Protein Family IF02648

Metagenome Isolate
181 Members
41 Samples
180 Scaffolds
330.96 Avg Length

🧬 Representative Sequence

ID
3300010049|Ga0123356_10002040|Ga0123356_1000204016
Length
376 aa
Sequence
MECFFEWYAKFYGYKVGLIALKWIRNLKCIFDKQASSQGNNLRETVVTMEQLAESHFKLLVSMAVGLVVLVGVIAVLIFFVAVKGAEQTMVPEVRGKDLTEALLELQAKELYPRIQLRYSQSSREKGQILEQDPRAGSIVKAGRQVRLVVSQGVMLNRVENYVGRYINDVRMDLQTFIASAGSPLLVLKEPLMYDFSAESPGTILRQKPEPGTDISGPVSLEFVVSRGPENTLMTVPQLAGLLLPAALEQLGRTDIVFEFFLREIREGERGEMVVYQEPPAGTSVTSNSIVTLVVNAPAQLGDNEVFKLFSYTIPRNPYPLPVRLEALLPSGERIRVIGIDYPGGKFTVPYRLPVGSILILSMMNREIYRETVRY*

📊 Sample Types

Isolate 0.6%
Metagenome 99.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 48.7%
Kalotermitidae 33.3%
Termopsidae 7.7%
Rhinotermitidae 5.1%
Unclassified 5.1%

🌳 Taxonomy

Archaea 1
Bacteria 176
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
2 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
3 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
4 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
5 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
6 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
7 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
8 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
9 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
10 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
11 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
12 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
13 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
14 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
15 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
16 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
17 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
18 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
19 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
20 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
21 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
22 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
23 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
24 2228664004 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T3b, from Florida USA Metagenome Termitidae
25 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
26 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
27 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
28 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
29 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
30 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
31 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
32 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
33 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
34 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
35 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
36 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
37 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
38 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
39 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
40 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
41 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 JGI24698J34947_10016205 3300002449 Bacteria 4047
2 JGI24695J34938_10001898 3300002450 Bacteria 16909
3 JGI24695J34938_10009375 3300002450 Bacteria 5448
4 Ga0072940_1012377 3300005200 Bacteria 4537
5 Ga0072941_1020691 3300005201 Bacteria 3154
6 Ga0466692_142303 3300042591 Bacteria 11124
7 Ga0466699_020661 3300042597 Bacteria 15510
8 Ga0466699_246505 3300042597 Bacteria 5467
9 Ga0466699_284827 3300042597 Bacteria 14833
10 Ga0466699_402495 3300042597 Bacteria 1102
11 Ga0466720_030398 3300042607 Bacteria 8380
12 Ga0466720_047027 3300042607 Bacteria 12219
13 Ga0466722_237965 3300042609 Bacteria 34947
14 Ga0466704_122002 3300042643 Bacteria 30457
15 Ga0466704_372601 3300042643 Bacteria 3303
16 Ga0466712_060583 3300042614 Bacteria 12544
17 Ga0466712_128666 3300042614 Bacteria 4277
18 Ga0466715_140735 3300042616 Bacteria 12507
19 Ga0466718_025580 3300042617 Bacteria 3087
20 Ga0466718_102936 3300042617 Bacteria 3220
21 Ga0466723_184630 3300042618 Bacteria 5689
22 Ga0466726_097154 3300042619 Bacteria 2843
23 Ga0123356_10050509 3300010049 Bacteria 3869
24 Ga0466705_197675 3300042612 Bacteria 7780
25 Ga0466732_169438 3300042656 Bacteria 8760
26 JGI24698J34947_10001666 3300002449 Bacteria 11857
27 JGI24698J34947_10007406 3300002449 Bacteria 6034
28 JGI24698J34947_10048594 3300002449 Bacteria 2148
29 JGI24695J34938_10038314 3300002450 Bacteria 2172
30 Ga0264413_109565 3300024493 Bacteria 11496
31 Ga0264413_113395 3300024493 Unclassified 11167
32 Ga0466693_293912 3300042592 Bacteria 55262
33 Ga0466694_003456 3300042594 Bacteria 20803
34 Ga0466694_251341 3300042594 Bacteria 19435
35 Ga0466699_121947 3300042597 Bacteria 2490
36 Ga0466699_130586 3300042597 Bacteria 14073
37 Ga0466699_147966 3300042597 Bacteria 13012
38 Ga0466700_193849 3300042600 Bacteria 35866
39 Ga0466700_306192 3300042600 Bacteria 1883
40 Ga0466719_124221 3300042606 Bacteria 6285
41 Ga0466719_297251 3300042606 Bacteria 8240
42 Ga0466720_192784 3300042607 Bacteria 2506
43 Ga0466735_056124 3300042624 Bacteria 19681
44 Ga0466702_397819 3300042635 Bacteria 6214
45 Ga0466712_070916 3300042614 Bacteria 20641
46 Ga0466712_217249 3300042614 Bacteria 27211
47 Ga0466711_056003 3300042615 Bacteria 26561
48 Ga0466711_080435 3300042615 Bacteria 15828
49 Ga0466718_023816 3300042617 Bacteria 1516
50 Ga0466718_068555 3300042617 Bacteria 2844
51 Ga0466728_106856 3300042620 Bacteria 4066
52 Ga0466732_119877 3300042656 Bacteria 14151
53 AustNasuHG_c1001886 3300000089 Bacteria 7557
54 JGI24698J34947_10028573 3300002449 Bacteria 2952
55 JGI24698J34947_10037925 3300002449 Bacteria 2502
56 JGI24695J34938_10000152 3300002450 Bacteria 63361
57 JGI24695J34938_10019377 3300002450 Bacteria 3374
58 Ga0072940_1008788 3300005200 Bacteria 12159
59 Ga0264413_108708 3300024493 Bacteria 3993
60 Ga0264413_112101 3300024493 Bacteria 5161
61 Ga0264413_118425 3300024493 Bacteria 3498
62 Ga0466692_027843 3300042591 Bacteria 5851
63 Ga0466694_050440 3300042594 Bacteria 148325
64 Ga0466696_271238 3300042596 Bacteria 2575
65 Ga0466699_094667 3300042597 Bacteria 5557
66 Ga0466699_140170 3300042597 Bacteria 7515
67 Ga0466699_209802 3300042597 Bacteria 4825
68 Ga0466699_229331 3300042597 Bacteria 37974
69 Ga0466700_238974 3300042600 Bacteria 1449
70 Ga0466707_082114 3300042601 Bacteria 3689
71 Ga0466716_455715 3300042605 Bacteria 3435
72 Ga0466720_130422 3300042607 Bacteria 5776
73 Ga0466720_210159 3300042607 Bacteria 13825
74 Ga0466722_262265 3300042609 Bacteria 11596
75 Ga0466708_176927 3300042652 Bacteria 2178
76 Ga0466712_267664 3300042614 Bacteria 1851
77 Ga0466712_304258 3300042614 Bacteria 4166
78 Ga0466715_179417 3300042616 Bacteria 1511
79 Ga0466715_204009 3300042616 Bacteria 3321
80 Ga0466723_127591 3300042618 Bacteria 10587
81 Ga0466705_003950 3300042612 Bacteria 6908
82 Ga0466732_298068 3300042656 Bacteria 8109
83 AustNasuHG_c1000242 3300000089 Bacteria 18428
84 AustNasuHG_c1002550 3300000089 Bacteria 6586
85 JGI24698J34947_10032481 3300002449 Bacteria 2740
86 JGI24698J34947_10072492 3300002449 Unclassified 1648
87 JGI24695J34938_10051615 3300002450 Bacteria 1798
88 JGI24695J34938_10079971 3300002450 Bacteria 1351
89 Ga0072941_1000579 3300005201 Bacteria 109731
90 Ga0072941_1141036 3300005201 Bacteria 3420
91 Ga0264413_123022 3300024493 Unclassified 2173
92 Ga0466690_053982 3300042590 Bacteria 6284
93 Ga0466690_073996 3300042590 Bacteria 7817
94 Ga0466694_136825 3300042594 Bacteria 22203
95 Ga0466696_378564 3300042596 Bacteria 2739
96 Ga0466699_070155 3300042597 Bacteria 13589
97 Ga0466699_216175 3300042597 Bacteria 4816
98 Ga0466719_132315 3300042606 Bacteria 14338
99 Ga0466719_146226 3300042606 Bacteria 1692
100 Ga0466720_115436 3300042607 Bacteria 52557
101 Ga0466704_231113 3300042643 Bacteria 17132
102 Ga0466709_090791 3300042648 Bacteria 4697
103 Ga0466708_346153 3300042652 Bacteria 2956
104 Ga0466712_113995 3300042614 Bacteria 6907
105 Ga0466712_142458 3300042614 Bacteria 2290
106 Ga0466718_044945 3300042617 Bacteria 6992
107 Ga0123353_10172411 3300010167 Bacteria 3433
108 JGI24698J34947_10002531 3300002449 Bacteria 9862
109 JGI24698J34947_10012323 3300002449 Bacteria 4686
110 JGI24695J34938_10005404 3300002450 Bacteria 7979
111 Ga0072941_1014408 3300005201 Bacteria 13384
112 Ga0264413_113668 3300024493 Bacteria 13305
113 Ga0466694_333017 3300042594 Bacteria 9653
114 Ga0466699_420987 3300042597 Bacteria 4811
115 Ga0466716_164561 3300042605 Bacteria 8480
116 Ga0466716_371982 3300042605 Bacteria 2332
117 Ga0466712_008289 3300042614 Bacteria 3001
118 Ga0466712_187252 3300042614 Bacteria 1788
119 Ga0466715_133299 3300042616 Bacteria 4597
120 Ga0466718_011064 3300042617 Bacteria 26269
121 Ga0466718_129403 3300042617 Bacteria 6886
122 Ga0466718_143186 3300042617 Bacteria 1291
123 Ga0123353_10022188 3300010167 Bacteria 9560
124 JGI24698J34947_10029901 3300002449 Bacteria 2875
125 JGI24699J35502_11133970 3300002509 Bacteria 21986
126 Ga0072941_1001475 3300005201 Bacteria 8505
127 Ga0466699_069552 3300042597 Bacteria 2132
128 Ga0466699_143168 3300042597 Bacteria 5869
129 Ga0466699_210403 3300042597 Bacteria 9117
130 Ga0466699_331651 3300042597 Bacteria 2729
131 Ga0466722_157352 3300042609 Bacteria 3033
132 Ga0466727_209892 3300042655 Bacteria 1189
133 Ga0466712_003200 3300042614 Bacteria 27121
134 Ga0466712_045972 3300042614 Bacteria 9356
135 Ga0466712_093655 3300042614 Bacteria 3396
136 Ga0466712_281667 3300042614 Bacteria 12480
137 Ga0466715_466067 3300042616 Bacteria 4736
138 Ga0466723_088505 3300042618 Bacteria 4146
139 Ga0466726_100519 3300042619 Bacteria 10669
140 Ga0466728_070889 3300042620 Bacteria 2622
141 Ga0123356_10001687 3300010049 Bacteria 24179
142 Ga0123356_10136623 3300010049 Bacteria 2411
143 2230969605 2228664004 Bacteria 12738
144 JGI24698J34947_10003440 3300002449 Bacteria 8585
145 JGI24698J34947_10027764 3300002449 Unclassified 3002
146 JGI24698J34947_10028438 3300002449 Bacteria 2959
147 Ga0264413_121503 3300024493 Bacteria 4129
148 Ga0415639_052413 3300038395 Bacteria 5568
149 Ga0466692_067795 3300042591 Bacteria 3741
150 Ga0466692_072476 3300042591 Bacteria 16646
151 Ga0466691_066370 3300042593 Bacteria 2027
152 Ga0466694_005539 3300042594 Bacteria 2172
153 Ga0466694_212057 3300042594 Bacteria 2743
154 Ga0466699_048393 3300042597 Bacteria 18418
155 Ga0466699_440887 3300042597 Bacteria 6318
156 Ga0466716_281805 3300042605 Bacteria 3817
157 Ga0466698_083770 3300042610 Bacteria 10096
158 Ga0466735_017006 3300042624 Bacteria 2185
159 Ga0466702_113325 3300042635 Bacteria 20618
160 Ga0466704_372461 3300042643 Bacteria 3878
161 Ga0466727_003423 3300042655 Bacteria 1226
162 Ga0466718_039200 3300042617 Bacteria 3013
163 Ga0466718_095604 3300042617 Bacteria 3092
164 Ga0466718_147364 3300042617 Bacteria 21998
165 Ga0466723_180975 3300042618 Bacteria 8729
166 Ga0123356_10002040 3300010049 Bacteria 21761
167 Ga0466705_157760 3300042612 Bacteria 4174
168 JGI24698J34947_10008212 3300002449 Bacteria 5727
169 JGI24698J34947_10070133 3300002449 Bacteria 1689
170 Ga0466691_216333 3300042593 Bacteria 2456
171 Ga0466720_203446 3300042607 Bacteria 6620
172 Ga0466709_323719 3300042648 Bacteria 2180
173 Ga0466712_049384 3300042614 Bacteria 5141
174 Ga0466712_122942 3300042614 Bacteria 4259
175 Ga0466718_063158 3300042617 Bacteria 5272
176 Ga0466723_047623 3300042618 Bacteria 4074
177 Ga0466726_075885 3300042619 Bacteria 8782
178 Ga0466728_300370 3300042620 Bacteria 4884
179 Ga0123353_10213051 3300010167 Bacteria 3028
180 Ga0123353_10533906 3300010167 Archaea 1697

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042597 Ga0466699_147966 Ga0466699_147966_1451_2386 280
2 3300024493 Ga0264413_121503 Ga0264413_1215032 288
3 3300042597 Ga0466699_440887 Ga0466699_440887_4683_5693 301
4 3300010167 Ga0123353_10022188 Ga0123353_100221883 302
5 3300002449 JGI24698J34947_10032481 JGI24698J34947_100324812 304
6 3300005201 Ga0072941_1000579 Ga0072941_100057967 304
7 3300042597 Ga0466699_069552 Ga0466699_069552_1197_2114 305
8 3300042597 Ga0466699_140170 Ga0466699_140170_4514_5530 307
9 3300042597 Ga0466699_246505 Ga0466699_246505_2910_3929 307
10 3300042617 Ga0466718_011064 Ga0466718_011064_19741_20769 308
11 3300024493 Ga0264413_118425 Ga0264413_1184255 309
12 3300042606 Ga0466719_132315 Ga0466719_132315_9130_10059 309
13 3300042607 Ga0466720_210159 Ga0466720_210159_7433_8458 309
14 3300042618 Ga0466723_047623 Ga0466723_047623_887_1816 309
15 3300042594 Ga0466694_212057 Ga0466694_212057_1469_2491 310
16 3300002449 JGI24698J34947_10037925 JGI24698J34947_100379253 311
17 3300024493 Ga0264413_113668 Ga0264413_1136688 311
18 3300042590 Ga0466690_073996 Ga0466690_073996_6280_7215 311
19 3300042597 Ga0466699_420987 Ga0466699_420987_1550_2563 311
20 3300042614 Ga0466712_060583 Ga0466712_060583_9570_10583 311
21 3300042656 Ga0466732_119877 Ga0466732_119877_3269_4297 311
22 3300002449 JGI24698J34947_10002531 JGI24698J34947_100025312 312
23 3300002449 JGI24698J34947_10007406 JGI24698J34947_100074066 312
24 3300002449 JGI24698J34947_10048594 JGI24698J34947_100485942 312
25 3300042607 Ga0466720_115436 Ga0466720_115436_33546_34556 312
26 3300005201 Ga0072941_1001475 Ga0072941_10014754 313
27 3300042614 Ga0466712_008289 Ga0466712_008289_660_1688 314
28 3300042614 Ga0466712_049384 Ga0466712_049384_1179_2204 314
29 3300002449 JGI24698J34947_10027764 JGI24698J34947_100277642 315
30 3300002449 JGI24698J34947_10072492 JGI24698J34947_100724921 315
31 3300042605 Ga0466716_371982 Ga0466716_371982_208_1155 315
32 3300042614 Ga0466712_142458 Ga0466712_142458_498_1526 315
33 3300042614 Ga0466712_281667 Ga0466712_281667_8519_9547 315
34 3300042607 Ga0466720_030398 Ga0466720_030398_2806_3807 316
35 3300042607 Ga0466720_130422 Ga0466720_130422_4609_5610 316
36 3300042607 Ga0466720_203446 Ga0466720_203446_2721_3752 316
37 3300042620 Ga0466728_300370 Ga0466728_300370_2060_3115 317
38 3300024493 Ga0264413_113395 Ga0264413_1133954 318
39 3300024493 Ga0264413_123022 Ga0264413_1230222 318
40 3300002449 JGI24698J34947_10008212 JGI24698J34947_100082125 319
41 3300002449 JGI24698J34947_10016205 JGI24698J34947_100162052 319
42 3300002449 JGI24698J34947_10029901 JGI24698J34947_100299013 319
43 3300042614 Ga0466712_113995 Ga0466712_113995_2026_3051 319
44 3300042615 Ga0466711_056003 Ga0466711_056003_2867_3826 319
45 3300002449 JGI24698J34947_10001666 JGI24698J34947_100016662 320
46 3300002449 JGI24698J34947_10003440 JGI24698J34947_100034406 320
47 3300002450 JGI24695J34938_10019377 JGI24695J34938_100193774 320
48 3300010049 Ga0123356_10136623 Ga0123356_101366232 320
49 3300042617 Ga0466718_143186 Ga0466718_143186_37_999 320
50 3300002449 JGI24698J34947_10028438 JGI24698J34947_100284384 321
51 3300002450 JGI24695J34938_10005404 JGI24695J34938_100054047 321
52 3300010167 Ga0123353_10213051 Ga0123353_102130513 321
53 3300042597 Ga0466699_402495 Ga0466699_402495_44_1054 321
54 3300042606 Ga0466719_146226 Ga0466719_146226_187_1224 321
55 3300042594 Ga0466694_136825 Ga0466694_136825_10104_11117 323
56 3300042607 Ga0466720_047027 Ga0466720_047027_11052_12053 323
57 3300002450 JGI24695J34938_10001898 JGI24695J34938_100018986 324
58 3300042614 Ga0466712_122942 Ga0466712_122942_2894_3919 324
59 3300042591 Ga0466692_067795 Ga0466692_067795_1456_2475 325
60 3300042597 Ga0466699_020661 Ga0466699_020661_3362_4339 325
61 3300042597 Ga0466699_048393 Ga0466699_048393_7795_8775 326
62 3300042597 Ga0466699_070155 Ga0466699_070155_5652_6632 326
63 3300042597 Ga0466699_331651 Ga0466699_331651_553_1533 326
64 3300002509 JGI24699J35502_11133970 JGI24699J35502_111339708 329
65 3300005201 Ga0072941_1020691 Ga0072941_10206912 329
66 3300010049 Ga0123356_10050509 Ga0123356_100505094 329
67 3300042605 Ga0466716_164561 Ga0466716_164561_5255_6250 331
68 3300042617 Ga0466718_044945 Ga0466718_044945_5697_6692 331
69 3300042618 Ga0466723_180975 Ga0466723_180975_7088_8083 331
70 3300042652 Ga0466708_346153 Ga0466708_346153_944_1939 331
71 3300042655 Ga0466727_003423 Ga0466727_003423_44_1039 331
72 3300042655 Ga0466727_209892 Ga0466727_209892_181_1176 331
73 3300042593 Ga0466691_066370 Ga0466691_066370_536_1534 332
74 3300042618 Ga0466723_127591 Ga0466723_127591_2797_3795 332
75 3300038395 Ga0415639_052413 Ga0415639_052413_2376_3377 333
76 3300042596 Ga0466696_271238 Ga0466696_271238_580_1581 333
77 3300042596 Ga0466696_378564 Ga0466696_378564_525_1526 333
78 3300042620 Ga0466728_070889 Ga0466728_070889_220_1221 333
79 3300042620 Ga0466728_106856 Ga0466728_106856_2174_3175 333
80 3300042594 Ga0466694_003456 Ga0466694_003456_13852_14856 334
81 3300042597 Ga0466699_229331 Ga0466699_229331_35344_36348 334
82 3300042617 Ga0466718_102936 Ga0466718_102936_640_1644 334
83 3300002450 JGI24695J34938_10079971 JGI24695J34938_100799712 335
84 3300024493 Ga0264413_108708 Ga0264413_1087083 335
85 3300042594 Ga0466694_333017 Ga0466694_333017_2252_3259 335
86 3300042597 Ga0466699_143168 Ga0466699_143168_3376_4383 335
87 3300042597 Ga0466699_216175 Ga0466699_216175_456_1463 335
88 3300042614 Ga0466712_070916 Ga0466712_070916_8493_9500 335
89 3300042614 Ga0466712_217249 Ga0466712_217249_9944_10951 335
90 3300042643 Ga0466704_372461 Ga0466704_372461_575_1582 335
91 3300042643 Ga0466704_372601 Ga0466704_372601_572_1579 335
92 3300010167 Ga0123353_10533906 Ga0123353_105339062 336
93 3300042594 Ga0466694_251341 Ga0466694_251341_4155_5165 336
94 3300042597 Ga0466699_210403 Ga0466699_210403_5253_6263 336
95 3300042600 Ga0466700_238974 Ga0466700_238974_37_1047 336
96 3300042609 Ga0466722_262265 Ga0466722_262265_3716_4753 336
97 3300042617 Ga0466718_023816 Ga0466718_023816_122_1132 336
98 3300042617 Ga0466718_147364 Ga0466718_147364_4203_5213 336
99 3300042656 Ga0466732_169438 Ga0466732_169438_5973_6983 336
100 3300002449 JGI24698J34947_10012323 JGI24698J34947_100123232 337
101 3300002449 JGI24698J34947_10028573 JGI24698J34947_100285732 337
102 3300002450 JGI24695J34938_10000152 JGI24695J34938_100001522 337
103 3300002450 JGI24695J34938_10038314 JGI24695J34938_100383142 337
104 3300002450 JGI24695J34938_10051615 JGI24695J34938_100516152 337
105 3300005201 Ga0072941_1141036 Ga0072941_11410362 337
106 3300042592 Ga0466693_293912 Ga0466693_293912_27511_28524 337
107 3300042594 Ga0466694_005539 Ga0466694_005539_610_1623 337
108 3300042594 Ga0466694_050440 Ga0466694_050440_88354_89367 337
109 3300042597 Ga0466699_121947 Ga0466699_121947_899_1912 337
110 3300042597 Ga0466699_130586 Ga0466699_130586_7977_8990 337
111 3300042600 Ga0466700_193849 Ga0466700_193849_5366_6379 337
112 3300042614 Ga0466712_045972 Ga0466712_045972_6640_7653 337
113 3300042614 Ga0466712_093655 Ga0466712_093655_1708_2721 337
114 3300042614 Ga0466712_128666 Ga0466712_128666_1872_2900 337
115 3300042614 Ga0466712_304258 Ga0466712_304258_2558_3571 337
116 3300042617 Ga0466718_068555 Ga0466718_068555_167_1180 337
117 3300042624 Ga0466735_017006 Ga0466735_017006_41_1054 337
118 2228664004 2230969605 2230682937 338
119 3300000089 AustNasuHG_c1000242 AustNasuHG_100024211 338
120 3300002449 JGI24698J34947_10070133 JGI24698J34947_100701332 338
121 3300002450 JGI24695J34938_10009375 JGI24695J34938_100093752 338
122 3300005201 Ga0072941_1014408 Ga0072941_101440811 338
123 3300024493 Ga0264413_112101 Ga0264413_1121015 338
124 3300042597 Ga0466699_094667 Ga0466699_094667_1816_2832 338
125 3300042597 Ga0466699_209802 Ga0466699_209802_1836_2852 338
126 3300042597 Ga0466699_284827 Ga0466699_284827_5241_6257 338
127 3300042607 Ga0466720_192784 Ga0466720_192784_608_1624 338
128 3300042609 Ga0466722_237965 Ga0466722_237965_32011_33027 338
129 3300042610 Ga0466698_083770 Ga0466698_083770_6545_7561 338
130 3300042617 Ga0466718_063158 Ga0466718_063158_3450_4466 338
131 3300042635 Ga0466702_397819 Ga0466702_397819_1856_2872 338
132 3300042656 Ga0466732_298068 Ga0466732_298068_1464_2480 338
133 3300000089 AustNasuHG_c1002550 AustNasuHG_10025503 339
134 3300005200 Ga0072940_1008788 Ga0072940_10087888 339
135 3300010049 Ga0123356_10001687 Ga0123356_100016875 339
136 3300010167 Ga0123353_10172411 Ga0123353_101724112 339
137 3300042590 Ga0466690_053982 Ga0466690_053982_1370_2389 339
138 3300042609 Ga0466722_157352 Ga0466722_157352_1175_2194 339
139 3300042617 Ga0466718_025580 Ga0466718_025580_600_1619 339
140 3300042617 Ga0466718_129403 Ga0466718_129403_3730_4749 339
141 3300042619 Ga0466726_075885 Ga0466726_075885_7497_8516 339
142 3300042635 Ga0466702_113325 Ga0466702_113325_10804_11823 339
143 3300042643 Ga0466704_122002 Ga0466704_122002_5316_6356 339
144 3300000089 AustNasuHG_c1001886 AustNasuHG_10018862 340
145 3300042605 Ga0466716_281805 Ga0466716_281805_2746_3768 340
146 3300042612 Ga0466705_197675 Ga0466705_197675_1884_2906 340
147 3300042617 Ga0466718_039200 Ga0466718_039200_1497_2519 340
148 3300042648 Ga0466709_090791 Ga0466709_090791_2477_3499 340
149 3300042648 Ga0466709_323719 Ga0466709_323719_343_1365 340
150 3300024493 Ga0264413_109565 Ga0264413_1095656 341
151 3300042614 Ga0466712_003200 Ga0466712_003200_2203_3228 341
152 3300042618 Ga0466723_184630 Ga0466723_184630_1926_2951 341
153 3300042591 Ga0466692_027843 Ga0466692_027843_2495_3523 342
154 3300042614 Ga0466712_267664 Ga0466712_267664_406_1512 342
155 3300042616 Ga0466715_466067 Ga0466715_466067_492_1565 344
156 3300042605 Ga0466716_455715 Ga0466716_455715_1699_2736 345
157 3300042617 Ga0466718_095604 Ga0466718_095604_1417_2454 345
158 3300005200 Ga0072940_1012377 Ga0072940_10123775 346
159 3300042600 Ga0466700_306192 Ga0466700_306192_15_1055 346
160 3300042615 Ga0466711_080435 Ga0466711_080435_12442_13482 346
161 3300042619 Ga0466726_097154 Ga0466726_097154_71_1114 347
162 3300042591 Ga0466692_072476 Ga0466692_072476_4088_5137 349
163 3300042591 Ga0466692_142303 Ga0466692_142303_7294_8343 349
164 3300042612 Ga0466705_157760 Ga0466705_157760_2995_4044 349
165 3300042614 Ga0466712_187252 Ga0466712_187252_168_1217 349
166 3300042601 Ga0466707_082114 Ga0466707_082114_2161_3213 350
167 3300042616 Ga0466715_140735 Ga0466715_140735_5805_6857 350
168 3300042624 Ga0466735_056124 Ga0466735_056124_10405_11457 350
169 3300042643 Ga0466704_231113 Ga0466704_231113_9196_10248 350
170 3300042652 Ga0466708_176927 Ga0466708_176927_658_1710 350
171 3300042593 Ga0466691_216333 Ga0466691_216333_343_1398 351
172 3300042606 Ga0466719_297251 Ga0466719_297251_5078_6133 351
173 3300042616 Ga0466715_133299 Ga0466715_133299_584_1639 351
174 3300042616 Ga0466715_179417 Ga0466715_179417_213_1268 351
175 3300042616 Ga0466715_204009 Ga0466715_204009_1565_2620 351
176 3300042606 Ga0466719_124221 Ga0466719_124221_4773_5831 352
177 3300042618 Ga0466723_088505 Ga0466723_088505_370_1428 352
178 3300042619 Ga0466726_100519 Ga0466726_100519_2335_3402 355
179 3300042612 Ga0466705_003950 Ga0466705_003950_4047_5120 357
180 iso_pr_bacteria 2781125692 2781431159 367
181 3300010049 Ga0123356_10002040 Ga0123356_1000204016 376

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03793 PASTA PASTA domain 91 152 0.95

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.55 0.65 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.