metatranscriptome
0.5%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
47.5%
Kalotermitidae
23.0%
Unclassified
14.8%
Termopsidae
4.9%
Rhinotermitidae
3.3%
Passalidae
3.3%
Hodotermitidae
1.6%
Culicidae
1.6%
Taxonomy
Archaea
1
Bacteria
169
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 13 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 14 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 15 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 16 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 17 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 18 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 19 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 20 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 21 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 22 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 23 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 24 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 25 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 26 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 27 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 28 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 29 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 30 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 31 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 32 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 33 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 34 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 35 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 36 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 37 | 2820786992 | Unclassified Bacteroidetes Emb289P1bin66 | Isolate | Unclassified |
| 38 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 39 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 40 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 41 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 42 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 43 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 44 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 45 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 46 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 47 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 48 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 49 | 2820737921 | Unclassified Bacteroidetes Th196P4bin18 | Isolate | Unclassified |
| 50 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 51 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 52 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 53 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 54 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
| 55 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 56 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 57 | 2820736622 | Unclassified Bacteroidetes Th196P4bin26 | Isolate | Unclassified |
| 58 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 59 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 60 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 61 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 62 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 63 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_182648 | 3300042611 | Bacteria | 1425 |
| 2 | Ga0466733_012746 | 3300042659 | Bacteria | 6069 |
| 3 | Ga0466693_390153 | 3300042592 | Unclassified | 1521 |
| 4 | Ga0466695_112736 | 3300042595 | Bacteria | 1130 |
| 5 | Ga0466695_289405 | 3300042595 | Bacteria | 5949 |
| 6 | Ga0466696_107652 | 3300042596 | Bacteria | 2690 |
| 7 | Ga0466696_435689 | 3300042596 | Bacteria | 2453 |
| 8 | Ga0466700_275278 | 3300042600 | Bacteria | 2890 |
| 9 | Ga0466712_078993 | 3300042614 | Bacteria | 1454 |
| 10 | Ga0466715_247946 | 3300042616 | Unclassified | 1218 |
| 11 | Ga0466715_477561 | 3300042616 | Bacteria | 36126 |
| 12 | Ga0466723_077918 | 3300042618 | Bacteria | 13441 |
| 13 | Ga0466723_179975 | 3300042618 | Bacteria | 21814 |
| 14 | Ga0466729_011708 | 3300042621 | Bacteria | 3397 |
| 15 | Ga0123356_10037294 | 3300010049 | Bacteria | 4536 |
| 16 | Ga0123356_10800328 | 3300010049 | Bacteria | 1114 |
| 17 | Ga0123356_11426651 | 3300010049 | Bacteria | 852 |
| 18 | Ga0123353_10425628 | 3300010167 | Bacteria | 1965 |
| 19 | Ga0123353_11503183 | 3300010167 | Bacteria | 858 |
| 20 | Ga0466702_082779 | 3300042635 | Bacteria | 1296 |
| 21 | Ga0466702_445842 | 3300042635 | Bacteria | 1522 |
| 22 | Ga0466703_101060 | 3300042636 | Bacteria | 3734 |
| 23 | 2227091655 | 2225789004 | Bacteria | 1832 |
| 24 | IMNBL1DRAFT_c0003672 | 3300000062 | Bacteria | 9676 |
| 25 | JGI24702J35022_10020715 | 3300002462 | Bacteria | 3567 |
| 26 | JGI24702J35022_10028240 | 3300002462 | Bacteria | 3016 |
| 27 | JGI24696J40584_12694445 | 3300002834 | Bacteria | 732 |
| 28 | Ga0068305_10892863 | 3300005083 | Bacteria | 1945 |
| 29 | Ga0466697_225534 | 3300042611 | Bacteria | 2078 |
| 30 | Ga0466656_304250 | 3300042550 | Bacteria | 4745 |
| 31 | Ga0466693_019815 | 3300042592 | Bacteria | 2357 |
| 32 | Ga0466693_344862 | 3300042592 | Bacteria | 1191 |
| 33 | Ga0466694_318570 | 3300042594 | Bacteria | 1157 |
| 34 | Ga0466696_167826 | 3300042596 | Bacteria | 25872 |
| 35 | Ga0466719_132037 | 3300042606 | Bacteria | 8118 |
| 36 | Ga0466710_317446 | 3300042613 | Bacteria | 1542 |
| 37 | Ga0466711_235923 | 3300042615 | Bacteria | 4956 |
| 38 | Ga0466723_069574 | 3300042618 | Bacteria | 6551 |
| 39 | Ga0123353_10360679 | 3300010167 | Bacteria | 2184 |
| 40 | Ga0123353_10489452 | 3300010167 | Bacteria | 1796 |
| 41 | Ga0123354_10161217 | 3300010882 | Bacteria | 2661 |
| 42 | Ga0466727_285656 | 3300042655 | Bacteria | 6160 |
| 43 | JGI24702J35022_10000052 | 3300002462 | Bacteria | 49045 |
| 44 | JGI24705J35276_11917535 | 3300002504 | Unclassified | 765 |
| 45 | JGI24696J40584_12709237 | 3300002834 | Unclassified | 746 |
| 46 | JGI24696J40584_12959776 | 3300002834 | Bacteria | 5621 |
| 47 | Ga0466705_278658 | 3300042612 | Bacteria | 1283 |
| 48 | Ga0466732_277015 | 3300042656 | Bacteria | 1637 |
| 49 | Ga0466690_347468 | 3300042590 | Bacteria | 4189 |
| 50 | Ga0466696_155559 | 3300042596 | Bacteria | 1569 |
| 51 | Ga0466696_301915 | 3300042596 | Unclassified | 2189 |
| 52 | Ga0466699_141425 | 3300042597 | Bacteria | 1066 |
| 53 | Ga0466706_169827 | 3300042599 | Bacteria | 1129 |
| 54 | Ga0466698_078236 | 3300042610 | Bacteria | 1146 |
| 55 | Ga0466710_316084 | 3300042613 | Bacteria | 1652 |
| 56 | Ga0466711_190990 | 3300042615 | Bacteria | 24298 |
| 57 | Ga0466711_335669 | 3300042615 | Bacteria | 37569 |
| 58 | Ga0466715_009739 | 3300042616 | Bacteria | 69251 |
| 59 | Ga0466728_007578 | 3300042620 | Bacteria | 2508 |
| 60 | Ga0466728_468155 | 3300042620 | Bacteria | 1508 |
| 61 | Ga0123355_10481776 | 3300009826 | Bacteria | 1543 |
| 62 | Ga0123356_11289674 | 3300010049 | Bacteria | 894 |
| 63 | Ga0123356_12238034 | 3300010049 | Bacteria | 683 |
| 64 | Ga0123353_10272693 | 3300010167 | Unclassified | 2605 |
| 65 | Ga0466709_260379 | 3300042648 | Bacteria | 1728 |
| 66 | IMNBL1DRAFT_c0007879 | 3300000062 | Bacteria | 5517 |
| 67 | JGI24702J35022_10002248 | 3300002462 | Bacteria | 11866 |
| 68 | JGI24702J35022_10208014 | 3300002462 | Unclassified | 1122 |
| 69 | JGI24705J35276_12231578 | 3300002504 | Bacteria | 3987 |
| 70 | Ga0466705_178231 | 3300042612 | Bacteria | 47995 |
| 71 | Ga0466732_006487 | 3300042656 | Bacteria | 4225 |
| 72 | Ga0466732_273953 | 3300042656 | Bacteria | 1961 |
| 73 | Ga0255786_1021573 | 3300022815 | Bacteria | 1166 |
| 74 | Ga0466656_338826 | 3300042550 | Bacteria | 3045 |
| 75 | Ga0466696_207603 | 3300042596 | Bacteria | 8687 |
| 76 | Ga0466701_045106 | 3300042598 | Bacteria | 1079 |
| 77 | Ga0466716_017246 | 3300042605 | Bacteria | 3723 |
| 78 | Ga0466716_295761 | 3300042605 | Bacteria | 10101 |
| 79 | Ga0466711_150539 | 3300042615 | Bacteria | 27789 |
| 80 | Ga0466728_080811 | 3300042620 | Bacteria | 17781 |
| 81 | Ga0466728_448813 | 3300042620 | Bacteria | 5858 |
| 82 | Ga0123356_10313642 | 3300010049 | Bacteria | 1678 |
| 83 | Ga0123356_11048384 | 3300010049 | Bacteria | 985 |
| 84 | Ga0123353_10329539 | 3300010167 | Bacteria | 2312 |
| 85 | Ga0123353_10775428 | 3300010167 | Unclassified | 1329 |
| 86 | Ga0123354_10129525 | 3300010882 | Bacteria | 3196 |
| 87 | Ga0466734_110183 | 3300042623 | Bacteria | 1815 |
| 88 | Ga0466735_072352 | 3300042624 | Bacteria | 1169 |
| 89 | Ga0466735_213617 | 3300042624 | Bacteria | 1101 |
| 90 | Ga0466703_022106 | 3300042636 | Bacteria | 4426 |
| 91 | Ga0466704_023062 | 3300042643 | Bacteria | 1234 |
| 92 | Ga0466708_176752 | 3300042652 | Bacteria | 26441 |
| 93 | JGI24702J35022_10366445 | 3300002462 | Bacteria | 864 |
| 94 | Ga0072941_1160853 | 3300005201 | Bacteria | 5230 |
| 95 | Ga0466697_182351 | 3300042611 | Bacteria | 8295 |
| 96 | Ga0466696_005413 | 3300042596 | Bacteria | 7145 |
| 97 | Ga0466696_398015 | 3300042596 | Unclassified | 1121 |
| 98 | Ga0466701_086009 | 3300042598 | Bacteria | 1340 |
| 99 | Ga0466707_307280 | 3300042601 | Unclassified | 3410 |
| 100 | Ga0466713_034961 | 3300042602 | Bacteria | 28922 |
| 101 | Ga0466722_249719 | 3300042609 | Bacteria | 1783 |
| 102 | Ga0466710_005051 | 3300042613 | Bacteria | 2194 |
| 103 | Ga0466710_108813 | 3300042613 | Unclassified | 3567 |
| 104 | Ga0123355_10050510 | 3300009826 | Bacteria | 6755 |
| 105 | Ga0123356_10170523 | 3300010049 | Bacteria | 2186 |
| 106 | Ga0123356_10794004 | 3300010049 | Bacteria | 1118 |
| 107 | Ga0123353_10804508 | 3300010167 | Bacteria | 1297 |
| 108 | Ga0123354_10409824 | 3300010882 | Unclassified | 1138 |
| 109 | Ga0466734_052015 | 3300042623 | Bacteria | 2156 |
| 110 | Ga0466703_252157 | 3300042636 | Bacteria | 5129 |
| 111 | Ga0466704_555533 | 3300042643 | Bacteria | 1943 |
| 112 | Ga0466709_123085 | 3300042648 | Bacteria | 10890 |
| 113 | Ga0466708_330610 | 3300042652 | Bacteria | 11894 |
| 114 | Ga0466725_078708 | 3300042654 | Bacteria | 2300 |
| 115 | IMNBL1DRAFT_c0012043 | 3300000062 | Bacteria | 3985 |
| 116 | JGI24702J35022_10000890 | 3300002462 | Bacteria | 18538 |
| 117 | JGI24696J40584_12942583 | 3300002834 | Bacteria | 1745 |
| 118 | Ga0105524_103918 | 3300007733 | Bacteria | 1966 |
| 119 | Ga0466697_162522 | 3300042611 | Bacteria | 1802 |
| 120 | Ga0466694_292093 | 3300042594 | Bacteria | 3116 |
| 121 | Ga0466699_167486 | 3300042597 | Bacteria | 2141 |
| 122 | Ga0466700_103876 | 3300042600 | Bacteria | 3235 |
| 123 | Ga0466700_492309 | 3300042600 | Bacteria | 1696 |
| 124 | Ga0466714_107454 | 3300042603 | Bacteria | 2297 |
| 125 | Ga0466717_287584 | 3300042604 | Bacteria | 2196 |
| 126 | Ga0466722_028185 | 3300042609 | Bacteria | 38347 |
| 127 | Ga0466722_107470 | 3300042609 | Bacteria | 1031 |
| 128 | Ga0466722_203269 | 3300042609 | Bacteria | 1082 |
| 129 | Ga0466726_244062 | 3300042619 | Archaea | 5219 |
| 130 | Ga0123355_10000003 | 3300009826 | Bacteria | 224088 |
| 131 | Ga0123356_12759296 | 3300010049 | Bacteria | 615 |
| 132 | Ga0123353_10000433 | 3300010167 | Bacteria | 51855 |
| 133 | Ga0123353_11029176 | 3300010167 | Bacteria | 1103 |
| 134 | Ga0123353_11688774 | 3300010167 | Unclassified | 794 |
| 135 | Ga0466731_334875 | 3300042622 | Bacteria | 1224 |
| 136 | Ga0466727_247343 | 3300042655 | Bacteria | 10852 |
| 137 | JGI24695J34938_10266966 | 3300002450 | Bacteria | 731 |
| 138 | JGI24702J35022_10007109 | 3300002462 | Bacteria | 6433 |
| 139 | JGI24702J35022_10213338 | 3300002462 | Bacteria | 1109 |
| 140 | Ga0466705_088250 | 3300042612 | Bacteria | 15152 |
| 141 | Ga0160460_100002 | 3300012845 | Bacteria | 833437 |
| 142 | Ga0466657_008238 | 3300042582 | Bacteria | 2647 |
| 143 | Ga0466690_036055 | 3300042590 | Bacteria | 9031 |
| 144 | Ga0466690_223746 | 3300042590 | Bacteria | 3148 |
| 145 | Ga0466693_295769 | 3300042592 | Bacteria | 1262 |
| 146 | Ga0466716_159342 | 3300042605 | Bacteria | 3024 |
| 147 | Ga0466719_245768 | 3300042606 | Bacteria | 1498 |
| 148 | Ga0466719_259708 | 3300042606 | Bacteria | 13010 |
| 149 | Ga0466723_085607 | 3300042618 | Bacteria | 23658 |
| 150 | Ga0123355_10002918 | 3300009826 | Bacteria | 24295 |
| 151 | Ga0123356_10173107 | 3300010049 | Bacteria | 2172 |
| 152 | Ga0123356_11356893 | 3300010049 | Bacteria | 873 |
| 153 | Ga0123353_11412428 | 3300010167 | Bacteria | 894 |
| 154 | Ga0123354_10351417 | 3300010882 | Bacteria | 1313 |
| 155 | Ga0466704_586174 | 3300042643 | Bacteria | 25035 |
| 156 | Ga0466709_047405 | 3300042648 | Bacteria | 4892 |
| 157 | JGI24696J40584_12958387 | 3300002834 | Bacteria | 4095 |
| 158 | Ga0466705_164121 | 3300042612 | Bacteria | 25201 |
| 159 | Ga0466732_116173 | 3300042656 | Bacteria | 1444 |
| 160 | Ga0466733_066373 | 3300042659 | Bacteria | 26399 |
| 161 | Ga0466691_120491 | 3300042593 | Bacteria | 9658 |
| 162 | Ga0466691_120716 | 3300042593 | Bacteria | 76920 |
| 163 | Ga0466694_164645 | 3300042594 | Bacteria | 1350 |
| 164 | Ga0466714_133845 | 3300042603 | Bacteria | 1111 |
| 165 | Ga0466697_054819 | 3300042611 | Bacteria | 3425 |
| 166 | Ga0466710_265955 | 3300042613 | Bacteria | 2548 |
| 167 | Ga0466715_219957 | 3300042616 | Bacteria | 1277 |
| 168 | Ga0466726_144061 | 3300042619 | Bacteria | 6317 |
| 169 | Ga0123356_10207576 | 3300010049 | Bacteria | 2004 |
| 170 | Ga0123356_11487403 | 3300010049 | Bacteria | 835 |
| 171 | Ga0123354_10040142 | 3300010882 | Bacteria | 7245 |
| 172 | Ga0123354_10268654 | 3300010882 | Bacteria | 1684 |
| 173 | Ga0466731_042453 | 3300042622 | Bacteria | 1573 |
| 174 | Ga0466734_001602 | 3300042623 | Bacteria | 1561 |
| 175 | Ga0466735_142848 | 3300042624 | Bacteria | 5114 |
| 176 | Ga0466709_029442 | 3300042648 | Bacteria | 27734 |
| 177 | Ga0466708_413340 | 3300042652 | Bacteria | 4708 |
| 178 | JGI24696J40584_12834400 | 3300002834 | Unclassified | 938 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042601 | Ga0466707_307280 | Ga0466707_307280_2598_3038 | 146 |
| 2 | 3300042598 | Ga0466701_045106 | Ga0466701_045106_19_465 | 148 |
| 3 | 3300010049 | Ga0123356_12238034 | Ga0123356_122380341 | 170 |
| 4 | 3300010049 | Ga0123356_12759296 | Ga0123356_127592961 | 171 |
| 5 | 3300042611 | Ga0466697_182648 | Ga0466697_182648_881_1396 | 171 |
| 6 | 3300042635 | Ga0466702_445842 | Ga0466702_445842_580_1113 | 177 |
| 7 | 3300002462 | JGI24702J35022_10213338 | JGI24702J35022_102133382 | 178 |
| 8 | 3300007733 | Ga0105524_103918 | Ga0105524_1039181 | 178 |
| 9 | 3300010049 | Ga0123356_10170523 | Ga0123356_101705233 | 178 |
| 10 | 3300010049 | Ga0123356_10173107 | Ga0123356_101731072 | 178 |
| 11 | 3300042603 | Ga0466714_133845 | Ga0466714_133845_66_602 | 178 |
| 12 | 3300042622 | Ga0466731_042453 | Ga0466731_042453_359_895 | 178 |
| 13 | 3300010049 | Ga0123356_11487403 | Ga0123356_114874031 | 179 |
| 14 | 3300010167 | Ga0123353_10804508 | Ga0123353_108045082 | 179 |
| 15 | 3300042592 | Ga0466693_344862 | Ga0466693_344862_202_741 | 179 |
| 16 | 3300042596 | Ga0466696_155559 | Ga0466696_155559_702_1241 | 179 |
| 17 | 3300042600 | Ga0466700_103876 | Ga0466700_103876_2097_2636 | 179 |
| 18 | 3300042604 | Ga0466717_287584 | Ga0466717_287584_1145_1684 | 179 |
| 19 | 3300042611 | Ga0466697_054819 | Ga0466697_054819_2552_3091 | 179 |
| 20 | 3300042611 | Ga0466697_225534 | Ga0466697_225534_184_723 | 179 |
| 21 | 3300042613 | Ga0466710_265955 | Ga0466710_265955_910_1449 | 179 |
| 22 | 3300042613 | Ga0466710_317446 | Ga0466710_317446_99_638 | 179 |
| 23 | 3300042615 | Ga0466711_335669 | Ga0466711_335669_36770_37309 | 179 |
| 24 | 3300042621 | Ga0466729_011708 | Ga0466729_011708_251_790 | 179 |
| 25 | 3300042648 | Ga0466709_123085 | Ga0466709_123085_9331_9870 | 179 |
| 26 | 3300042654 | Ga0466725_078708 | Ga0466725_078708_171_710 | 179 |
| 27 | 3300042656 | Ga0466732_006487 | Ga0466732_006487_2086_2625 | 179 |
| 28 | 3300042659 | Ga0466733_066373 | Ga0466733_066373_22076_22615 | 179 |
| 29 | 3300002462 | JGI24702J35022_10000052 | JGI24702J35022_1000005220 | 180 |
| 30 | 3300002462 | JGI24702J35022_10007109 | JGI24702J35022_100071095 | 180 |
| 31 | 3300002462 | JGI24702J35022_10020715 | JGI24702J35022_100207155 | 180 |
| 32 | 3300002504 | JGI24705J35276_11917535 | JGI24705J35276_119175352 | 180 |
| 33 | 3300002504 | JGI24705J35276_12231578 | JGI24705J35276_122315783 | 180 |
| 34 | 3300002834 | JGI24696J40584_12694445 | JGI24696J40584_126944451 | 180 |
| 35 | 3300002834 | JGI24696J40584_12942583 | JGI24696J40584_129425832 | 180 |
| 36 | 3300010049 | Ga0123356_10207576 | Ga0123356_102075762 | 180 |
| 37 | 3300010049 | Ga0123356_11048384 | Ga0123356_110483841 | 180 |
| 38 | 3300010049 | Ga0123356_11289674 | Ga0123356_112896742 | 180 |
| 39 | 3300010049 | Ga0123356_11426651 | Ga0123356_114266512 | 180 |
| 40 | 3300010167 | Ga0123353_10329539 | Ga0123353_103295392 | 180 |
| 41 | 3300010167 | Ga0123353_10360679 | Ga0123353_103606791 | 180 |
| 42 | 3300010167 | Ga0123353_11029176 | Ga0123353_110291762 | 180 |
| 43 | 3300010167 | Ga0123353_11412428 | Ga0123353_114124281 | 180 |
| 44 | 3300010167 | Ga0123353_11503183 | Ga0123353_115031832 | 180 |
| 45 | 3300010882 | Ga0123354_10129525 | Ga0123354_101295252 | 180 |
| 46 | 3300010882 | Ga0123354_10161217 | Ga0123354_101612172 | 180 |
| 47 | 3300010882 | Ga0123354_10268654 | Ga0123354_102686542 | 180 |
| 48 | 3300042590 | Ga0466690_036055 | Ga0466690_036055_1525_2067 | 180 |
| 49 | 3300042593 | Ga0466691_120716 | Ga0466691_120716_36736_37278 | 180 |
| 50 | 3300042613 | Ga0466710_108813 | Ga0466710_108813_164_706 | 180 |
| 51 | 3300042616 | Ga0466715_477561 | Ga0466715_477561_16876_17418 | 180 |
| 52 | 3300042618 | Ga0466723_077918 | Ga0466723_077918_5517_6059 | 180 |
| 53 | 3300042619 | Ga0466726_144061 | Ga0466726_144061_5739_6281 | 180 |
| 54 | 3300042620 | Ga0466728_468155 | Ga0466728_468155_831_1373 | 180 |
| 55 | 3300042655 | Ga0466727_247343 | Ga0466727_247343_8814_9356 | 180 |
| 56 | 3300042656 | Ga0466732_116173 | Ga0466732_116173_62_604 | 180 |
| 57 | 2225789004 | 2227091655 | 2227470887 | 181 |
| 58 | 3300005201 | Ga0072941_1160853 | Ga0072941_11608532 | 181 |
| 59 | 3300042582 | Ga0466657_008238 | Ga0466657_008238_224_769 | 181 |
| 60 | 3300042595 | Ga0466695_112736 | Ga0466695_112736_332_877 | 181 |
| 61 | 3300042595 | Ga0466695_289405 | Ga0466695_289405_4806_5351 | 181 |
| 62 | 3300042597 | Ga0466699_167486 | Ga0466699_167486_340_885 | 181 |
| 63 | 3300042598 | Ga0466701_086009 | Ga0466701_086009_33_578 | 181 |
| 64 | 3300042600 | Ga0466700_275278 | Ga0466700_275278_385_930 | 181 |
| 65 | 3300042606 | Ga0466719_259708 | Ga0466719_259708_8426_8971 | 181 |
| 66 | 3300042609 | Ga0466722_107470 | Ga0466722_107470_358_903 | 181 |
| 67 | 3300042609 | Ga0466722_249719 | Ga0466722_249719_930_1475 | 181 |
| 68 | 3300042610 | Ga0466698_078236 | Ga0466698_078236_433_978 | 181 |
| 69 | 3300042613 | Ga0466710_005051 | Ga0466710_005051_1245_1790 | 181 |
| 70 | 3300042616 | Ga0466715_009739 | Ga0466715_009739_44490_45035 | 181 |
| 71 | 3300042623 | Ga0466734_052015 | Ga0466734_052015_1301_1846 | 181 |
| 72 | 3300042655 | Ga0466727_285656 | Ga0466727_285656_170_715 | 181 |
| 73 | 3300042656 | Ga0466732_273953 | Ga0466732_273953_1372_1917 | 181 |
| 74 | iso_pr_bacteria | 2820744581 | 2820744918 | 181 |
| 75 | iso_pr_bacteria | 2820770630 | 2820771810 | 181 |
| 76 | 3300000062 | IMNBL1DRAFT_c0003672 | IMNBL1DRAFT_00036723 | 182 |
| 77 | 3300002462 | JGI24702J35022_10028240 | JGI24702J35022_100282405 | 182 |
| 78 | 3300002462 | JGI24702J35022_10208014 | JGI24702J35022_102080142 | 182 |
| 79 | 3300002462 | JGI24702J35022_10366445 | JGI24702J35022_103664451 | 182 |
| 80 | 3300002834 | JGI24696J40584_12709237 | JGI24696J40584_127092371 | 182 |
| 81 | 3300005083 | Ga0068305_10892863 | Ga0068305_108928632 | 182 |
| 82 | 3300010049 | Ga0123356_10313642 | Ga0123356_103136422 | 182 |
| 83 | 3300010049 | Ga0123356_10794004 | Ga0123356_107940042 | 182 |
| 84 | 3300010167 | Ga0123353_10000433 | Ga0123353_1000043315 | 182 |
| 85 | 3300010167 | Ga0123353_10425628 | Ga0123353_104256282 | 182 |
| 86 | 3300010167 | Ga0123353_10775428 | Ga0123353_107754281 | 182 |
| 87 | 3300010882 | Ga0123354_10351417 | Ga0123354_103514172 | 182 |
| 88 | 3300012845 | Ga0160460_100002 | Ga0160460_10000278 | 182 |
| 89 | 3300042550 | Ga0466656_304250 | Ga0466656_304250_2376_2924 | 182 |
| 90 | 3300042592 | Ga0466693_295769 | Ga0466693_295769_140_688 | 182 |
| 91 | 3300042596 | Ga0466696_207603 | Ga0466696_207603_3922_4470 | 182 |
| 92 | 3300042611 | Ga0466697_182351 | Ga0466697_182351_6012_6560 | 182 |
| 93 | 3300042612 | Ga0466705_164121 | Ga0466705_164121_3928_4476 | 182 |
| 94 | 3300042613 | Ga0466710_316084 | Ga0466710_316084_500_1048 | 182 |
| 95 | 3300042618 | Ga0466723_069574 | Ga0466723_069574_5617_6165 | 182 |
| 96 | 3300042622 | Ga0466731_334875 | Ga0466731_334875_230_778 | 182 |
| 97 | 3300042623 | Ga0466734_110183 | Ga0466734_110183_144_692 | 182 |
| 98 | 3300042624 | Ga0466735_213617 | Ga0466735_213617_189_737 | 182 |
| 99 | 3300042636 | Ga0466703_252157 | Ga0466703_252157_2587_3135 | 182 |
| 100 | 3300042643 | Ga0466704_023062 | Ga0466704_023062_234_782 | 182 |
| 101 | 3300042643 | Ga0466704_586174 | Ga0466704_586174_18188_18736 | 182 |
| 102 | 3300042656 | Ga0466732_277015 | Ga0466732_277015_673_1221 | 182 |
| 103 | iso_pr_bacteria | 2820737921 | 2820738353 | 182 |
| 104 | iso_pr_bacteria | 2820786992 | 2820787422 | 182 |
| 105 | iso_pr_bacteria | 2820788205 | 2820789533 | 182 |
| 106 | 3300002462 | JGI24702J35022_10002248 | JGI24702J35022_100022483 | 183 |
| 107 | 3300009826 | Ga0123355_10000003 | Ga0123355_10000003203 | 183 |
| 108 | 3300010167 | Ga0123353_10272693 | Ga0123353_102726932 | 183 |
| 109 | 3300010167 | Ga0123353_10489452 | Ga0123353_104894522 | 183 |
| 110 | 3300010167 | Ga0123353_11688774 | Ga0123353_116887741 | 183 |
| 111 | 3300010882 | Ga0123354_10409824 | Ga0123354_104098242 | 183 |
| 112 | 3300042550 | Ga0466656_338826 | Ga0466656_338826_805_1356 | 183 |
| 113 | 3300042590 | Ga0466690_347468 | Ga0466690_347468_468_1019 | 183 |
| 114 | 3300042592 | Ga0466693_390153 | Ga0466693_390153_787_1338 | 183 |
| 115 | 3300042596 | Ga0466696_005413 | Ga0466696_005413_3257_3808 | 183 |
| 116 | 3300042596 | Ga0466696_107652 | Ga0466696_107652_1495_2046 | 183 |
| 117 | 3300042597 | Ga0466699_141425 | Ga0466699_141425_377_928 | 183 |
| 118 | 3300042602 | Ga0466713_034961 | Ga0466713_034961_28066_28617 | 183 |
| 119 | 3300042603 | Ga0466714_107454 | Ga0466714_107454_488_1039 | 183 |
| 120 | 3300042605 | Ga0466716_017246 | Ga0466716_017246_3156_3707 | 183 |
| 121 | 3300042614 | Ga0466712_078993 | Ga0466712_078993_213_764 | 183 |
| 122 | 3300042615 | Ga0466711_150539 | Ga0466711_150539_21400_21951 | 183 |
| 123 | 3300042616 | Ga0466715_219957 | Ga0466715_219957_369_920 | 183 |
| 124 | 3300042618 | Ga0466723_085607 | Ga0466723_085607_15089_15640 | 183 |
| 125 | 3300042618 | Ga0466723_179975 | Ga0466723_179975_3214_3765 | 183 |
| 126 | 3300042620 | Ga0466728_448813 | Ga0466728_448813_1812_2363 | 183 |
| 127 | 3300042623 | Ga0466734_001602 | Ga0466734_001602_865_1416 | 183 |
| 128 | 3300042624 | Ga0466735_142848 | Ga0466735_142848_3247_3798 | 183 |
| 129 | 3300042635 | Ga0466702_082779 | Ga0466702_082779_316_867 | 183 |
| 130 | 3300042636 | Ga0466703_101060 | Ga0466703_101060_2374_2925 | 183 |
| 131 | 3300042648 | Ga0466709_029442 | Ga0466709_029442_24303_24854 | 183 |
| 132 | 3300042648 | Ga0466709_047405 | Ga0466709_047405_32_583 | 183 |
| 133 | 3300042652 | Ga0466708_330610 | Ga0466708_330610_10340_10891 | 183 |
| 134 | 3300042652 | Ga0466708_413340 | Ga0466708_413340_3226_3777 | 183 |
| 135 | iso_pr_bacteria | 2820736622 | 2820736974 | 183 |
| 136 | 3300000062 | IMNBL1DRAFT_c0007879 | IMNBL1DRAFT_00078794 | 184 |
| 137 | 3300000062 | IMNBL1DRAFT_c0012043 | IMNBL1DRAFT_00120435 | 184 |
| 138 | 3300002450 | JGI24695J34938_10266966 | JGI24695J34938_102669661 | 184 |
| 139 | 3300002462 | JGI24702J35022_10000890 | JGI24702J35022_100008906 | 184 |
| 140 | 3300002834 | JGI24696J40584_12958387 | JGI24696J40584_129583875 | 184 |
| 141 | 3300002834 | JGI24696J40584_12959776 | JGI24696J40584_129597767 | 184 |
| 142 | 3300010049 | Ga0123356_10800328 | Ga0123356_108003282 | 184 |
| 143 | 3300010882 | Ga0123354_10040142 | Ga0123354_100401422 | 184 |
| 144 | 3300022815 | Ga0255786_1021573 | Ga0255786_10215732 | 184 |
| 145 | 3300042592 | Ga0466693_019815 | Ga0466693_019815_325_879 | 184 |
| 146 | 3300042593 | Ga0466691_120491 | Ga0466691_120491_5711_6265 | 184 |
| 147 | 3300042594 | Ga0466694_318570 | Ga0466694_318570_263_817 | 184 |
| 148 | 3300042596 | Ga0466696_167826 | Ga0466696_167826_8421_8975 | 184 |
| 149 | 3300042596 | Ga0466696_398015 | Ga0466696_398015_389_943 | 184 |
| 150 | 3300042600 | Ga0466700_492309 | Ga0466700_492309_267_821 | 184 |
| 151 | 3300042606 | Ga0466719_132037 | Ga0466719_132037_5917_6471 | 184 |
| 152 | 3300042606 | Ga0466719_245768 | Ga0466719_245768_579_1133 | 184 |
| 153 | 3300042616 | Ga0466715_247946 | Ga0466715_247946_400_954 | 184 |
| 154 | 3300042619 | Ga0466726_244062 | Ga0466726_244062_3932_4486 | 184 |
| 155 | 3300042620 | Ga0466728_007578 | Ga0466728_007578_1438_1992 | 184 |
| 156 | 3300002834 | JGI24696J40584_12834400 | JGI24696J40584_128344002 | 185 |
| 157 | 3300042590 | Ga0466690_223746 | Ga0466690_223746_1911_2468 | 185 |
| 158 | 3300042599 | Ga0466706_169827 | Ga0466706_169827_411_968 | 185 |
| 159 | 3300042609 | Ga0466722_203269 | Ga0466722_203269_442_999 | 185 |
| 160 | 3300042612 | Ga0466705_088250 | Ga0466705_088250_10025_10582 | 185 |
| 161 | 3300042612 | Ga0466705_278658 | Ga0466705_278658_646_1203 | 185 |
| 162 | 3300042615 | Ga0466711_190990 | Ga0466711_190990_16933_17490 | 185 |
| 163 | 3300042615 | Ga0466711_235923 | Ga0466711_235923_995_1552 | 185 |
| 164 | 3300042620 | Ga0466728_080811 | Ga0466728_080811_12303_12860 | 185 |
| 165 | 3300042624 | Ga0466735_072352 | Ga0466735_072352_501_1058 | 185 |
| 166 | 3300042596 | Ga0466696_301915 | Ga0466696_301915_808_1368 | 186 |
| 167 | 3300042596 | Ga0466696_435689 | Ga0466696_435689_215_775 | 186 |
| 168 | 3300042605 | Ga0466716_159342 | Ga0466716_159342_2085_2645 | 186 |
| 169 | 3300042643 | Ga0466704_555533 | Ga0466704_555533_503_1066 | 187 |
| 170 | 3300042611 | Ga0466697_162522 | Ga0466697_162522_13_579 | 188 |
| 171 | 3300042648 | Ga0466709_260379 | Ga0466709_260379_547_1113 | 188 |
| 172 | 3300042612 | Ga0466705_178231 | Ga0466705_178231_17871_18440 | 189 |
| 173 | 3300042594 | Ga0466694_292093 | Ga0466694_292093_2421_2993 | 190 |
| 174 | 3300042609 | Ga0466722_028185 | Ga0466722_028185_30552_31130 | 192 |
| 175 | 3300042659 | Ga0466733_012746 | Ga0466733_012746_713_1291 | 192 |
| 176 | 3300042605 | Ga0466716_295761 | Ga0466716_295761_6510_7091 | 193 |
| 177 | 3300042594 | Ga0466694_164645 | Ga0466694_164645_220_804 | 194 |
| 178 | 3300042652 | Ga0466708_176752 | Ga0466708_176752_20610_21194 | 194 |
| 179 | 3300042636 | Ga0466703_022106 | Ga0466703_022106_618_1214 | 198 |
| 180 | 3300009826 | Ga0123355_10002918 | Ga0123355_100029186 | 203 |
| 181 | 3300010049 | Ga0123356_11356893 | Ga0123356_113568932 | 203 |
| 182 | 3300009826 | Ga0123355_10481776 | Ga0123355_104817762 | 205 |
| 183 | 3300010049 | Ga0123356_10037294 | Ga0123356_100372942 | 205 |
| 184 | 3300009826 | Ga0123355_10050510 | Ga0123355_100505102 | 214 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.49 | 0.64 | Medium |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.