Protein Family IF02652

Metagenome Isolate
245 Members
102 Samples
191 Scaffolds
377.42 Avg Length

🧬 Representative Sequence

ID
3300010049|Ga0123356_10002404|Ga0123356_1000240411
Length
436 aa
Sequence
MANRSVFSQERKICGEGRILNSGSIRKPLNGVTKKQTWPAARRLKEVNILDFLQMLYDFSQLIFGNMVATTWQQLVMWLIGGVLIYLAVKKDMEPTLLLPIGFGAILANLPFSGAITQTINGITEPGILDVLFNAGIANEALPLLLFIGIGAMIDFGPLLSNPKLLLFGAAAQFGIFFTLSMAALIGFDIRDAASIAIIGAADGPTSIFVANFFHSHYLGAIIVAAYSYMALVPIVQPPVIRLLTTKKERLIRMPYNPQNVPQIVKILFPIIVXXXXGXVAPVSVALVGFLMFGNLVRECGVLNQLSKGAQNELANIVTLLLGLTIAVRMQAEDFLRFATLMIISLGLVAFVFDTVGGVLFAKILNLFVKNKFNPMIGACGISAFPMSARVIHKMARKEDDQNFLLMHTVGVNVGGQVASVIAGGLVIALVSRLL*

📊 Sample Types

Isolate 22.0%
Metagenome 78.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 21.5%
Unclassified 18.3%
Kalotermitidae 15.1%
Blattidae 12.9%
Tenebrionidae 7.5%
Rhinotermitidae 3.2%
Drosophilidae 3.2%
Passalidae 3.2%
Stratiomyidae 2.2%
Scarabaeidae 2.2%
Termopsidae 2.2%
Formicidae 2.2%
Gomphidae 1.1%
Bombycidae 1.1%
Hodotermitidae 1.1%
Libellulidae 1.1%
Hydrophilidae 1.1%
Dytiscidae 1.1%

🌳 Taxonomy

Archaea 0
Bacteria 221
Eukaryota 0
Viruses 0
Unclassified 24

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940230426 Lachnospiraceae bacterium PH5-48 Isolate Blattidae
2 2940283334 Lachnospiraceae bacterium PF1-4 Isolate Blattidae
3 2940295490 Lachnospiraceae bacterium PH1-22 Isolate Blattidae
4 2781125651 Treponema sp. Co191P3bin8 Isolate Unclassified
5 2820727601 Unclassified Cloacimonetes Nt197P3bin46 Isolate Unclassified
6 2997944163 Streptococcus penaeicida CAIM 1838 Isolate Unclassified
7 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
8 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
9 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
10 651324002 Acetonema longum APO-1, DSM 6540 Isolate Kalotermitidae
11 8018802046 Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 Isolate Gomphidae
12 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
13 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
14 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
15 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
16 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
17 2940218408 Enterococcus sp. PF1-24 Isolate Blattidae
18 2940280053 Lachnospiraceae bacterium PF1-22 Isolate Blattidae
19 2944625312 Dysgonomonas sp. PF1-3 Isolate Blattidae
20 2585428085 Sporobacter termitidis DSM 10068 Isolate Termitidae
21 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
22 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
23 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
24 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
25 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
26 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
27 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
28 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
29 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
30 8030337018 Tissierella sp. Yu-01 Isolate Stratiomyidae
31 8038268975 Enterococcus mundtii EM01 Isolate Bombycidae
32 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
33 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
34 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
35 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
36 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
37 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
38 8114537524 Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 Isolate
39 2825804107 Enterococcus durans BDGP3 Isolate Drosophilidae
40 2940292506 Lachnoclostridium sp. PH5-23 Isolate Blattidae
41 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
42 2820367663 Unclassified Firmicutes Nt197P3bin105 Isolate Unclassified
43 2820389254 Unclassified Firmicutes Nc150P4bin19 Isolate Unclassified
44 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
45 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
46 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
47 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
48 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
49 8007237282 Enterococcus sp. DIV0212c Isolate
50 8018794549 Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 Isolate
51 8018798118 Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 Isolate
52 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
53 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
54 8114541043 Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 Isolate Libellulidae
55 2902668162 Lacticaseibacillus paracasei DmW_181 Isolate Drosophilidae
56 2940286528 Lachnospiraceae bacterium PFB1-21 Isolate Blattidae
57 8030343600 Proteiniborus sp. MB09-C3 Isolate Stratiomyidae
58 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
59 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
60 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
61 8114549044 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
62 2873595552 Erysipelothrix sp. HDW6C Isolate Hydrophilidae
63 2940277027 Lachnospiraceae bacterium PF1-21 Isolate Blattidae
64 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
65 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
66 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
67 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
68 647533136 Enterococcus faecalis Fly1 Isolate Drosophilidae
69 8007220153 Enterococcus sp. BWB1-3 Isolate Scarabaeidae
70 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
71 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
72 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
73 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
74 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
75 8114555646 Enterococcus sp. DIV1094 Isolate
76 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
77 2503904012 Sphaerochaeta coccoides SPN1, DSM 17374 Isolate Kalotermitidae
78 2775507073 Enterococcus sp. CR-Ec1 Isolate Unclassified
79 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
80 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
81 8012939035 Enterococcus sp. UD-01 Isolate Tenebrionidae
82 2873593402 Erysipelothrix sp. HDW6A Isolate Dytiscidae
83 2873597894 Erysipelothrix sp. HDW6B Isolate Unclassified
84 2940261461 Enterococcus sp. PFB1-1 Isolate Blattidae
85 2940289514 Lachnospiraceae bacterium PM6-15 Isolate Blattidae
86 2622736579 Desemzia incerta DSM 20581 Isolate Unclassified
87 2740892556 Enterococcus sp. JR029-101 Isolate Unclassified
88 2820724199 Unclassified Cloacimonetes Th196P3bin22 Isolate Unclassified
89 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
90 8108568626 Enterococcus sp. DIV1094 Isolate
91 8108576847 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
92 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
93 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
94 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
95 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
96 2940233634 Lachnoclostridium sp. PF5-10 Isolate Blattidae
97 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
98 2989309576 Sporomusa termitida DSM 4440 Isolate Unclassified
99 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
100 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
101 8002299145 Vagococcus allomyrinae BWB3-3 Isolate Scarabaeidae
102 8077780672 Enterococcus sp. PLM3 Isolate Formicidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123353_10198247 3300010167 Bacteria 3162
2 Ga0466706_082743 3300042599 Bacteria 4155
3 Ga0466713_023787 3300042602 Bacteria 11137
4 Ga0466722_259936 3300042609 Bacteria 16013
5 Ga0466715_187894 3300042616 Bacteria 3133
6 Ga0466726_265603 3300042619 Bacteria 6692
7 Ga0466704_069001 3300042643 Bacteria 4319
8 Ga0466708_062403 3300042652 Bacteria 26662
9 2227499619 2225789004 Bacteria 19624
10 IMNBL1DRAFT_c0000494 3300000062 Bacteria 32923
11 IMNBL1DRAFT_c0001728 3300000062 Bacteria 16028
12 JGI24695J34938_10001767 3300002450 Bacteria 17840
13 JGI24695J34938_10008306 3300002450 Bacteria 5937
14 Ga0072941_1021705 3300005201 Bacteria 24146
15 Ga0072941_1070834 3300005201 Bacteria 3604
16 Ga0466705_022437 3300042612 Bacteria 24966
17 Ga0466705_036513 3300042612 Bacteria 122886
18 Ga0466705_105365 3300042612 Bacteria 1660
19 Ga0123356_10545664 3300010049 Bacteria 1320
20 Ga0123353_10022447 3300010167 Bacteria 9518
21 Ga0123353_10041013 3300010167 Bacteria 7307
22 Ga0123353_10049068 3300010167 Bacteria 6724
23 Ga0466690_087910 3300042590 Bacteria 67683
24 Ga0466706_011267 3300042599 Bacteria 3093
25 Ga0466706_082350 3300042599 Bacteria 2657
26 Ga0466706_096162 3300042599 Bacteria 37393
27 Ga0466706_279758 3300042599 Bacteria 21465
28 Ga0466700_157938 3300042600 Bacteria 2159
29 Ga0466707_277438 3300042601 Unclassified 2711
30 Ga0466720_225102 3300042607 Bacteria 2058
31 Ga0466705_390387 3300042612 Bacteria 4311
32 Ga0466705_498231 3300042612 Bacteria 1956
33 Ga0466715_036720 3300042616 Bacteria 9199
34 Ga0466715_066943 3300042616 Bacteria 3854
35 Ga0466723_338813 3300042618 Bacteria 15460
36 Ga0466726_350669 3300042619 Bacteria 2020
37 Ga0466728_080658 3300042620 Bacteria 3058
38 Ga0466729_253864 3300042621 Bacteria 15671
39 Ga0466702_057005 3300042635 Bacteria 3047
40 Ga0466703_052208 3300042636 Unclassified 13397
41 Ga0466703_234264 3300042636 Bacteria 12348
42 Ga0466709_115669 3300042648 Bacteria 217304
43 2227065804 2225789003 Unclassified 3341
44 2227521857 2225789004 Bacteria 17099
45 IMNBL1DRAFT_c0003559 3300000062 Bacteria 9905
46 JGI24695J34938_10000156 3300002450 Bacteria 63017
47 JGI24695J34938_10008981 3300002450 Bacteria 5623
48 Ga0466705_112590 3300042612 Bacteria 9990
49 Ga0562374_0062 3300057007 Bacteria 360944
50 Ga0123356_10251778 3300010049 Bacteria 1844
51 Ga0123353_10179603 3300010167 Bacteria 3352
52 Ga0466692_006717 3300042591 Bacteria 4471
53 Ga0466691_028626 3300042593 Bacteria 9449
54 Ga0466699_173997 3300042597 Unclassified 2035
55 Ga0466706_226886 3300042599 Bacteria 4192
56 Ga0466706_239732 3300042599 Bacteria 1282
57 Ga0466698_107959 3300042610 Bacteria 6168
58 Ga0466710_331981 3300042613 Unclassified 2836
59 Ga0466715_089002 3300042616 Bacteria 1858
60 Ga0466715_443438 3300042616 Bacteria 4292
61 Ga0466702_044671 3300042635 Bacteria 109377
62 2227535733 2225789004 Bacteria 56982
63 2227560733 2225789004 Bacteria 14486
64 IMNBL1DRAFT_c0000088 3300000062 Bacteria 80215
65 IMNBL1DRAFT_c0005340 3300000062 Bacteria 7380
66 IMNBL1DRAFT_c0005865 3300000062 Bacteria 6881
67 JGI24695J34938_10017744 3300002450 Bacteria 3575
68 Ga0466733_174911 3300042659 Bacteria 11754
69 Ga0562375_0018 3300056856 Bacteria 940838
70 Ga0562375_0036 3300056856 Bacteria 609533
71 Ga0562375_0046 3300056856 Unclassified 491016
72 Ga0123353_10200622 3300010167 Bacteria 3139
73 Ga0123353_10694521 3300010167 Bacteria 1430
74 Ga0466699_306516 3300042597 Bacteria 2588
75 Ga0466699_434484 3300042597 Bacteria 8253
76 Ga0466706_148168 3300042599 Bacteria 1966
77 Ga0466707_199301 3300042601 Unclassified 3077
78 Ga0466719_207422 3300042606 Bacteria 16146
79 Ga0466715_425272 3300042616 Bacteria 1972
80 Ga0466702_026387 3300042635 Bacteria 4629
81 Ga0466704_555679 3300042643 Bacteria 35835
82 Ga0466724_62505 3300042649 Bacteria 2205
83 Ga0466708_364886 3300042652 Bacteria 16612
84 2227441900 2225789004 Unclassified 25945
85 2227513830 2225789004 Bacteria 3493
86 IMNBL1DRAFT_c0011238 3300000062 Bacteria 4200
87 JGI24695J34938_10000171 3300002450 Bacteria 60520
88 Ga0466705_303992 3300042612 Bacteria 4504
89 Ga0466733_167157 3300042659 Bacteria 20372
90 Ga0562379_0698 3300056790 Unclassified 56893
91 Ga0562377_0028 3300056842 Bacteria 766538
92 Ga0562376_0072 3300056857 Bacteria 246902
93 Ga0562376_1362 3300056857 Unclassified 34810
94 Ga0123353_10167968 3300010167 Bacteria 3485
95 Ga0123353_10534880 3300010167 Bacteria 1695
96 Ga0466693_176126 3300042592 Bacteria 4923
97 Ga0466694_218773 3300042594 Unclassified 1696
98 Ga0466696_215628 3300042596 Bacteria 88162
99 Ga0466706_077725 3300042599 Bacteria 5481
100 Ga0466706_178990 3300042599 Bacteria 2500
101 Ga0466700_136144 3300042600 Bacteria 1527
102 Ga0466707_247224 3300042601 Unclassified 143661
103 Ga0466707_322802 3300042601 Bacteria 14394
104 Ga0466707_327485 3300042601 Unclassified 14923
105 Ga0466714_084203 3300042603 Bacteria 3838
106 Ga0466719_014220 3300042606 Bacteria 7815
107 Ga0466719_210722 3300042606 Bacteria 2736
108 Ga0466715_081391 3300042616 Bacteria 24207
109 Ga0466715_113254 3300042616 Bacteria 52859
110 Ga0466715_139954 3300042616 Bacteria 28732
111 Ga0466715_631927 3300042616 Bacteria 2882
112 Ga0466723_002342 3300042618 Bacteria 16756
113 Ga0466723_172507 3300042618 Bacteria 3184
114 Ga0466703_216974 3300042636 Bacteria 2045
115 Ga0466704_613443 3300042643 Bacteria 4977
116 Ga0466709_039865 3300042648 Bacteria 21232
117 Ga0466708_227476 3300042652 Bacteria 3523
118 JGI24695J34938_10000019 3300002450 Bacteria 113818
119 JGI24695J34938_10000062 3300002450 Bacteria 88353
120 JGI24695J34938_10000627 3300002450 Bacteria 33643
121 JGI24695J34938_10001218 3300002450 Bacteria 22750
122 JGI24695J34938_10014115 3300002450 Bacteria 4159
123 JGI24695J34938_10041197 3300002450 Bacteria 2074
124 JGI24702J35022_10005550 3300002462 Bacteria 7358
125 CVPL010L_1000134 3300002932 Bacteria 35879
126 Ga0466705_200485 3300042612 Unclassified 1799
127 Ga0562379_0092 3300056790 Bacteria 317609
128 Ga0562376_1491 3300056857 Bacteria 32420
129 Ga0123353_10192061 3300010167 Bacteria 3222
130 Ga0123353_10281440 3300010167 Bacteria 2554
131 Ga0123354_10099953 3300010882 Bacteria 3931
132 Ga0466690_228009 3300042590 Bacteria 19764
133 Ga0466696_230481 3300042596 Bacteria 1898
134 Ga0466701_026006 3300042598 Unclassified 6841
135 Ga0466706_073876 3300042599 Unclassified 2227
136 Ga0466706_187731 3300042599 Unclassified 2163
137 Ga0466707_082474 3300042601 Bacteria 105318
138 Ga0466707_251332 3300042601 Bacteria 2550
139 Ga0466713_031365 3300042602 Bacteria 59157
140 Ga0466713_153447 3300042602 Bacteria 13421
141 Ga0466728_031879 3300042620 Bacteria 15219
142 Ga0466729_112245 3300042621 Bacteria 1461
143 Ga0466703_112682 3300042636 Bacteria 2845
144 Ga0466704_140761 3300042643 Bacteria 2269
145 Ga0466708_160938 3300042652 Bacteria 18767
146 Ga0466708_263298 3300042652 Bacteria 3342
147 2227216900 2225789004 Bacteria 7544
148 IMNBL1DRAFT_c0000279 3300000062 Bacteria 45201
149 IMNBL1DRAFT_c0003141 3300000062 Bacteria 10863
150 IMNBL1DRAFT_c0018989 3300000062 Bacteria 2834
151 Ga0562378_0319 3300056814 Unclassified 98233
152 Ga0562377_0019 3300056842 Bacteria 1067000
153 Ga0562377_1124 3300056842 Unclassified 31714
154 Ga0562375_0246 3300056856 Bacteria 147023
155 Ga0123356_10002404 3300010049 Bacteria 20028
156 Ga0123356_10116479 3300010049 Bacteria 2591
157 Ga0466657_084129 3300042582 Bacteria 1168
158 Ga0466693_193542 3300042592 Bacteria 34341
159 Ga0466706_114772 3300042599 Bacteria 128005
160 Ga0466707_158334 3300042601 Unclassified 4514
161 Ga0466719_039820 3300042606 Bacteria 14410
162 Ga0466719_300269 3300042606 Unclassified 1637
163 Ga0466715_039313 3300042616 Unclassified 1452
164 Ga0466715_069337 3300042616 Bacteria 68642
165 Ga0466715_410276 3300042616 Bacteria 7544
166 Ga0466715_421137 3300042616 Bacteria 6577
167 Ga0466715_544192 3300042616 Bacteria 15210
168 Ga0466729_065657 3300042621 Bacteria 2514
169 Ga0466709_388758 3300042648 Bacteria 19307
170 Ga0466727_324265 3300042655 Bacteria 57686
171 2227164124 2225789004 Bacteria 35807
172 2227594658 2225789004 Unclassified 2390
173 Ga0466697_192316 3300042611 Bacteria 2090
174 Ga0562378_0194 3300056814 Unclassified 147808
175 Ga0123353_10152499 3300010167 Bacteria 3687
176 Ga0123353_10387770 3300010167 Bacteria 2086
177 Ga0466706_082465 3300042599 Bacteria 9059
178 Ga0466706_238760 3300042599 Bacteria 1259
179 Ga0466700_095378 3300042600 Bacteria 87403
180 Ga0466722_107639 3300042609 Bacteria 2691
181 Ga0466726_262297 3300042619 Bacteria 2845
182 Ga0466728_289962 3300042620 Bacteria 4108
183 Ga0466729_200622 3300042621 Bacteria 6737
184 Ga0466702_064902 3300042635 Bacteria 1491
185 Ga0466703_416198 3300042636 Bacteria 1688
186 Ga0466704_066201 3300042643 Bacteria 6856
187 Ga0466727_085753 3300042655 Bacteria 33439
188 2227117225 2225789004 Bacteria 1717
189 IMNBL1DRAFT_c0001261 3300000062 Bacteria 19129
190 IMNBL1DRAFT_c0001395 3300000062 Bacteria 18166
191 IMNBL1DRAFT_c0003046 3300000062 Bacteria 11065

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042582 Ga0466657_084129 Ga0466657_084129_14_985 323
2 3300042599 Ga0466706_238760 Ga0466706_238760_15_1055 346
3 3300000062 IMNBL1DRAFT_c0005340 IMNBL1DRAFT_00053403 353
4 3300042599 Ga0466706_178990 Ga0466706_178990_289_1419 354
5 3300042599 Ga0466706_114772 Ga0466706_114772_35842_36981 355
6 3300042616 Ga0466715_039313 Ga0466715_039313_35_1135 355
7 3300010167 Ga0123353_10022447 Ga0123353_100224476 356
8 3300042599 Ga0466706_073876 Ga0466706_073876_204_1343 356
9 3300042599 Ga0466706_187731 Ga0466706_187731_177_1316 356
10 3300042599 Ga0466706_239732 Ga0466706_239732_183_1256 357
11 3300042594 Ga0466694_218773 Ga0466694_218773_314_1393 359
12 3300042607 Ga0466720_225102 Ga0466720_225102_750_1829 359
13 3300042616 Ga0466715_069337 Ga0466715_069337_45706_46869 359
14 3300042616 Ga0466715_089002 Ga0466715_089002_373_1506 360
15 3300042635 Ga0466702_064902 Ga0466702_064902_22_1104 360
16 2225789003 2227065804 2227422986 361
17 2225789004 2227441900 2227880014 361
18 3300042591 Ga0466692_006717 Ga0466692_006717_2409_3494 361
19 3300042600 Ga0466700_095378 Ga0466700_095378_59946_61031 361
20 iso_pr_bacteria 647533136 647746814 361
21 3300000062 IMNBL1DRAFT_c0000494 IMNBL1DRAFT_00004947 362
22 3300010167 Ga0123353_10200622 Ga0123353_102006224 363
23 3300042599 Ga0466706_148168 Ga0466706_148168_314_1480 363
24 3300042612 Ga0466705_498231 Ga0466705_498231_530_1669 363
25 3300000062 IMNBL1DRAFT_c0003141 IMNBL1DRAFT_00031416 364
26 3300042598 Ga0466701_026006 Ga0466701_026006_5643_6797 364
27 3300042601 Ga0466707_327485 Ga0466707_327485_756_1850 364
28 3300010167 Ga0123353_10198247 Ga0123353_101982472 365
29 3300042599 Ga0466706_279758 Ga0466706_279758_13326_14465 365
30 3300002450 JGI24695J34938_10000062 JGI24695J34938_1000006253 366
31 3300042616 Ga0466715_544192 Ga0466715_544192_6091_7191 366
32 3300042619 Ga0466726_262297 Ga0466726_262297_1731_2831 366
33 3300042619 Ga0466726_265603 Ga0466726_265603_15_1115 366
34 3300000062 IMNBL1DRAFT_c0003046 IMNBL1DRAFT_00030466 367
35 3300010167 Ga0123353_10281440 Ga0123353_102814403 368
36 3300042601 Ga0466707_158334 Ga0466707_158334_1726_2877 368
37 3300042601 Ga0466707_199301 Ga0466707_199301_566_1717 368
38 3300042601 Ga0466707_251332 Ga0466707_251332_130_1281 368
39 3300042601 Ga0466707_277438 Ga0466707_277438_1438_2589 368
40 iso_pr_bacteria 2820724199 2820724395 368
41 3300005201 Ga0072941_1021705 Ga0072941_102170525 369
42 3300010049 Ga0123356_10545664 Ga0123356_105456641 369
43 3300042620 Ga0466728_080658 Ga0466728_080658_1396_2568 369
44 iso_pr_bacteria 2873595552 2873596470 369
45 2225789004 2227216900 2227647713 370
46 3300000062 IMNBL1DRAFT_c0000088 IMNBL1DRAFT_000008828 370
47 3300042599 Ga0466706_096162 Ga0466706_096162_25167_26279 370
48 3300042606 Ga0466719_210722 Ga0466719_210722_1026_2174 370
49 iso_pr_bacteria 2873593402 2873594073 370
50 iso_pr_bacteria 2873597894 2873599731 370
51 iso_pr_bacteria 2940218408 2940221311 370
52 iso_pr_bacteria 2940261461 2940264367 370
53 2225789004 2227521857 2228026042 371
54 2225789004 2227560733 2228097343 371
55 2225789004 2227594658 2228156603 371
56 3300042659 Ga0466733_167157 Ga0466733_167157_10387_11502 371
57 3300042659 Ga0466733_174911 Ga0466733_174911_9717_10832 371
58 3300056790 Ga0562379_0092 Ga0562379_0092_62036_63151 371
59 3300056790 Ga0562379_0698 Ga0562379_0698_20733_21848 371
60 3300056814 Ga0562378_0194 Ga0562378_0194_30323_31438 371
61 3300056856 Ga0562375_0018 Ga0562375_0018_253251_254366 371
62 3300056856 Ga0562375_0036 Ga0562375_0036_47828_48943 371
63 3300056856 Ga0562375_0046 Ga0562375_0046_244668_245783 371
64 3300056857 Ga0562376_1362 Ga0562376_1362_10975_12090 371
65 iso_pr_bacteria 2740892556 2743948487 371
66 iso_pr_bacteria 2775507073 2777019226 371
67 iso_pr_bacteria 2825804107 2825805126 371
68 iso_pr_bacteria 8007220153 8007223051 371
69 iso_pr_bacteria 8007237282 8007240120 371
70 iso_pr_bacteria 8012939035 8012941572 371
71 iso_pr_bacteria 8018794549 8018794577 371
72 iso_pr_bacteria 8018798118 8018801141 371
73 iso_pr_bacteria 8018802046 8018802071 371
74 iso_pr_bacteria 8030337018 8030339178 371
75 iso_pr_bacteria 8038268975 8038269445 371
76 iso_pr_bacteria 8077780672 8077783474 371
77 iso_pr_bacteria 8108568626 8108571716 371
78 iso_pr_bacteria 8108576847 8108577668 371
79 iso_pr_bacteria 8114537524 8114537617 371
80 iso_pr_bacteria 8114541043 8114542251 371
81 iso_pr_bacteria 8114549044 8114549865 371
82 iso_pr_bacteria 8114555646 8114558736 371
83 3300000062 IMNBL1DRAFT_c0003559 IMNBL1DRAFT_00035598 372
84 3300002932 CVPL010L_1000134 CVPL010L_10001347 372
85 3300042616 Ga0466715_425272 Ga0466715_425272_444_1622 372
86 3300042616 Ga0466715_443438 Ga0466715_443438_140_1318 372
87 3300056814 Ga0562378_0319 Ga0562378_0319_13177_14295 372
88 3300057007 Ga0562374_0062 Ga0562374_0062_87084_88202 372
89 3300042601 Ga0466707_082474 Ga0466707_082474_34585_35706 373
90 3300042612 Ga0466705_036513 Ga0466705_036513_85028_86149 373
91 3300042612 Ga0466705_105365 Ga0466705_105365_402_1580 373
92 3300042616 Ga0466715_066943 Ga0466715_066943_831_1994 373
93 3300042616 Ga0466715_187894 Ga0466715_187894_1874_2995 373
94 3300042618 Ga0466723_002342 Ga0466723_002342_13968_15131 373
95 3300042618 Ga0466723_172507 Ga0466723_172507_909_2057 373
96 3300042643 Ga0466704_066201 Ga0466704_066201_4306_5484 373
97 3300056842 Ga0562377_0028 Ga0562377_0028_358587_359708 373
98 3300056842 Ga0562377_1124 Ga0562377_1124_6098_7219 373
99 3300056856 Ga0562375_0246 Ga0562375_0246_143490_144611 373
100 3300056857 Ga0562376_0072 Ga0562376_0072_145812_146933 373
101 iso_pr_bacteria 2622736579 2623393713 373
102 iso_pr_bacteria 2997944163 2997944290 373
103 iso_pr_bacteria 8002299145 8002300627 373
104 iso_pr_bacteria 8012939035 8012940427 373
105 3300042599 Ga0466706_082465 Ga0466706_082465_6735_7859 374
106 3300042610 Ga0466698_107959 Ga0466698_107959_4046_5170 374
107 3300042620 Ga0466728_031879 Ga0466728_031879_11843_12991 374
108 3300056842 Ga0562377_0019 Ga0562377_0019_976021_977145 374
109 3300056857 Ga0562376_1491 Ga0562376_1491_26616_27740 374
110 iso_pr_bacteria 2902668162 2902671429 374
111 iso_pr_bacteria 8030343600 8030344892 374
112 2225789004 2227164124 2227575088 375
113 3300042600 Ga0466700_136144 Ga0466700_136144_305_1459 375
114 3300042606 Ga0466719_300269 Ga0466719_300269_346_1509 375
115 3300042616 Ga0466715_631927 Ga0466715_631927_551_1714 375
116 3300042619 Ga0466726_350669 Ga0466726_350669_847_2010 375
117 3300042652 Ga0466708_263298 Ga0466708_263298_1804_2982 375
118 3300000062 IMNBL1DRAFT_c0011238 IMNBL1DRAFT_00112382 376
119 3300005201 Ga0072941_1070834 Ga0072941_10708345 376
120 3300042612 Ga0466705_022437 Ga0466705_022437_17670_18800 376
121 3300042612 Ga0466705_112590 Ga0466705_112590_3396_4559 376
122 3300042612 Ga0466705_200485 Ga0466705_200485_301_1464 376
123 3300042620 Ga0466728_289962 Ga0466728_289962_416_1579 376
124 3300042621 Ga0466729_253864 Ga0466729_253864_8182_9342 376
125 3300042643 Ga0466704_069001 Ga0466704_069001_2884_4014 376
126 3300042655 Ga0466727_324265 Ga0466727_324265_14941_16071 376
127 3300042612 Ga0466705_390387 Ga0466705_390387_2936_4069 377
128 3300042616 Ga0466715_410276 Ga0466715_410276_5421_6554 377
129 3300042655 Ga0466727_085753 Ga0466727_085753_22003_23136 377
130 iso_pr_bacteria 8030337018 8030339006 377
131 2225789004 2227535733 2228052628 378
132 3300002450 JGI24695J34938_10000019 JGI24695J34938_1000001936 378
133 3300010167 Ga0123353_10179603 Ga0123353_101796032 378
134 3300042601 Ga0466707_322802 Ga0466707_322802_3018_4154 378
135 3300042616 Ga0466715_081391 Ga0466715_081391_5083_6219 378
136 3300042648 Ga0466709_115669 Ga0466709_115669_147633_148769 378
137 iso_pr_bacteria 2940230426 2940232806 378
138 iso_pr_bacteria 2940233634 2940235921 378
139 iso_pr_bacteria 2940277027 2940279921 378
140 iso_pr_bacteria 2940280053 2940283148 378
141 iso_pr_bacteria 2940283334 2940285696 378
142 iso_pr_bacteria 2940286528 2940287737 378
143 iso_pr_bacteria 2940289514 2940290715 378
144 iso_pr_bacteria 2940292506 2940293861 378
145 iso_pr_bacteria 2940295490 2940298413 378
146 iso_pr_bacteria 2944625312 2944626516 378
147 3300042599 Ga0466706_226886 Ga0466706_226886_1935_3074 379
148 3300042613 Ga0466710_331981 Ga0466710_331981_866_2005 379
149 3300042616 Ga0466715_139954 Ga0466715_139954_20841_21980 379
150 3300042636 Ga0466703_416198 Ga0466703_416198_231_1421 379
151 3300042648 Ga0466709_388758 Ga0466709_388758_11828_12967 379
152 2225789004 2227499619 2227980663 380
153 3300000062 IMNBL1DRAFT_c0001395 IMNBL1DRAFT_000139514 380
154 3300010167 Ga0123353_10534880 Ga0123353_105348801 380
155 3300042599 Ga0466706_011267 Ga0466706_011267_454_1596 380
156 3300042599 Ga0466706_077725 Ga0466706_077725_147_1289 380
157 iso_pr_bacteria 2503904012 2503956591 380
158 2225789004 2227513830 2228010824 381
159 3300000062 IMNBL1DRAFT_c0001261 IMNBL1DRAFT_000126112 381
160 3300000062 IMNBL1DRAFT_c0005865 IMNBL1DRAFT_00058653 381
161 3300002450 JGI24695J34938_10041197 JGI24695J34938_100411972 381
162 iso_pr_bacteria 2781125638 2781283406 381
163 iso_pr_bacteria 2781125642 2781291828 381
164 2225789004 2227117225 2227508733 382
165 3300002450 JGI24695J34938_10000156 JGI24695J34938_1000015639 382
166 3300002450 JGI24695J34938_10000171 JGI24695J34938_1000017138 382
167 3300002450 JGI24695J34938_10000627 JGI24695J34938_100006278 382
168 3300002450 JGI24695J34938_10001218 JGI24695J34938_1000121813 382
169 3300002450 JGI24695J34938_10017744 JGI24695J34938_100177442 382
170 3300010167 Ga0123353_10192061 Ga0123353_101920613 382
171 3300042609 Ga0466722_259936 Ga0466722_259936_2670_3818 382
172 3300042636 Ga0466703_052208 Ga0466703_052208_2716_3864 382
173 3300042636 Ga0466703_234264 Ga0466703_234264_3474_4622 382
174 iso_pr_bacteria 2781125651 2781310531 382
175 3300002450 JGI24695J34938_10014115 JGI24695J34938_100141152 383
176 3300042602 Ga0466713_023787 Ga0466713_023787_2486_3637 383
177 3300042611 Ga0466697_192316 Ga0466697_192316_826_1977 383
178 3300042635 Ga0466702_044671 Ga0466702_044671_84222_85373 383
179 3300042636 Ga0466703_112682 Ga0466703_112682_1487_2638 383
180 3300010049 Ga0123356_10116479 Ga0123356_101164794 384
181 3300010167 Ga0123353_10049068 Ga0123353_100490686 384
182 3300042592 Ga0466693_193542 Ga0466693_193542_1025_2179 384
183 3300042601 Ga0466707_247224 Ga0466707_247224_83686_84840 384
184 3300042649 Ga0466724_62505 Ga0466724_62505_1000_2154 384
185 iso_pr_bacteria 2781125636 2781279350 384
186 iso_pr_bacteria 2781125646 2781300338 384
187 iso_pr_bacteria 2820389254 2820390576 384
188 3300002450 JGI24695J34938_10001767 JGI24695J34938_100017677 385
189 3300002450 JGI24695J34938_10008981 JGI24695J34938_100089812 385
190 3300042596 Ga0466696_215628 Ga0466696_215628_18364_19521 385
191 3300042596 Ga0466696_230481 Ga0466696_230481_623_1780 385
192 3300042597 Ga0466699_173997 Ga0466699_173997_623_1780 385
193 3300042606 Ga0466719_039820 Ga0466719_039820_1127_2284 385
194 3300042606 Ga0466719_207422 Ga0466719_207422_587_1744 385
195 3300042609 Ga0466722_107639 Ga0466722_107639_1265_2422 385
196 3300042652 Ga0466708_227476 Ga0466708_227476_102_1259 385
197 iso_pr_bacteria 2989309576 2989311087 385
198 iso_pr_bacteria 651324002 651580822 385
199 3300010167 Ga0123353_10387770 Ga0123353_103877703 386
200 3300042599 Ga0466706_082743 Ga0466706_082743_2019_3179 386
201 3300000062 IMNBL1DRAFT_c0001728 IMNBL1DRAFT_00017285 387
202 3300002462 JGI24702J35022_10005550 JGI24702J35022_100055503 387
203 3300042599 Ga0466706_082350 Ga0466706_082350_1296_2459 387
204 3300042602 Ga0466713_153447 Ga0466713_153447_3772_4935 387
205 3300042606 Ga0466719_014220 Ga0466719_014220_4467_5630 387
206 3300042616 Ga0466715_036720 Ga0466715_036720_1350_2513 387
207 3300042616 Ga0466715_421137 Ga0466715_421137_1654_2817 387
208 3300042643 Ga0466704_140761 Ga0466704_140761_572_1735 387
209 3300042648 Ga0466709_039865 Ga0466709_039865_17835_18998 387
210 3300042652 Ga0466708_160938 Ga0466708_160938_17249_18412 387
211 3300010167 Ga0123353_10152499 Ga0123353_101524992 389
212 3300042597 Ga0466699_434484 Ga0466699_434484_5754_6923 389
213 3300042618 Ga0466723_338813 Ga0466723_338813_11680_12849 389
214 3300010167 Ga0123353_10041013 Ga0123353_100410135 390
215 3300042590 Ga0466690_228009 Ga0466690_228009_635_1807 390
216 3300042635 Ga0466702_057005 Ga0466702_057005_1108_2280 390
217 3300042636 Ga0466703_216974 Ga0466703_216974_340_1569 390
218 3300042652 Ga0466708_062403 Ga0466708_062403_20102_21274 390
219 3300042652 Ga0466708_364886 Ga0466708_364886_10125_11315 390
220 3300000062 IMNBL1DRAFT_c0018989 IMNBL1DRAFT_00189892 391
221 3300010882 Ga0123354_10099953 Ga0123354_100999533 391
222 3300002450 JGI24695J34938_10008306 JGI24695J34938_100083065 392
223 3300042597 Ga0466699_306516 Ga0466699_306516_470_1648 392
224 3300042602 Ga0466713_031365 Ga0466713_031365_31366_32544 392
225 3300042592 Ga0466693_176126 Ga0466693_176126_3298_4479 393
226 3300042612 Ga0466705_303992 Ga0466705_303992_1412_2593 393
227 3300042643 Ga0466704_613443 Ga0466704_613443_1454_2635 393
228 3300042616 Ga0466715_113254 Ga0466715_113254_42918_44108 396
229 iso_pr_bacteria 2820727601 2820728695 396
230 3300042621 Ga0466729_065657 Ga0466729_065657_1300_2496 398
231 3300042621 Ga0466729_112245 Ga0466729_112245_43_1242 399
232 3300000062 IMNBL1DRAFT_c0000279 IMNBL1DRAFT_000027938 400
233 3300042593 Ga0466691_028626 Ga0466691_028626_6233_7438 401
234 3300010167 Ga0123353_10694521 Ga0123353_106945212 402
235 3300010167 Ga0123353_10167968 Ga0123353_101679684 404
236 3300042621 Ga0466729_200622 Ga0466729_200622_1694_2908 404
237 iso_pr_bacteria 2585428085 2587835416 404
238 3300042590 Ga0466690_087910 Ga0466690_087910_32080_33303 407
239 3300042600 Ga0466700_157938 Ga0466700_157938_787_2010 407
240 3300042603 Ga0466714_084203 Ga0466714_084203_784_2010 408
241 iso_pr_bacteria 2820367663 2820368499 408
242 3300042643 Ga0466704_555679 Ga0466704_555679_29910_31139 409
243 3300010049 Ga0123356_10251778 Ga0123356_102517782 410
244 3300042635 Ga0466702_026387 Ga0466702_026387_1355_2587 410
245 3300010049 Ga0123356_10002404 Ga0123356_1000240411 436

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03977 OAD_beta Na+-transporting oxaloacetate decarboxylase beta subunit 73 430 0.98

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.81 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.