Protein Family IF02711

Metagenome Metatranscriptome Isolate
210 Members
91 Samples
191 Scaffolds
182.55 Avg Length

🧬 Representative Sequence

ID
3300010049|Ga0123356_10019186|Ga0123356_100191867
Length
197 aa
Sequence
LLYKLIGGKAMSRIGKLPITLPKGVEITRDEKSQIVTVKGAKGELKQYVDGDITFTIEDGKLTLLRPTEQKRHKAMHGLYRALLANMIKGVSEGFEIKQELVGVGYKAEAKPGNQLEMSLGYSHNLIFELCPEVTVETINEKGKNPLIILRGIDKQLMGQVANKIRSYRKPEPYKGKGIRFQGEIVRKKAGKSAEK*

📊 Sample Types

Isolate 9.1%
Metagenome 89.5%
MAG 0.0%
Metatranscriptome 1.4%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 35.6%
Unclassified 19.5%
Kalotermitidae 14.9%
Formicidae 5.7%
Armadillidiidae 4.6%
Culicidae 4.6%
Rhinotermitidae 3.4%
Termopsidae 2.3%
Passalidae 2.3%
Elmidae 1.1%
Drosophilidae 1.1%
Hodotermitidae 1.1%
Blattidae 1.1%
Hydrophilidae 1.1%
Daphniidae 1.1%

🌳 Taxonomy

Archaea 0
Bacteria 191
Eukaryota 0
Viruses 0
Unclassified 19

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820783511 Unclassified Bacteroidetes Emb289P3bin108 Isolate Unclassified
2 2820788205 Unclassified Bacteroidetes Emb289P1bin57 Isolate Unclassified
3 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
4 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
5 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
6 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
7 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
8 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
9 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
10 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
11 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
12 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
13 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
14 2820795054 Unclassified Bacteroidetes Cu122P1bin21 Isolate Unclassified
15 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
16 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
17 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
18 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
19 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
20 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
21 3300021245 Termite gut microbial communities from nest from French Guiana - 11-4 mRNA SA Metatranscriptome Termitidae
22 2820755292 Unclassified Bacteroidetes Nc150P3bin3 Isolate Unclassified
23 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
24 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
25 2820797595 Unclassified Bacteroidetes Co191P3bin3 Isolate Unclassified
26 2864968865 Paucibacter oligotrophus S00239 Isolate Elmidae
27 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
28 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
29 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
30 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
31 2820753519 Unclassified Bacteroidetes Nc150P4bin20 Isolate Unclassified
32 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
33 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
34 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
35 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
36 2820770630 Unclassified Bacteroidetes Lab288P3bin130 Isolate Unclassified
37 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
38 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
39 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
40 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
41 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
42 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
43 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
44 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
45 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
46 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
47 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
48 2820746860 Unclassified Bacteroidetes Th196P3bin126 Isolate Unclassified
49 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
50 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
51 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
52 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
53 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
54 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
55 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
56 2585428141 Pilibacter termitis ATCC BAA-1030 Isolate Rhinotermitidae
57 2820785563 Unclassified Bacteroidetes Emb289P1bin74 Isolate Unclassified
58 2820792843 Unclassified Bacteroidetes Cu122P3bin1 Isolate Unclassified
59 2940393498 Paenibacillus sp. PastF-2 Isolate Blattidae
60 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
61 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
62 2989309576 Sporomusa termitida DSM 4440 Isolate Unclassified
63 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
64 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
65 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
66 2820092068 Unclassified Proteobacteria Lab288P3bin38 Isolate Unclassified
67 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
68 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
69 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
70 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
71 3300022232 Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA Metatranscriptome Termitidae
72 2820619171 Unclassified Firmicutes Emb289P1bin130 Isolate Unclassified
73 2820735654 Unclassified Bacteroidetes Th196P4bin9 Isolate Unclassified
74 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
75 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
76 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
77 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
78 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
79 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
80 2873776654 Pedobacter sp. HDW13 Isolate Hydrophilidae
81 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
82 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
83 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
84 2590828803 Pedobacter glucosidilyticus DD6b Isolate Daphniidae
85 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
86 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
87 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
88 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
89 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
90 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
91 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_009863 3300042656 Bacteria 1494
2 Ga0466732_299434 3300042656 Bacteria 1505
3 Ga0123355_10617082 3300009826 Bacteria 1280
4 Ga0123356_10459264 3300010049 Unclassified 1423
5 Ga0123356_10973979 3300010049 Bacteria 1019
6 Ga0123353_10002126 3300010167 Bacteria 24517
7 Ga0466700_003162 3300042600 Bacteria 3539
8 Ga0466700_164676 3300042600 Bacteria 2894
9 Ga0466707_296601 3300042601 Bacteria 7478
10 Ga0466707_354355 3300042601 Bacteria 49155
11 Ga0466713_124336 3300042602 Bacteria 24023
12 Ga0466713_137191 3300042602 Bacteria 44160
13 Ga0466717_243810 3300042604 Unclassified 1133
14 Ga0466717_285335 3300042604 Bacteria 1749
15 Ga0466721_136051 3300042608 Bacteria 1206
16 Ga0466698_418342 3300042610 Bacteria 6626
17 Ga0160469_100154 3300012824 Bacteria 76254
18 Ga0160455_100183 3300012837 Bacteria 61401
19 Ga0466694_111997 3300042594 Bacteria 1610
20 Ga0466694_180398 3300042594 Bacteria 1841
21 IMNBGM34_c017181 3300000036 Bacteria 903
22 IMNBL1DRAFT_c0000311 3300000062 Bacteria 41422
23 Ga0068305_10073887 3300005083 Bacteria 1927
24 Ga0103268_1018774 3300007192 Unclassified 1543
25 Ga0466710_251017 3300042613 Bacteria 2155
26 Ga0466734_015756 3300042623 Bacteria 28187
27 Ga0466724_03072 3300042649 Bacteria 18268
28 Ga0466725_461929 3300042654 Bacteria 22391
29 Ga0466733_120852 3300042659 Bacteria 8712
30 Ga0123355_10023090 3300009826 Bacteria 9981
31 Ga0123356_10102085 3300010049 Bacteria 2753
32 Ga0123356_10221611 3300010049 Bacteria 1948
33 Ga0123356_10594456 3300010049 Bacteria 1271
34 Ga0123356_10830970 3300010049 Bacteria 1095
35 Ga0123356_12010078 3300010049 Bacteria 721
36 Ga0123353_10489666 3300010167 Bacteria 1796
37 Ga0123353_10910240 3300010167 Unclassified 1196
38 Ga0123353_11594421 3300010167 Unclassified 825
39 Ga0123354_10272226 3300010882 Bacteria 1664
40 Ga0466701_030599 3300042598 Bacteria 4831
41 Ga0466701_082560 3300042598 Bacteria 10541
42 Ga0466706_123047 3300042599 Bacteria 432554
43 Ga0466719_401320 3300042606 Bacteria 1479
44 Ga0466719_468537 3300042606 Bacteria 80797
45 Ga0160459_107425 3300012831 Bacteria 1377
46 Ga0466657_203405 3300042582 Bacteria 6735
47 Ga0466692_191187 3300042591 Bacteria 1023
48 Ga0466694_060428 3300042594 Bacteria 2134
49 IMNBL1DRAFT_c0013511 3300000062 Bacteria 3656
50 Ga0466702_388408 3300042635 Bacteria 1709
51 Ga0466697_101971 3300042611 Bacteria 1665
52 Ga0466705_089959 3300042612 Bacteria 3058
53 Ga0123357_10056176 3300009784 Bacteria 5295
54 Ga0123355_10073553 3300009826 Bacteria 5477
55 Ga0123356_10144520 3300010049 Bacteria 2351
56 Ga0123356_11672216 3300010049 Bacteria 789
57 Ga0123353_10056405 3300010167 Bacteria 6287
58 Ga0123353_10406262 3300010167 Bacteria 2024
59 Ga0466701_101169 3300042598 Bacteria 66668
60 Ga0466713_052484 3300042602 Bacteria 51192
61 Ga0160431_100175 3300012828 Bacteria 44721
62 Ga0160472_105816 3300012839 Bacteria 1923
63 Ga0160457_1001220 3300012858 Bacteria 7723
64 Ga0223683_1072936 3300021245 Bacteria 1119
65 Ga0233288_1006034 3300022232 Bacteria 1595
66 Ga0466694_063011 3300042594 Bacteria 7947
67 JGI24695J34938_10009199 3300002450 Unclassified 5516
68 JGI24702J35022_10000489 3300002462 Bacteria 23998
69 Ga0466710_199383 3300042613 Bacteria 1329
70 Ga0466715_378047 3300042616 Bacteria 21549
71 Ga0466723_289451 3300042618 Bacteria 49429
72 Ga0466726_079457 3300042619 Bacteria 4157
73 Ga0466726_109190 3300042619 Bacteria 5348
74 Ga0466728_137843 3300042620 Bacteria 2744
75 Ga0466704_367182 3300042643 Bacteria 14991
76 Ga0466724_17202 3300042649 Bacteria 3672
77 Ga0466725_224042 3300042654 Bacteria 2257
78 Ga0123357_10665868 3300009784 Unclassified 763
79 Ga0123356_10460412 3300010049 Bacteria 1421
80 Ga0123356_11974644 3300010049 Bacteria 727
81 Ga0123353_10138080 3300010167 Bacteria 3908
82 Ga0123354_10308507 3300010882 Bacteria 1483
83 Ga0160464_113521 3300012805 Bacteria 616
84 Ga0466706_122919 3300042599 Bacteria 1762
85 Ga0466707_290813 3300042601 Bacteria 7513
86 Ga0466717_137120 3300042604 Bacteria 2927
87 Ga0466721_390986 3300042608 Bacteria 1091
88 Ga0160468_105537 3300012819 Bacteria 1427
89 Ga0160441_100013 3300012825 Bacteria 353830
90 Ga0160457_1000216 3300012858 Bacteria 43789
91 Ga0466693_428138 3300042592 Bacteria 5450
92 Ga0466694_061306 3300042594 Bacteria 1086
93 Ga0466695_098343 3300042595 Bacteria 1755
94 Ga0466696_412028 3300042596 Bacteria 31787
95 JGI24702J35022_10044638 3300002462 Bacteria 2362
96 Ga0103263_101903 3300007042 Bacteria 2647
97 Ga0102740_1000340 3300007140 Bacteria 13154
98 Ga0105005_1121158 3300007505 Unclassified 2543
99 Ga0466710_128288 3300042613 Unclassified 1534
100 Ga0466729_144169 3300042621 Bacteria 1089
101 Ga0466734_119789 3300042623 Bacteria 17928
102 Ga0466724_47248 3300042649 Bacteria 1146
103 Ga0466725_380667 3300042654 Bacteria 5631
104 Ga0466697_099390 3300042611 Bacteria 1617
105 Ga0466697_223009 3300042611 Bacteria 1699
106 Ga0466733_151623 3300042659 Bacteria 7663
107 Ga0123355_10053144 3300009826 Bacteria 6569
108 Ga0123355_10270893 3300009826 Bacteria 2359
109 Ga0123356_10139456 3300010049 Bacteria 2390
110 Ga0123356_11610380 3300010049 Unclassified 804
111 Ga0123353_10673804 3300010167 Bacteria 1458
112 Ga0123354_10198836 3300010882 Unclassified 2212
113 Ga0123354_10657423 3300010882 Bacteria 746
114 Ga0466700_283432 3300042600 Bacteria 2095
115 Ga0466716_032863 3300042605 Bacteria 2255
116 Ga0160468_100431 3300012819 Bacteria 17464
117 Ga0466657_204285 3300042582 Bacteria 4902
118 Ga0466694_312337 3300042594 Bacteria 5792
119 IMNBGM34_c003625 3300000036 Bacteria 2119
120 IMNBGM34_c004877 3300000036 Bacteria 1797
121 Ga0466710_429042 3300042613 Bacteria 1432
122 Ga0466729_108585 3300042621 Bacteria 3906
123 Ga0466731_016159 3300042622 Bacteria 48336
124 Ga0466731_334150 3300042622 Bacteria 2330
125 Ga0466702_445943 3300042635 Unclassified 1559
126 Ga0466724_66981 3300042649 Bacteria 17748
127 Ga0466705_325997 3300042612 Bacteria 31796
128 Ga0466733_076918 3300042659 Bacteria 4299
129 Ga0466733_179817 3300042659 Bacteria 1581
130 Ga0123356_10019186 3300010049 Bacteria 6486
131 Ga0123356_10036374 3300010049 Bacteria 4598
132 Ga0123353_10113321 3300010167 Bacteria 4365
133 Ga0123353_10404880 3300010167 Unclassified 2029
134 Ga0123353_10448733 3300010167 Unclassified 1900
135 Ga0466706_228754 3300042599 Bacteria 25710
136 Ga0466717_017183 3300042604 Bacteria 2585
137 Ga0466717_104945 3300042604 Bacteria 7422
138 Ga0160470_101175 3300012813 Bacteria 6868
139 Ga0233288_1023764 3300022232 Bacteria 908
140 Ga0466690_208712 3300042590 Bacteria 16914
141 Ga0466691_108606 3300042593 Bacteria 9393
142 AustNasuHG_c1007648 3300000089 Unclassified 3833
143 Ga0102739_1013811 3300007095 Unclassified 1039
144 Ga0466723_019869 3300042618 Bacteria 35706
145 Ga0466723_306212 3300042618 Bacteria 6356
146 Ga0466728_444146 3300042620 Bacteria 1249
147 Ga0466731_248329 3300042622 Bacteria 5724
148 Ga0466735_137752 3300042624 Bacteria 2919
149 Ga0466703_068182 3300042636 Bacteria 42719
150 Ga0466704_201176 3300042643 Bacteria 27945
151 Ga0466708_172769 3300042652 Bacteria 7449
152 Ga0466733_120424 3300042659 Bacteria 2645
153 Ga0123355_10001203 3300009826 Bacteria 36038
154 Ga0123356_10051712 3300010049 Bacteria 3822
155 Ga0123356_11651494 3300010049 Unclassified 794
156 Ga0123353_10673803 3300010167 Bacteria 1458
157 Ga0123354_10433716 3300010882 Bacteria 1080
158 Ga0466701_098401 3300042598 Bacteria 3611
159 Ga0466698_066268 3300042610 Bacteria 6926
160 Ga0160455_100062 3300012837 Bacteria 204480
161 Ga0466692_115746 3300042591 Bacteria 1253
162 Ga0466693_027963 3300042592 Bacteria 4027
163 Ga0466691_081749 3300042593 Bacteria 15757
164 JGI24705J35276_12199368 3300002504 Unclassified 1584
165 Ga0105005_1021830 3300007505 Bacteria 8863
166 Ga0466723_015433 3300042618 Bacteria 8886
167 Ga0466705_221348 3300042612 Unclassified 3919
168 Ga0123355_10008401 3300009826 Bacteria 15608
169 Ga0123353_10026029 3300010167 Bacteria 8926
170 Ga0123353_10244935 3300010167 Bacteria 2782
171 Ga0160465_100054 3300012803 Bacteria 130977
172 Ga0466701_025996 3300042598 Bacteria 29910
173 Ga0466713_056506 3300042602 Bacteria 16973
174 Ga0466713_100023 3300042602 Bacteria 4216
175 Ga0466717_290438 3300042604 Bacteria 1208
176 Ga0466717_309442 3300042604 Bacteria 3604
177 Ga0466698_094276 3300042610 Bacteria 4974
178 Ga0160472_110190 3300012839 Bacteria 1171
179 Ga0160447_100004 3300012849 Bacteria 554359
180 IMNBL1DRAFT_c0013028 3300000062 Bacteria 3760
181 JGI24705J35276_12144886 3300002504 Bacteria 1157
182 JGI24696J40584_12951634 3300002834 Bacteria 2263
183 CVPL010W_10000676 3300002931 Bacteria 64066
184 Ga0105005_1104662 3300007505 Bacteria 2954
185 Ga0466723_309299 3300042618 Bacteria 8426
186 Ga0466729_064368 3300042621 Bacteria 15899
187 Ga0466735_196613 3300042624 Bacteria 7717
188 Ga0466730_053826 3300042625 Bacteria 92011
189 Ga0466709_095111 3300042648 Bacteria 17483
190 Ga0466709_218885 3300042648 Bacteria 3409
191 Ga0466724_28405 3300042649 Bacteria 7792

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042604 Ga0466717_104945 Ga0466717_104945_1892_2443 153
2 3300042608 Ga0466721_390986 Ga0466721_390986_19_498 159
3 3300009784 Ga0123357_10665868 Ga0123357_106658682 160
4 3300010049 Ga0123356_12010078 Ga0123356_120100781 160
5 3300042604 Ga0466717_290438 Ga0466717_290438_679_1161 160
6 3300005083 Ga0068305_10073887 Ga0068305_100738873 161
7 3300007505 Ga0105005_1104662 Ga0105005_11046624 161
8 3300010167 Ga0123353_10138080 Ga0123353_101380806 161
9 3300042620 Ga0466728_444146 Ga0466728_444146_740_1231 163
10 3300042652 Ga0466708_172769 Ga0466708_172769_5475_5972 165
11 3300012819 Ga0160468_100431 Ga0160468_10043120 166
12 3300042619 Ga0466726_079457 Ga0466726_079457_1402_1935 166
13 3300042591 Ga0466692_115746 Ga0466692_115746_13_516 167
14 3300042598 Ga0466701_101169 Ga0466701_101169_19901_20443 167
15 3300009826 Ga0123355_10008401 Ga0123355_100084019 168
16 3300042602 Ga0466713_100023 Ga0466713_100023_3145_3654 169
17 3300042593 Ga0466691_081749 Ga0466691_081749_11063_11605 171
18 3300042620 Ga0466728_137843 Ga0466728_137843_1399_1914 171
19 3300042643 Ga0466704_367182 Ga0466704_367182_6798_7340 171
20 3300012819 Ga0160468_105537 Ga0160468_1055373 172
21 3300012828 Ga0160431_100175 Ga0160431_10017536 172
22 3300012831 Ga0160459_107425 Ga0160459_1074251 172
23 3300012839 Ga0160472_105816 Ga0160472_1058162 172
24 3300042635 Ga0466702_445943 Ga0466702_445943_765_1283 172
25 3300009826 Ga0123355_10023090 Ga0123355_1002309011 173
26 3300002834 JGI24696J40584_12951634 JGI24696J40584_129516342 174
27 3300010167 Ga0123353_10406262 Ga0123353_104062622 175
28 3300010167 Ga0123353_11594421 Ga0123353_115944212 175
29 3300009826 Ga0123355_10001203 Ga0123355_1000120340 176
30 3300042596 Ga0466696_412028 Ga0466696_412028_13251_13808 176
31 3300042592 Ga0466693_027963 Ga0466693_027963_1390_1923 177
32 3300042612 Ga0466705_325997 Ga0466705_325997_7652_8212 177
33 3300042623 Ga0466734_015756 Ga0466734_015756_7789_8322 177
34 3300042649 Ga0466724_03072 Ga0466724_03072_15336_15869 177
35 3300042654 Ga0466725_461929 Ga0466725_461929_7455_7988 177
36 iso_pr_bacteria 2820092068 2820092380 177
37 iso_pr_bacteria 2864968865 2864971856 177
38 3300010049 Ga0123356_11974644 Ga0123356_119746442 178
39 3300010167 Ga0123353_10026029 Ga0123353_1002602910 178
40 3300042618 Ga0466723_015433 Ga0466723_015433_341_877 178
41 3300042618 Ga0466723_019869 Ga0466723_019869_27361_27897 178
42 iso_pr_bacteria 2585428141 2588054823 178
43 3300042618 Ga0466723_306212 Ga0466723_306212_654_1193 179
44 3300042593 Ga0466691_108606 Ga0466691_108606_4140_4682 180
45 3300042606 Ga0466719_401320 Ga0466719_401320_584_1126 180
46 3300042606 Ga0466719_468537 Ga0466719_468537_12812_13354 180
47 3300042618 Ga0466723_289451 Ga0466723_289451_9347_9889 180
48 3300042618 Ga0466723_309299 Ga0466723_309299_3359_3901 180
49 3300042621 Ga0466729_108585 Ga0466729_108585_1885_2427 180
50 3300042636 Ga0466703_068182 Ga0466703_068182_18625_19167 180
51 iso_pr_bacteria 2940393498 2940399031 180
52 3300009826 Ga0123355_10270893 Ga0123355_102708935 181
53 3300042623 Ga0466734_119789 Ga0466734_119789_7937_8482 181
54 iso_pr_bacteria 2820619171 2820619524 181
55 3300000062 IMNBL1DRAFT_c0013511 IMNBL1DRAFT_00135116 182
56 3300009826 Ga0123355_10617082 Ga0123355_106170822 182
57 3300000062 IMNBL1DRAFT_c0000311 IMNBL1DRAFT_000031118 183
58 3300010882 Ga0123354_10308507 Ga0123354_103085072 183
59 iso_pr_bacteria 2989309576 2989309651 183
60 3300022232 Ga0233288_1006034 Ga0233288_10060342 184
61 3300022232 Ga0233288_1023764 Ga0233288_10237642 184
62 3300042595 Ga0466695_098343 Ga0466695_098343_635_1189 184
63 3300042598 Ga0466701_082560 Ga0466701_082560_2787_3341 184
64 3300042599 Ga0466706_123047 Ga0466706_123047_23403_23957 184
65 3300042599 Ga0466706_228754 Ga0466706_228754_11493_12047 184
66 3300042601 Ga0466707_354355 Ga0466707_354355_21607_22161 184
67 3300042602 Ga0466713_052484 Ga0466713_052484_37823_38377 184
68 3300042602 Ga0466713_137191 Ga0466713_137191_7615_8169 184
69 3300042605 Ga0466716_032863 Ga0466716_032863_1377_1931 184
70 3300042621 Ga0466729_144169 Ga0466729_144169_69_623 184
71 3300042625 Ga0466730_053826 Ga0466730_053826_89390_89944 184
72 3300042649 Ga0466724_28405 Ga0466724_28405_6271_6825 184
73 3300000062 IMNBL1DRAFT_c0013028 IMNBL1DRAFT_00130283 185
74 3300002931 CVPL010W_10000676 CVPL010W_1000067629 185
75 3300007042 Ga0103263_101903 Ga0103263_1019033 185
76 3300007095 Ga0102739_1013811 Ga0102739_10138112 185
77 3300007140 Ga0102740_1000340 Ga0102740_10003408 185
78 3300007192 Ga0103268_1018774 Ga0103268_10187742 185
79 3300010049 Ga0123356_10102085 Ga0123356_101020853 185
80 3300010049 Ga0123356_10460412 Ga0123356_104604122 185
81 3300021245 Ga0223683_1072936 Ga0223683_10729362 185
82 3300042582 Ga0466657_203405 Ga0466657_203405_4743_5300 185
83 3300042590 Ga0466690_208712 Ga0466690_208712_7344_7901 185
84 3300042591 Ga0466692_191187 Ga0466692_191187_107_664 185
85 3300042592 Ga0466693_428138 Ga0466693_428138_916_1473 185
86 3300042594 Ga0466694_061306 Ga0466694_061306_366_923 185
87 3300042599 Ga0466706_122919 Ga0466706_122919_506_1063 185
88 3300042600 Ga0466700_003162 Ga0466700_003162_1030_1587 185
89 3300042600 Ga0466700_164676 Ga0466700_164676_2261_2818 185
90 3300042601 Ga0466707_290813 Ga0466707_290813_636_1193 185
91 3300042601 Ga0466707_296601 Ga0466707_296601_5357_5914 185
92 3300042602 Ga0466713_056506 Ga0466713_056506_1970_2527 185
93 3300042602 Ga0466713_124336 Ga0466713_124336_10828_11385 185
94 3300042604 Ga0466717_137120 Ga0466717_137120_1856_2413 185
95 3300042604 Ga0466717_243810 Ga0466717_243810_529_1086 185
96 3300042604 Ga0466717_285335 Ga0466717_285335_1136_1693 185
97 3300042610 Ga0466698_066268 Ga0466698_066268_5771_6328 185
98 3300042610 Ga0466698_094276 Ga0466698_094276_2302_2859 185
99 3300042611 Ga0466697_101971 Ga0466697_101971_784_1341 185
100 3300042612 Ga0466705_089959 Ga0466705_089959_1637_2194 185
101 3300042612 Ga0466705_221348 Ga0466705_221348_1630_2187 185
102 3300042613 Ga0466710_199383 Ga0466710_199383_643_1200 185
103 3300042616 Ga0466715_378047 Ga0466715_378047_4015_4572 185
104 3300042619 Ga0466726_109190 Ga0466726_109190_2694_3251 185
105 3300042621 Ga0466729_064368 Ga0466729_064368_6565_7122 185
106 3300042622 Ga0466731_334150 Ga0466731_334150_609_1166 185
107 3300042624 Ga0466735_137752 Ga0466735_137752_1915_2472 185
108 3300042624 Ga0466735_196613 Ga0466735_196613_640_1197 185
109 3300042635 Ga0466702_388408 Ga0466702_388408_539_1096 185
110 3300042643 Ga0466704_201176 Ga0466704_201176_834_1391 185
111 3300042648 Ga0466709_095111 Ga0466709_095111_1991_2548 185
112 3300042654 Ga0466725_380667 Ga0466725_380667_4583_5140 185
113 3300042656 Ga0466732_299434 Ga0466732_299434_372_929 185
114 3300042659 Ga0466733_076918 Ga0466733_076918_883_1440 185
115 3300042659 Ga0466733_120424 Ga0466733_120424_1486_2043 185
116 3300042659 Ga0466733_120852 Ga0466733_120852_617_1174 185
117 3300042659 Ga0466733_151623 Ga0466733_151623_6920_7477 185
118 3300042659 Ga0466733_179817 Ga0466733_179817_467_1024 185
119 iso_pr_bacteria 2590828803 2592928926 185
120 iso_pr_bacteria 2820746860 2820747461 185
121 iso_pr_bacteria 2820770630 2820771383 185
122 iso_pr_bacteria 2820785563 2820786932 185
123 iso_pr_bacteria 2820788205 2820789822 185
124 iso_pr_bacteria 2873776654 2873777851 185
125 3300000036 IMNBGM34_c003625 IMNBGM34_0036252 186
126 3300000036 IMNBGM34_c004877 IMNBGM34_0048772 186
127 3300000036 IMNBGM34_c017181 IMNBGM34_0171812 186
128 3300002504 JGI24705J35276_12144886 JGI24705J35276_121448861 186
129 3300009826 Ga0123355_10053144 Ga0123355_100531444 186
130 3300009826 Ga0123355_10073553 Ga0123355_100735532 186
131 3300010049 Ga0123356_10036374 Ga0123356_100363743 186
132 3300010049 Ga0123356_10051712 Ga0123356_100517126 186
133 3300010049 Ga0123356_10139456 Ga0123356_101394565 186
134 3300010049 Ga0123356_10144520 Ga0123356_101445202 186
135 3300010049 Ga0123356_10221611 Ga0123356_102216113 186
136 3300010049 Ga0123356_10594456 Ga0123356_105944562 186
137 3300010049 Ga0123356_10830970 Ga0123356_108309702 186
138 3300010049 Ga0123356_10973979 Ga0123356_109739792 186
139 3300010049 Ga0123356_11610380 Ga0123356_116103801 186
140 3300010049 Ga0123356_11672216 Ga0123356_116722162 186
141 3300010167 Ga0123353_10244935 Ga0123353_102449355 186
142 3300010882 Ga0123354_10272226 Ga0123354_102722262 186
143 3300010882 Ga0123354_10433716 Ga0123354_104337162 186
144 3300010882 Ga0123354_10657423 Ga0123354_106574232 186
145 3300012803 Ga0160465_100054 Ga0160465_10005492 186
146 3300012805 Ga0160464_113521 Ga0160464_1135211 186
147 3300012813 Ga0160470_101175 Ga0160470_10117513 186
148 3300012824 Ga0160469_100154 Ga0160469_10015439 186
149 3300012825 Ga0160441_100013 Ga0160441_100013228 186
150 3300012837 Ga0160455_100062 Ga0160455_10006256 186
151 3300012837 Ga0160455_100183 Ga0160455_10018323 186
152 3300012839 Ga0160472_110190 Ga0160472_1101902 186
153 3300012849 Ga0160447_100004 Ga0160447_100004192 186
154 3300012858 Ga0160457_1000216 Ga0160457_100021643 186
155 3300012858 Ga0160457_1001220 Ga0160457_10012209 186
156 3300042582 Ga0466657_204285 Ga0466657_204285_2791_3351 186
157 3300042594 Ga0466694_060428 Ga0466694_060428_1205_1765 186
158 3300042594 Ga0466694_063011 Ga0466694_063011_2619_3179 186
159 3300042594 Ga0466694_111997 Ga0466694_111997_533_1093 186
160 3300042594 Ga0466694_180398 Ga0466694_180398_851_1411 186
161 3300042594 Ga0466694_312337 Ga0466694_312337_4682_5242 186
162 3300042598 Ga0466701_025996 Ga0466701_025996_8814_9374 186
163 3300042598 Ga0466701_030599 Ga0466701_030599_3555_4115 186
164 3300042598 Ga0466701_098401 Ga0466701_098401_413_973 186
165 3300042600 Ga0466700_283432 Ga0466700_283432_311_871 186
166 3300042604 Ga0466717_017183 Ga0466717_017183_1042_1602 186
167 3300042604 Ga0466717_309442 Ga0466717_309442_1806_2366 186
168 3300042608 Ga0466721_136051 Ga0466721_136051_563_1123 186
169 3300042610 Ga0466698_418342 Ga0466698_418342_1101_1661 186
170 3300042611 Ga0466697_223009 Ga0466697_223009_739_1299 186
171 3300042613 Ga0466710_128288 Ga0466710_128288_490_1050 186
172 3300042613 Ga0466710_251017 Ga0466710_251017_863_1423 186
173 3300042622 Ga0466731_016159 Ga0466731_016159_10_570 186
174 3300042622 Ga0466731_248329 Ga0466731_248329_1422_1982 186
175 3300042648 Ga0466709_218885 Ga0466709_218885_1594_2154 186
176 3300042649 Ga0466724_17202 Ga0466724_17202_1334_1894 186
177 3300042649 Ga0466724_47248 Ga0466724_47248_105_665 186
178 3300042649 Ga0466724_66981 Ga0466724_66981_9118_9678 186
179 3300042656 Ga0466732_009863 Ga0466732_009863_396_956 186
180 iso_pr_bacteria 2820735654 2820735868 186
181 iso_pr_bacteria 2820753519 2820754034 186
182 iso_pr_bacteria 2820755292 2820756146 186
183 iso_pr_bacteria 2820783511 2820785216 186
184 iso_pr_bacteria 2820792843 2820794905 186
185 iso_pr_bacteria 2820795054 2820795817 186
186 iso_pr_bacteria 2820797595 2820799325 186
187 3300000089 AustNasuHG_c1007648 AustNasuHG_10076486 187
188 3300002450 JGI24695J34938_10009199 JGI24695J34938_100091993 187
189 3300002462 JGI24702J35022_10000489 JGI24702J35022_1000048911 187
190 3300002462 JGI24702J35022_10044638 JGI24702J35022_100446385 187
191 3300002504 JGI24705J35276_12199368 JGI24705J35276_121993682 187
192 3300010049 Ga0123356_10459264 Ga0123356_104592642 187
193 3300010049 Ga0123356_11651494 Ga0123356_116514941 187
194 3300010167 Ga0123353_10002126 Ga0123353_100021269 187
195 3300010167 Ga0123353_10056405 Ga0123353_100564055 187
196 3300010167 Ga0123353_10113321 Ga0123353_101133213 187
197 3300010167 Ga0123353_10404880 Ga0123353_104048804 187
198 3300010167 Ga0123353_10448733 Ga0123353_104487333 187
199 3300010167 Ga0123353_10673803 Ga0123353_106738032 187
200 3300010167 Ga0123353_10673804 Ga0123353_106738042 187
201 3300010167 Ga0123353_10910240 Ga0123353_109102403 187
202 3300010882 Ga0123354_10198836 Ga0123354_101988362 187
203 3300007505 Ga0105005_1121158 Ga0105005_11211584 188
204 3300007505 Ga0105005_1021830 Ga0105005_10218302 192
205 3300009784 Ga0123357_10056176 Ga0123357_100561769 193
206 3300042611 Ga0466697_099390 Ga0466697_099390_69_656 195
207 3300042613 Ga0466710_429042 Ga0466710_429042_615_1202 195
208 3300010167 Ga0123353_10489666 Ga0123353_104896662 196
209 3300010049 Ga0123356_10019186 Ga0123356_100191867 197
210 3300042654 Ga0466725_224042 Ga0466725_224042_1529_2164 211

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00347 Ribosomal_L6 Ribosomal protein L6 22 94 0.97

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.82 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.