Protein Family IF02664

Metagenome Metatranscriptome Isolate
199 Members
132 Samples
113 Scaffolds
157.05 Avg Length

🧬 Representative Sequence

ID
3300010049|Ga0123356_10003991|Ga0123356_1000399112
Length
158 aa
Sequence
MSRRRNAEKREITPDPKFNSALVTQFINNVTKSGKKRLAENLFYSAVEMAGQRSGGVDGLSVFKKAVENVKPVLEVKSRRIGGANYQVPIEVPAERRVSLAIRWLISYAKQRSEKSMAEKLANEFVQASKNEGGAIRKKIDTHKMAEANKAFAHFRY*

📊 Sample Types

Isolate 43.2%
Metagenome 54.3%
MAG 0.0%
Metatranscriptome 2.5%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 23.3%
Termitidae 16.7%
Apidae 10.0%
Kalotermitidae 7.5%
Halictidae 7.5%
Tenebrionidae 5.8%
Blattidae 5.0%
Drosophilidae 3.3%
Passalidae 2.5%
Scarabaeidae 2.5%
Formicidae 2.5%
Elmidae 1.7%
Termopsidae 1.7%
Calliphoridae 0.8%
Vespidae 0.8%
Stratiomyidae 0.8%
Bombycidae 0.8%
Hodotermitidae 0.8%
Armadillidiidae 0.8%
Gomphidae 0.8%
Nephropidae 0.8%
Libellulidae 0.8%
Cerambycidae 0.8%
Rhinotermitidae 0.8%
Noctuidae 0.8%

🌳 Taxonomy

Archaea 0
Bacteria 175
Eukaryota 0
Viruses 0
Unclassified 24

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 8114555646 Enterococcus sp. DIV1094 Isolate
2 2940270707 Lachnoclostridium sp. PF1-13 Isolate Blattidae
3 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
4 2595698190 Melissococcus plutonius 21.1 Isolate Apidae
5 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
6 2820483401 Unclassified Firmicutes Lab288P1bin74 Isolate Unclassified
7 2627853628 Melissococcus plutonius 82 Isolate Apidae
8 8012939035 Enterococcus sp. UD-01 Isolate Tenebrionidae
9 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
10 8114537524 Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 Isolate
11 2855361764 Lysinibacillus fusiformis Juneja Isolate Drosophilidae
12 2881902429 Companilactobacillus metriopterae JCM 31635 Isolate Unclassified
13 2595698199 Melissococcus plutonius 60 Isolate Apidae
14 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
15 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
16 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
17 8007215774 Enterococcus sp. BWR-S5 Isolate Scarabaeidae
18 8007237282 Enterococcus sp. DIV0212c Isolate
19 8018798118 Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 Isolate
20 8066802609 Apilactobacillus timberlakei HV_09 Isolate Halictidae
21 8002304686 Apilactobacillus kunkeei UASWS1867-NN5 Isolate Apidae
22 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
23 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
24 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
25 8114544644 Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 Isolate
26 2852123468 Lysinibacillus sphaericus KCCM 35418 Isolate Unclassified
27 2852431164 Brevibacillus laterosporus BON707 Isolate Calliphoridae
28 2881375749 Vagococcus entomophilus DSM 24756 Isolate Vespidae
29 2940218408 Enterococcus sp. PF1-24 Isolate Blattidae
30 2940264388 Lachnospiraceae bacterium PFB1-17 Isolate Blattidae
31 2940267548 Lachnospiraceae bacterium PFB1-22 Isolate Blattidae
32 2595698193 Melissococcus plutonius B5 Isolate Apidae
33 2595698196 Melissococcus plutonius 49.3 Isolate Apidae
34 2820285501 Unclassified Firmicutes Th196P3bin142 Isolate Unclassified
35 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
36 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
37 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
38 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
39 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
40 8030337018 Tissierella sp. Yu-01 Isolate Stratiomyidae
41 8038268975 Enterococcus mundtii EM01 Isolate Bombycidae
42 8066794103 Apilactobacillus timberlakei HV_25 Isolate Halictidae
43 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
44 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
45 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
46 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
47 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
48 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
49 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
50 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
51 3300021190 Termite gut microbial communities from nest - French Guiana - 1_3 mRNA 1_3 mRNA SA Metatranscriptome Termitidae
52 8114549044 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
53 2890957088 Psychrobacillus lasiicapitis NEAU-3TGS17 Isolate Formicidae
54 2923762712 Apilactobacillus micheneri Hlig3 Isolate Halictidae
55 2834540479 Leuconostoc citreum DmW_111 Isolate Drosophilidae
56 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
57 2524614537 Lysinibacillus sphaericus OT4b.31 Isolate Unclassified
58 2595698198 Melissococcus plutonius L9 Isolate Apidae
59 2751185832 Lysinibacillus sp. AR18-8 Isolate Unclassified
60 2675903377 Apilactobacillus kunkeei AR114 Isolate Unclassified
61 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
62 647533136 Enterococcus faecalis Fly1 Isolate Drosophilidae
63 8007220153 Enterococcus sp. BWB1-3 Isolate Scarabaeidae
64 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
65 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
66 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
67 3300022232 Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA Metatranscriptome Termitidae
68 2936628749 Apilactobacillus quenuiae HV_6 Isolate Halictidae
69 2595698194 Melissococcus plutonius 90.0 Isolate Apidae
70 2595698195 Melissococcus plutonius 119 Isolate Apidae
71 2767802234 Cytobacillus kochii BDGP4 Isolate Drosophilidae
72 2820353569 Unclassified Firmicutes Nt197P3bin28 Isolate Unclassified
73 2820385248 Unclassified Firmicutes Nt197P1bin19 Isolate Unclassified
74 2820539610 Unclassified Firmicutes Lab288P1bin136 Isolate Unclassified
75 8007223943 Enterococcus sp. MSG2901 Isolate
76 8012112996 Staphylococcus muscae ATCC 49910 Isolate
77 8018802046 Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 Isolate Gomphidae
78 8043041867 Bacillus pumilus Ha06YP001 Isolate Nephropidae
79 8066795793 Apilactobacillus timberlakei HV_10 Isolate Halictidae
80 8066799369 Apilactobacillus timberlakei HV_02 Isolate Halictidae
81 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
82 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
83 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
84 2997944163 Streptococcus penaeicida CAIM 1838 Isolate Unclassified
85 8114541043 Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 Isolate Libellulidae
86 2843246524 Lysinibacillus sphaericus DSM 28 Isolate Unclassified
87 2864895409 Bacillus aerius S00152 Isolate Elmidae
88 2084038013 Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae Metagenome Cerambycidae
89 2595698197 Melissococcus plutonius H6 Isolate Apidae
90 2820510699 Unclassified Firmicutes Lab288P1bin40 Isolate Unclassified
91 2820526825 Unclassified Firmicutes Lab288P1bin16 Isolate Unclassified
92 2558860143 Apilactobacillus kunkeei EFB6 Isolate Apidae
93 2820679524 Unclassified Firmicutes Co191P1bin94 Isolate Unclassified
94 650716050 Melissococcus plutonius ATCC 35311 Isolate Unclassified
95 8007211731 Enterococcus larvae BWM-S5 Isolate Scarabaeidae
96 8066790652 Apilactobacillus timberlakei HV_28 Isolate Halictidae
97 8066792404 Apilactobacillus timberlakei HV_04 Isolate Halictidae
98 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
99 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
100 2983866074 Paenibacillus polymyxa A18 Isolate Unclassified
101 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
102 3300022820 Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA Metatranscriptome Termitidae
103 8112490586 Staphylococcus muscae CCM 4175 Isolate
104 2917496769 Staphylococcus muscae DSM 7068 Isolate Unclassified
105 2940261461 Enterococcus sp. PFB1-1 Isolate Blattidae
106 2940273867 Lachnoclostridium sp. PH1-16 Isolate Blattidae
107 2551306396 Paenibacillus sp. ICGEB2008 Isolate Noctuidae
108 2576861701 Paenibacillus sp. JCM 10914 Isolate Termitidae
109 2740892556 Enterococcus sp. JR029-101 Isolate Unclassified
110 2740892557 Staphylococcus sp. JDR108L-110-1 Isolate Unclassified
111 2820497731 Unclassified Firmicutes Lab288P1bin55 Isolate Unclassified
112 2820504582 Unclassified Firmicutes Lab288P1bin5 Isolate Unclassified
113 2820634724 Unclassified Firmicutes Emb289P1bin116 Isolate Unclassified
114 8108568626 Enterococcus sp. DIV1094 Isolate
115 8108576847 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
116 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
117 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
118 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
119 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
120 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
121 2864801025 Bacillus aerius S00042 Isolate Elmidae
122 2877522083 Apilactobacillus bombintestini BHWM-4 Isolate Apidae
123 2820296961 Unclassified Firmicutes Th196P3bin102 Isolate Unclassified
124 2820547636 Unclassified Firmicutes Lab288P1bin10 Isolate Unclassified
125 2820646798 Unclassified Firmicutes Cu122P5bin36 Isolate Unclassified
126 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
127 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
128 8066797744 Apilactobacillus timberlakei HV_26 Isolate Halictidae
129 8077780672 Enterococcus sp. PLM3 Isolate Formicidae
130 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
131 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
132 3300023282 Termite gut microbial communities from Aparatermes sp. nest - French Guiana - 29-3 mRNA Metatranscriptome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562379_0011 3300056790 Bacteria 1623141
2 Ga0466707_250286 3300042601 Unclassified 2774
3 Ga0466707_266828 3300042601 Bacteria 1006
4 2227607975 2225789004 Unclassified 2285
5 JGI24697J35500_10899030 3300002507 Bacteria 807
6 Ga0072941_1103827 3300005201 Bacteria 2530
7 Ga0466711_488367 3300042615 Bacteria 14361
8 Ga0123355_10260693 3300009826 Bacteria 2424
9 Ga0123356_12003578 3300010049 Bacteria 722
10 Ga0123353_10521517 3300010167 Bacteria 1724
11 Ga0466705_377866 3300042612 Bacteria 2815
12 Ga0562379_0879 3300056790 Bacteria 44973
13 Ga0562379_2916 3300056790 Bacteria 12733
14 Ga0562377_0006 3300056842 Bacteria 3350072
15 Ga0562374_1307 3300057007 Bacteria 30195
16 Ga0466706_104819 3300042599 Unclassified 10684
17 Ga0466706_196526 3300042599 Bacteria 1233
18 Ga0466706_242096 3300042599 Bacteria 4062
19 Ga0466707_152663 3300042601 Bacteria 4882
20 Ga0466719_298555 3300042606 Bacteria 20171
21 2227601024 2225789004 Bacteria 2337
22 2227672131 2225789004 Unclassified 1892
23 IMNBL1DRAFT_c0173851 3300000062 Unclassified 546
24 JGI24703J35330_11748732 3300002501 Bacteria 29684
25 Ga0123355_10456500 3300009826 Bacteria 1607
26 Ga0123356_10278162 3300010049 Bacteria 1767
27 Ga0123353_11252621 3300010167 Bacteria 968
28 Ga0562376_0063 3300056857 Bacteria 267702
29 Ga0466709_054276 3300042648 Unclassified 1488
30 Ga0233288_1005524 3300022232 Bacteria 1247
31 Ga0466690_196200 3300042590 Unclassified 2174
32 Ga0466706_038772 3300042599 Bacteria 6236
33 Ga0466706_050734 3300042599 Bacteria 49644
34 Ga0466707_062300 3300042601 Bacteria 130663
35 2227247451 2225789004 Bacteria 32242
36 IMNBL1DRAFT_c0000268 3300000062 Bacteria 46090
37 IMNBL1DRAFT_c0010442 3300000062 Unclassified 4444
38 AustNasuHG_c1012310 3300000089 Unclassified 2953
39 Ga0466704_327672 3300042643 Bacteria 29858
40 Ga0466709_028819 3300042648 Bacteria 2947
41 Ga0415639_014593 3300038395 Unclassified 5864
42 Ga0466706_158072 3300042599 Bacteria 12307
43 2226987898 2225789003 Unclassified 1667
44 2227513826 2225789004 Unclassified 3494
45 2227544084 2225789004 Bacteria 15356
46 2227649629 2225789004 Bacteria 10798
47 IMNBL1DRAFT_c0006609 3300000062 Bacteria 6291
48 IMNBL1DRAFT_c0016963 3300000062 Bacteria 3089
49 IMNBL1DRAFT_c0019087 3300000062 Bacteria 2822
50 AustNasuHG_c1011205 3300000089 Bacteria 3109
51 Ga0123355_10208781 3300009826 Unclassified 2835
52 Ga0123355_10221348 3300009826 Bacteria 2721
53 Ga0123355_10893794 3300009826 Bacteria 967
54 Ga0123356_10003991 3300010049 Bacteria 15330
55 Ga0466730_089070 3300042625 Bacteria 1395
56 Ga0222431_1026073 3300021190 Bacteria 1166
57 Ga0415639_174965 3300038395 Bacteria 3149
58 Ga0466693_179292 3300042592 Bacteria 4915
59 Ga0466707_168226 3300042601 Bacteria 11522
60 Ga0466714_034586 3300042603 Bacteria 3040
61 Ga0466716_469396 3300042605 Bacteria 9930
62 2227121916 2225789004 Unclassified 1698
63 2227356341 2225789004 Bacteria 1134
64 2227464709 2225789004 Bacteria 982
65 IMNBL1DRAFT_c0004716 3300000062 Bacteria 8070
66 IMNBL1DRAFT_c0015584 3300000062 Bacteria 3295
67 CVPL010L_1000065 3300002932 Unclassified 54722
68 Ga0466726_355238 3300042619 Bacteria 13364
69 Ga0123355_10704972 3300009826 Bacteria 1157
70 Ga0123355_11829039 3300009826 Unclassified 571
71 Ga0530661_000718 3300056564 Unclassified 21906
72 Ga0466691_046649 3300042593 Bacteria 3408
73 Ga0466719_239553 3300042606 Bacteria 9313
74 2227066264 2225789003 Unclassified 666
75 2227646819 2225789004 Bacteria 44364
76 IMNBL1DRAFT_c0000241 3300000062 Bacteria 48129
77 JGI24695J34938_10035309 3300002450 Bacteria 2287
78 Ga0466715_481552 3300042616 Bacteria 17646
79 Ga0123357_10284789 3300009784 Bacteria 1700
80 Ga0123355_10055693 3300009826 Bacteria 6402
81 Ga0123355_10225755 3300009826 Bacteria 2684
82 Ga0123356_12998972 3300010049 Bacteria 589
83 Ga0123353_10242518 3300010167 Bacteria 2799
84 Ga0123353_10270864 3300010167 Unclassified 2616
85 Ga0123353_10556619 3300010167 Bacteria 1652
86 Ga0123354_10301991 3300010882 Bacteria 1512
87 Ga0466705_264536 3300042612 Bacteria 2358
88 Ga0466733_115687 3300042659 Bacteria 10819
89 Ga0466733_190676 3300042659 Bacteria 1547
90 Ga0562377_0317 3300056842 Bacteria 97339
91 Ga0233288_1001098 3300022232 Bacteria 2097
92 Ga0255809_1020759 3300022820 Unclassified 1474
93 Ga0466693_097661 3300042592 Bacteria 2187
94 Ga0466693_404523 3300042592 Bacteria 3204
95 Ga0466721_235909 3300042608 Bacteria 27576
96 Ga0466722_094775 3300042609 Bacteria 4300
97 IMNBL1DRAFT_c0000036 3300000062 Bacteria 120012
98 IMNBL1DRAFT_c0020533 3300000062 Bacteria 2672
99 IMNBL1DRAFT_c0032549 3300000062 Bacteria 1879
100 Ga0466705_488388 3300042612 Bacteria 10904
101 Ga0123357_10042851 3300009784 Bacteria 6152
102 Ga0123353_10295389 3300010167 Bacteria 2477
103 Ga0562378_0008 3300056814 Bacteria 1370151
104 Ga0466735_070611 3300042624 Unclassified 1325
105 Ga0160467_100322 3300012829 Bacteria 52269
106 Ga0255808_1004439 3300023282 Unclassified 2197
107 AglaG_GDN60OX02IRH8P 2084038013 Unclassified 532
108 2227121641 2225789004 Unclassified 1699
109 Ga0466715_257161 3300042616 Bacteria 85931
110 Ga0466715_262608 3300042616 Bacteria 6632
111 Ga0123357_10012257 3300009784 Bacteria 11047
112 Ga0123353_10433002 3300010167 Bacteria 1944
113 Ga0123353_11808333 3300010167 Bacteria 759

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010049 Ga0123356_12998972 Ga0123356_129989721 151
2 3300021190 Ga0222431_1026073 Ga0222431_10260732 151
3 3300042659 Ga0466733_190676 Ga0466733_190676_497_985 153
4 3300042599 Ga0466706_242096 Ga0466706_242096_2998_3465 155
5 2084038013 AglaG_GDN60OX02IRH8P AglaG_04574160 156
6 2225789003 2226987898 2227336462 156
7 2225789003 2227066264 2227423828 156
8 2225789004 2227121641 2227514830 156
9 2225789004 2227121916 2227515190 156
10 2225789004 2227247451 2227689013 156
11 2225789004 2227356341 2227801212 156
12 2225789004 2227464709 2227901905 156
13 2225789004 2227513826 2228010805 156
14 2225789004 2227607975 2228178185 156
15 2225789004 2227646819 2228239381 156
16 2225789004 2227649629 2228244589 156
17 2225789004 2227672131 2228278091 156
18 3300022820 Ga0255809_1020759 Ga0255809_10207592 156
19 3300023282 Ga0255808_1004439 Ga0255808_10044392 156
20 3300038395 Ga0415639_014593 Ga0415639_014593_189_659 156
21 3300038395 Ga0415639_174965 Ga0415639_174965_819_1289 156
22 3300042590 Ga0466690_196200 Ga0466690_196200_477_947 156
23 3300042592 Ga0466693_097661 Ga0466693_097661_973_1443 156
24 3300042592 Ga0466693_179292 Ga0466693_179292_1213_1683 156
25 3300042592 Ga0466693_404523 Ga0466693_404523_1464_1934 156
26 3300042593 Ga0466691_046649 Ga0466691_046649_498_968 156
27 3300042599 Ga0466706_038772 Ga0466706_038772_697_1167 156
28 3300042599 Ga0466706_050734 Ga0466706_050734_32675_33145 156
29 3300042599 Ga0466706_104819 Ga0466706_104819_9895_10365 156
30 3300042599 Ga0466706_158072 Ga0466706_158072_7164_7634 156
31 3300042599 Ga0466706_196526 Ga0466706_196526_657_1127 156
32 3300042601 Ga0466707_062300 Ga0466707_062300_73426_73896 156
33 3300042601 Ga0466707_152663 Ga0466707_152663_2881_3351 156
34 3300042601 Ga0466707_168226 Ga0466707_168226_9897_10367 156
35 3300042601 Ga0466707_250286 Ga0466707_250286_798_1268 156
36 3300042601 Ga0466707_266828 Ga0466707_266828_291_761 156
37 3300042603 Ga0466714_034586 Ga0466714_034586_2408_2878 156
38 3300042605 Ga0466716_469396 Ga0466716_469396_6221_6691 156
39 3300042606 Ga0466719_239553 Ga0466719_239553_8034_8504 156
40 3300042606 Ga0466719_298555 Ga0466719_298555_10022_10492 156
41 3300042612 Ga0466705_264536 Ga0466705_264536_781_1251 156
42 3300042612 Ga0466705_488388 Ga0466705_488388_10336_10806 156
43 3300042616 Ga0466715_257161 Ga0466715_257161_30772_31242 156
44 3300042616 Ga0466715_262608 Ga0466715_262608_3424_3894 156
45 3300042616 Ga0466715_481552 Ga0466715_481552_8611_9081 156
46 3300042619 Ga0466726_355238 Ga0466726_355238_10666_11136 156
47 3300042624 Ga0466735_070611 Ga0466735_070611_650_1120 156
48 3300042625 Ga0466730_089070 Ga0466730_089070_300_770 156
49 3300042643 Ga0466704_327672 Ga0466704_327672_17861_18331 156
50 3300042648 Ga0466709_028819 Ga0466709_028819_186_656 156
51 3300042648 Ga0466709_054276 Ga0466709_054276_96_566 156
52 3300056564 Ga0530661_000718 Ga0530661_000718_9568_10038 156
53 3300056790 Ga0562379_0011 Ga0562379_0011_355398_355868 156
54 3300056790 Ga0562379_0879 Ga0562379_0879_1253_1723 156
55 3300056790 Ga0562379_2916 Ga0562379_2916_9466_9936 156
56 3300056814 Ga0562378_0008 Ga0562378_0008_704761_705231 156
57 3300056842 Ga0562377_0006 Ga0562377_0006_10867_11337 156
58 3300056842 Ga0562377_0317 Ga0562377_0317_49789_50259 156
59 3300056857 Ga0562376_0063 Ga0562376_0063_216390_216860 156
60 3300057007 Ga0562374_1307 Ga0562374_1307_22197_22667 156
61 iso_pr_bacteria 2524614537 2524835972 156
62 iso_pr_bacteria 2551306396 2552923423 156
63 iso_pr_bacteria 2558860143 2559001087 156
64 iso_pr_bacteria 2576861701 2579272615 156
65 iso_pr_bacteria 2595698190 2596205191 156
66 iso_pr_bacteria 2595698193 2596210590 156
67 iso_pr_bacteria 2595698194 2596213665 156
68 iso_pr_bacteria 2595698195 2596214277 156
69 iso_pr_bacteria 2595698196 2596216099 156
70 iso_pr_bacteria 2595698197 2596217930 156
71 iso_pr_bacteria 2595698198 2596219760 156
72 iso_pr_bacteria 2595698199 2596221573 156
73 iso_pr_bacteria 2627853628 2628279899 156
74 iso_pr_bacteria 2675903377 2677724350 156
75 iso_pr_bacteria 2740892556 2743948673 156
76 iso_pr_bacteria 2740892557 2743952615 156
77 iso_pr_bacteria 2751185832 2753512163 156
78 iso_pr_bacteria 2767802234 2769328207 156
79 iso_pr_bacteria 2820272499 2820272625 156
80 iso_pr_bacteria 2820285501 2820288679 156
81 iso_pr_bacteria 2820296961 2820297459 156
82 iso_pr_bacteria 2820353569 2820354650 156
83 iso_pr_bacteria 2820385248 2820387279 156
84 iso_pr_bacteria 2820483401 2820484351 156
85 iso_pr_bacteria 2820497731 2820499219 156
86 iso_pr_bacteria 2820504582 2820505864 156
87 iso_pr_bacteria 2820510699 2820511959 156
88 iso_pr_bacteria 2820526825 2820527818 156
89 iso_pr_bacteria 2820539610 2820539638 156
90 iso_pr_bacteria 2820547636 2820548172 156
91 iso_pr_bacteria 2820634724 2820636086 156
92 iso_pr_bacteria 2820646798 2820647240 156
93 iso_pr_bacteria 2820679524 2820679822 156
94 iso_pr_bacteria 2834540479 2834541690 156
95 iso_pr_bacteria 2843246524 2843246756 156
96 iso_pr_bacteria 2852123468 2852127090 156
97 iso_pr_bacteria 2852431164 2852434086 156
98 iso_pr_bacteria 2855361764 2855365629 156
99 iso_pr_bacteria 2864801025 2864804880 156
100 iso_pr_bacteria 2864895409 2864899262 156
101 iso_pr_bacteria 2877522083 2877522491 156
102 iso_pr_bacteria 2881375749 2881377097 156
103 iso_pr_bacteria 2881902429 2881903605 156
104 iso_pr_bacteria 2890957088 2890959902 156
105 iso_pr_bacteria 2917496769 2917497993 156
106 iso_pr_bacteria 2923762712 2923763956 156
107 iso_pr_bacteria 2936628749 2936629319 156
108 iso_pr_bacteria 2940218408 2940221005 156
109 iso_pr_bacteria 2940261461 2940264035 156
110 iso_pr_bacteria 2940264388 2940266129 156
111 iso_pr_bacteria 2940267548 2940269257 156
112 iso_pr_bacteria 2940270707 2940272416 156
113 iso_pr_bacteria 2940273867 2940275613 156
114 iso_pr_bacteria 2983866074 2983871067 156
115 iso_pr_bacteria 2997944163 2997946122 156
116 iso_pr_bacteria 647533136 647746959 156
117 iso_pr_bacteria 650716050 650844479 156
118 iso_pr_bacteria 8002304686 8002305213 156
119 iso_pr_bacteria 8007211731 8007214485 156
120 iso_pr_bacteria 8007215774 8007219225 156
121 iso_pr_bacteria 8007220153 8007221872 156
122 iso_pr_bacteria 8007223943 8007226409 156
123 iso_pr_bacteria 8007237282 8007239124 156
124 iso_pr_bacteria 8012112996 8012114680 156
125 iso_pr_bacteria 8012939035 8012939844 156
126 iso_pr_bacteria 8018798118 8018798918 156
127 iso_pr_bacteria 8018802046 8018803727 156
128 iso_pr_bacteria 8030337018 8030338651 156
129 iso_pr_bacteria 8038268975 8038272051 156
130 iso_pr_bacteria 8043041867 8043045556 156
131 iso_pr_bacteria 8066790652 8066790958 156
132 iso_pr_bacteria 8066792404 8066792485 156
133 iso_pr_bacteria 8066794103 8066794807 156
134 iso_pr_bacteria 8066795793 8066797379 156
135 iso_pr_bacteria 8066797744 8066797825 156
136 iso_pr_bacteria 8066799369 8066799692 156
137 iso_pr_bacteria 8066802609 8066803351 156
138 iso_pr_bacteria 8077780672 8077780874 156
139 iso_pr_bacteria 8108568626 8108569945 156
140 iso_pr_bacteria 8108576847 8108579168 156
141 iso_pr_bacteria 8112490586 8112491359 156
142 iso_pr_bacteria 8114537524 8114539412 156
143 iso_pr_bacteria 8114541043 8114543888 156
144 iso_pr_bacteria 8114544644 8114546904 156
145 iso_pr_bacteria 8114549044 8114551365 156
146 iso_pr_bacteria 8114555646 8114556965 156
147 3300000062 IMNBL1DRAFT_c0000036 IMNBL1DRAFT_000003664 157
148 3300000062 IMNBL1DRAFT_c0000241 IMNBL1DRAFT_000024147 157
149 3300000062 IMNBL1DRAFT_c0000268 IMNBL1DRAFT_000026836 157
150 3300000062 IMNBL1DRAFT_c0004716 IMNBL1DRAFT_00047164 157
151 3300000062 IMNBL1DRAFT_c0006609 IMNBL1DRAFT_00066092 157
152 3300000062 IMNBL1DRAFT_c0010442 IMNBL1DRAFT_00104424 157
153 3300000062 IMNBL1DRAFT_c0015584 IMNBL1DRAFT_00155843 157
154 3300000062 IMNBL1DRAFT_c0016963 IMNBL1DRAFT_00169631 157
155 3300000062 IMNBL1DRAFT_c0019087 IMNBL1DRAFT_00190876 157
156 3300000062 IMNBL1DRAFT_c0020533 IMNBL1DRAFT_00205332 157
157 3300000062 IMNBL1DRAFT_c0032549 IMNBL1DRAFT_00325492 157
158 3300000062 IMNBL1DRAFT_c0173851 IMNBL1DRAFT_01738511 157
159 3300000089 AustNasuHG_c1011205 AustNasuHG_10112052 157
160 3300000089 AustNasuHG_c1012310 AustNasuHG_10123103 157
161 3300002450 JGI24695J34938_10035309 JGI24695J34938_100353092 157
162 3300002501 JGI24703J35330_11748732 JGI24703J35330_1174873218 157
163 3300002507 JGI24697J35500_10899030 JGI24697J35500_108990301 157
164 3300002932 CVPL010L_1000065 CVPL010L_10000652 157
165 3300005201 Ga0072941_1103827 Ga0072941_11038274 157
166 3300009784 Ga0123357_10012257 Ga0123357_100122574 157
167 3300009784 Ga0123357_10042851 Ga0123357_100428513 157
168 3300009784 Ga0123357_10284789 Ga0123357_102847893 157
169 3300009826 Ga0123355_10055693 Ga0123355_100556934 157
170 3300009826 Ga0123355_10208781 Ga0123355_102087814 157
171 3300009826 Ga0123355_10260693 Ga0123355_102606932 157
172 3300009826 Ga0123355_10456500 Ga0123355_104565002 157
173 3300009826 Ga0123355_10893794 Ga0123355_108937941 157
174 3300009826 Ga0123355_11829039 Ga0123355_118290391 157
175 3300010049 Ga0123356_10278162 Ga0123356_102781621 157
176 3300010049 Ga0123356_12003578 Ga0123356_120035781 157
177 3300010167 Ga0123353_10270864 Ga0123353_102708642 157
178 3300010167 Ga0123353_10433002 Ga0123353_104330024 157
179 3300010167 Ga0123353_10521517 Ga0123353_105215172 157
180 3300010882 Ga0123354_10301991 Ga0123354_103019912 157
181 3300012829 Ga0160467_100322 Ga0160467_10032225 157
182 3300022232 Ga0233288_1001098 Ga0233288_10010982 157
183 3300042608 Ga0466721_235909 Ga0466721_235909_23372_23845 157
184 3300010049 Ga0123356_10003991 Ga0123356_1000399112 158
185 2225789004 2227601024 2228166811 162
186 2225789004 2227544084 2228068275 163
187 3300009826 Ga0123355_10225755 Ga0123355_102257552 163
188 3300009826 Ga0123355_10704972 Ga0123355_107049722 163
189 3300010167 Ga0123353_10242518 Ga0123353_102425183 163
190 3300010167 Ga0123353_10295389 Ga0123353_102953892 163
191 3300010167 Ga0123353_11252621 Ga0123353_112526212 163
192 3300022232 Ga0233288_1005524 Ga0233288_10055241 163
193 3300042609 Ga0466722_094775 Ga0466722_094775_3368_3859 163
194 3300042659 Ga0466733_115687 Ga0466733_115687_8615_9106 163
195 3300042615 Ga0466711_488367 Ga0466711_488367_12448_12942 164
196 3300010167 Ga0123353_10556619 Ga0123353_105566192 178
197 3300010167 Ga0123353_11808333 Ga0123353_118083331 181
198 3300009826 Ga0123355_10221348 Ga0123355_102213483 183
199 3300042612 Ga0466705_377866 Ga0466705_377866_277_843 188

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00177 Ribosomal_S7 Ribosomal protein S7p/S5e 2 150 0.98

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.