Protein Family IF02644

Metagenome Isolate
117 Members
44 Samples
112 Scaffolds
158.5 Avg Length

🧬 Representative Sequence

ID
3300010049|Ga0123356_10001693|Ga0123356_1000169311
Length
177 aa
Sequence
MNNVTINSDGLTLPFWNDSARGYALKVLDEIKRDNWELSILFCNDKKIKSLNFQYRNKNEPTDILSFNLGETVKKGNKNIYLPGDIVISLDSLSKNAVYFQIPEDEELRRLLIHGILHLDGMDHKTLEKDEPMLKLQEKILDKLKNEHIIPNGSLLQVDDDKKSKNGRKISCGGKK*

📊 Sample Types

Isolate 4.3%
Metagenome 95.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 45.2%
Kalotermitidae 28.6%
Unclassified 14.3%
Termopsidae 7.1%
Rhinotermitidae 4.8%

🌳 Taxonomy

Archaea 1
Bacteria 111
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
2 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
3 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
4 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
5 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
6 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
7 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
8 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
9 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
10 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
11 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
12 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
13 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
14 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
15 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
16 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
17 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
18 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
19 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
20 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
21 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
22 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
23 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
24 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
25 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
26 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
27 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
28 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
29 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
30 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
31 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
32 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
33 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
34 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
35 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
36 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
37 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
38 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
39 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
40 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
41 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
42 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
43 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
44 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0264413_100300 3300024493 Bacteria 12096
2 Ga0264413_100302 3300024493 Bacteria 69754
3 Ga0466692_034584 3300042591 Bacteria 3245
4 Ga0466694_107547 3300042594 Bacteria 58970
5 Ga0466712_236106 3300042614 Bacteria 16720
6 Ga0466712_238722 3300042614 Bacteria 6167
7 Ga0123356_10021798 3300010049 Bacteria 6048
8 JGI24698J34947_10001414 3300002449 Bacteria 12648
9 JGI24695J34938_10005409 3300002450 Bacteria 7974
10 Ga0072941_1029790 3300005201 Unclassified 7612
11 Ga0072941_1098071 3300005201 Unclassified 1326
12 Ga0466705_060729 3300042612 Bacteria 3766
13 Ga0466708_152059 3300042652 Bacteria 10876
14 Ga0466727_076396 3300042655 Bacteria 6778
15 Ga0466694_291943 3300042594 Bacteria 8665
16 Ga0466711_003790 3300042615 Bacteria 7700
17 Ga0466728_019949 3300042620 Bacteria 5259
18 Ga0466707_135275 3300042601 Bacteria 1178
19 Ga0466722_190855 3300042609 Bacteria 12564
20 Ga0123356_10647153 3300010049 Bacteria 1224
21 AustNasuHG_c1004855 3300000089 Bacteria 4812
22 JGI24695J34938_10000007 3300002450 Bacteria 136740
23 JGI24695J34938_10000845 3300002450 Bacteria 28392
24 JGI24695J34938_10290800 3300002450 Bacteria 703
25 Ga0466705_081715 3300042612 Bacteria 9301
26 Ga0466730_074865 3300042625 Bacteria 1834
27 Ga0415639_080491 3300038395 Bacteria 2403
28 Ga0466696_221437 3300042596 Bacteria 1012
29 Ga0466705_389024 3300042612 Bacteria 7110
30 Ga0466712_206377 3300042614 Bacteria 6019
31 Ga0466712_296161 3300042614 Bacteria 1510
32 Ga0466718_018769 3300042617 Bacteria 8038
33 Ga0466720_024075 3300042607 Bacteria 11745
34 Ga0466720_057580 3300042607 Bacteria 1720
35 Ga0466720_134623 3300042607 Bacteria 4113
36 Ga0123356_10086650 3300010049 Bacteria 2973
37 JGI24699J35502_10483800 3300002509 Bacteria 607
38 Ga0074263_115386 3300005485 Bacteria 3517
39 Ga0466735_042470 3300042624 Bacteria 3310
40 Ga0466735_206182 3300042624 Bacteria 16936
41 Ga0466703_300536 3300042636 Bacteria 1296
42 Ga0415639_031420 3300038395 Bacteria 11292
43 Ga0466693_197086 3300042592 Bacteria 15167
44 Ga0466712_081449 3300042614 Bacteria 5707
45 Ga0466715_285144 3300042616 Bacteria 11641
46 Ga0466715_540587 3300042616 Bacteria 1776
47 Ga0466718_006750 3300042617 Bacteria 7617
48 Ga0466718_149198 3300042617 Bacteria 1994
49 Ga0466716_404592 3300042605 Bacteria 1018
50 Ga0466720_088215 3300042607 Bacteria 2362
51 Ga0466721_022408 3300042608 Bacteria 34914
52 Ga0466722_050060 3300042609 Bacteria 6792
53 Ga0123356_10002085 3300010049 Bacteria 21580
54 Ga0123353_11823003 3300010167 Bacteria 755
55 AustNasuHG_c1034956 3300000089 Bacteria 1333
56 AustNasuHG_c1037225 3300000089 Bacteria 1247
57 JGI24695J34938_10000063 3300002450 Bacteria 87942
58 Ga0072941_1007233 3300005201 Unclassified 40154
59 Ga0466732_142729 3300042656 Bacteria 25250
60 Ga0466735_044213 3300042624 Bacteria 25121
61 Ga0466735_149400 3300042624 Bacteria 1459
62 Ga0466694_079165 3300042594 Bacteria 40053
63 Ga0466699_005857 3300042597 Bacteria 25238
64 Ga0466712_030931 3300042614 Unclassified 33192
65 Ga0466715_410633 3300042616 Bacteria 1696
66 Ga0466715_418438 3300042616 Bacteria 4530
67 Ga0466723_337651 3300042618 Bacteria 1171
68 Ga0466726_302572 3300042619 Bacteria 1466
69 Ga0466707_343731 3300042601 Bacteria 5926
70 Ga0466717_185909 3300042604 Bacteria 2846
71 Ga0072941_1169638 3300005201 Bacteria 2815
72 Ga0466703_277965 3300042636 Bacteria 4822
73 Ga0466704_511957 3300042643 Bacteria 10131
74 Ga0466709_415572 3300042648 Bacteria 11426
75 Ga0264413_100301 3300024493 Bacteria 19762
76 Ga0264413_135409 3300024493 Bacteria 1383
77 Ga0466691_032418 3300042593 Bacteria 11220
78 Ga0466696_032633 3300042596 Bacteria 26823
79 Ga0466712_299516 3300042614 Bacteria 3755
80 Ga0466711_242633 3300042615 Bacteria 9598
81 Ga0466715_173704 3300042616 Bacteria 8097
82 Ga0123356_10004092 3300010049 Bacteria 15152
83 JGI24698J34947_10001176 3300002449 Bacteria 13650
84 JGI24698J34947_10036068 3300002449 Bacteria 2576
85 JGI24695J34938_10000415 3300002450 Bacteria 41485
86 JGI24695J34938_10000446 3300002450 Bacteria 39944
87 Ga0072941_1007578 3300005201 Bacteria 12273
88 Ga0072941_1533495 3300005201 Bacteria 830
89 Ga0466691_140817 3300042593 Bacteria 1841
90 Ga0466711_471644 3300042615 Bacteria 39662
91 Ga0466718_013384 3300042617 Bacteria 8927
92 Ga0466718_134785 3300042617 Bacteria 4057
93 Ga0466720_139361 3300042607 Bacteria 5999
94 Ga0466722_014313 3300042609 Bacteria 18073
95 Ga0123356_10064385 3300010049 Bacteria 3428
96 Ga0072941_1113971 3300005201 Bacteria 3500
97 Ga0072941_1169639 3300005201 Bacteria 1504
98 Ga0466705_032048 3300042612 Bacteria 2295
99 Ga0466732_386355 3300042656 Bacteria 1042
100 Ga0466704_247802 3300042643 Bacteria 5063
101 Ga0415639_038796 3300038395 Bacteria 14366
102 Ga0466694_178924 3300042594 Bacteria 9363
103 Ga0466712_003382 3300042614 Bacteria 2569
104 Ga0466711_279255 3300042615 Bacteria 5812
105 Ga0466718_017986 3300042617 Unclassified 14314
106 Ga0466718_144179 3300042617 Archaea 1120
107 Ga0466700_292084 3300042600 Bacteria 1475
108 Ga0466707_047263 3300042601 Bacteria 18620
109 Ga0123356_10001693 3300010049 Bacteria 24130
110 Ga0123356_10592012 3300010049 Bacteria 1273
111 Ga0123353_10067080 3300010167 Bacteria 5761
112 Ga0072941_1040761 3300005201 Bacteria 8209

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042601 Ga0466707_135275 Ga0466707_135275_600_1040 146
2 3300010167 Ga0123353_10067080 Ga0123353_100670803 147
3 3300042593 Ga0466691_140817 Ga0466691_140817_714_1166 150
4 3300042612 Ga0466705_032048 Ga0466705_032048_864_1316 150
5 3300042616 Ga0466715_540587 Ga0466715_540587_472_924 150
6 3300042618 Ga0466723_337651 Ga0466723_337651_542_994 150
7 3300042601 Ga0466707_343731 Ga0466707_343731_3015_3470 151
8 3300042619 Ga0466726_302572 Ga0466726_302572_176_631 151
9 3300042624 Ga0466735_149400 Ga0466735_149400_144_599 151
10 3300042655 Ga0466727_076396 Ga0466727_076396_5426_5881 151
11 3300042597 Ga0466699_005857 Ga0466699_005857_18324_18782 152
12 3300042615 Ga0466711_242633 Ga0466711_242633_8959_9417 152
13 3300042615 Ga0466711_471644 Ga0466711_471644_21734_22192 152
14 3300042616 Ga0466715_410633 Ga0466715_410633_1187_1645 152
15 3300042615 Ga0466711_003790 Ga0466711_003790_3190_3654 154
16 3300042615 Ga0466711_279255 Ga0466711_279255_3437_3901 154
17 3300042616 Ga0466715_285144 Ga0466715_285144_3824_4288 154
18 3300042648 Ga0466709_415572 Ga0466709_415572_6323_6787 154
19 3300042607 Ga0466720_139361 Ga0466720_139361_3310_3777 155
20 3300042614 Ga0466712_030931 Ga0466712_030931_7135_7602 155
21 3300010049 Ga0123356_10086650 Ga0123356_100866502 156
22 3300010049 Ga0123356_10592012 Ga0123356_105920122 156
23 3300010049 Ga0123356_10647153 Ga0123356_106471532 156
24 3300038395 Ga0415639_031420 Ga0415639_031420_3398_3868 156
25 3300042594 Ga0466694_107547 Ga0466694_107547_45713_46183 156
26 3300042596 Ga0466696_032633 Ga0466696_032633_19676_20146 156
27 3300042614 Ga0466712_003382 Ga0466712_003382_683_1153 156
28 3300042614 Ga0466712_081449 Ga0466712_081449_4146_4616 156
29 3300042614 Ga0466712_206377 Ga0466712_206377_5049_5519 156
30 3300042614 Ga0466712_238722 Ga0466712_238722_5144_5614 156
31 3300042614 Ga0466712_296161 Ga0466712_296161_734_1204 156
32 3300042614 Ga0466712_299516 Ga0466712_299516_3099_3569 156
33 3300042625 Ga0466730_074865 Ga0466730_074865_71_541 156
34 3300042636 Ga0466703_277965 Ga0466703_277965_813_1283 156
35 iso_pr_bacteria 2781125663 2781337744 156
36 3300002449 JGI24698J34947_10001176 JGI24698J34947_100011765 157
37 3300002449 JGI24698J34947_10001414 JGI24698J34947_100014146 157
38 3300002449 JGI24698J34947_10036068 JGI24698J34947_100360682 157
39 3300002450 JGI24695J34938_10000446 JGI24695J34938_1000044610 157
40 3300002509 JGI24699J35502_10483800 JGI24699J35502_104838001 157
41 3300005201 Ga0072941_1007233 Ga0072941_10072336 157
42 3300005201 Ga0072941_1007578 Ga0072941_10075785 157
43 3300005201 Ga0072941_1029790 Ga0072941_10297903 157
44 3300005201 Ga0072941_1040761 Ga0072941_10407612 157
45 3300005201 Ga0072941_1098071 Ga0072941_10980712 157
46 3300005201 Ga0072941_1169638 Ga0072941_11696382 157
47 3300005201 Ga0072941_1169639 Ga0072941_11696392 157
48 3300010049 Ga0123356_10002085 Ga0123356_100020856 157
49 3300010049 Ga0123356_10004092 Ga0123356_100040925 157
50 3300010049 Ga0123356_10021798 Ga0123356_100217984 157
51 3300024493 Ga0264413_100300 Ga0264413_1003005 157
52 3300024493 Ga0264413_100301 Ga0264413_10030113 157
53 3300024493 Ga0264413_100302 Ga0264413_10030244 157
54 3300024493 Ga0264413_135409 Ga0264413_1354092 157
55 3300042592 Ga0466693_197086 Ga0466693_197086_11139_11612 157
56 3300042594 Ga0466694_079165 Ga0466694_079165_30972_31445 157
57 3300042594 Ga0466694_178924 Ga0466694_178924_8780_9253 157
58 3300042594 Ga0466694_291943 Ga0466694_291943_7441_7914 157
59 3300042596 Ga0466696_221437 Ga0466696_221437_498_971 157
60 3300042607 Ga0466720_024075 Ga0466720_024075_1866_2339 157
61 3300042607 Ga0466720_134623 Ga0466720_134623_593_1066 157
62 3300042609 Ga0466722_014313 Ga0466722_014313_9219_9692 157
63 3300042612 Ga0466705_060729 Ga0466705_060729_3004_3477 157
64 3300042612 Ga0466705_081715 Ga0466705_081715_7378_7851 157
65 3300042614 Ga0466712_236106 Ga0466712_236106_7081_7554 157
66 3300042617 Ga0466718_006750 Ga0466718_006750_7092_7565 157
67 3300042617 Ga0466718_013384 Ga0466718_013384_290_763 157
68 3300042617 Ga0466718_017986 Ga0466718_017986_9302_9775 157
69 3300042617 Ga0466718_018769 Ga0466718_018769_85_558 157
70 3300042617 Ga0466718_134785 Ga0466718_134785_85_558 157
71 3300042617 Ga0466718_149198 Ga0466718_149198_122_595 157
72 3300042620 Ga0466728_019949 Ga0466728_019949_3539_4012 157
73 3300042624 Ga0466735_044213 Ga0466735_044213_13250_13723 157
74 3300042636 Ga0466703_300536 Ga0466703_300536_597_1070 157
75 3300042643 Ga0466704_511957 Ga0466704_511957_1791_2264 157
76 3300042652 Ga0466708_152059 Ga0466708_152059_7701_8174 157
77 3300000089 AustNasuHG_c1004855 AustNasuHG_10048555 158
78 3300000089 AustNasuHG_c1034956 AustNasuHG_10349562 158
79 3300000089 AustNasuHG_c1037225 AustNasuHG_10372251 158
80 3300002450 JGI24695J34938_10000007 JGI24695J34938_1000000741 158
81 3300005201 Ga0072941_1113971 Ga0072941_11139713 158
82 3300005485 Ga0074263_115386 Ga0074263_1153862 158
83 3300042607 Ga0466720_057580 Ga0466720_057580_417_893 158
84 3300042616 Ga0466715_173704 Ga0466715_173704_3811_4287 158
85 iso_pr_bacteria 2781125634 2781273954 158
86 3300002450 JGI24695J34938_10290800 JGI24695J34938_102908001 159
87 3300038395 Ga0415639_038796 Ga0415639_038796_4072_4551 159
88 3300042624 Ga0466735_206182 Ga0466735_206182_11543_12052 159
89 3300042656 Ga0466732_142729 Ga0466732_142729_14086_14565 159
90 3300042656 Ga0466732_386355 Ga0466732_386355_182_661 159
91 3300042600 Ga0466700_292084 Ga0466700_292084_396_878 160
92 3300042609 Ga0466722_190855 Ga0466722_190855_8606_9088 160
93 3300042612 Ga0466705_389024 Ga0466705_389024_3561_4043 160
94 3300002450 JGI24695J34938_10000845 JGI24695J34938_1000084513 161
95 3300038395 Ga0415639_080491 Ga0415639_080491_384_869 161
96 3300042593 Ga0466691_032418 Ga0466691_032418_6702_7187 161
97 3300042604 Ga0466717_185909 Ga0466717_185909_1719_2204 161
98 3300042616 Ga0466715_418438 Ga0466715_418438_408_893 161
99 3300042643 Ga0466704_247802 Ga0466704_247802_1932_2417 161
100 3300042605 Ga0466716_404592 Ga0466716_404592_428_916 162
101 3300042617 Ga0466718_144179 Ga0466718_144179_141_629 162
102 3300005201 Ga0072941_1533495 Ga0072941_15334951 163
103 3300010167 Ga0123353_11823003 Ga0123353_118230031 163
104 3300042601 Ga0466707_047263 Ga0466707_047263_17795_18286 163
105 3300010049 Ga0123356_10064385 Ga0123356_100643853 166
106 3300042608 Ga0466721_022408 Ga0466721_022408_19697_20197 166
107 3300042609 Ga0466722_050060 Ga0466722_050060_3360_3866 168
108 iso_pr_bacteria 2781125644 2781296156 168
109 3300002450 JGI24695J34938_10000415 JGI24695J34938_1000041515 169
110 3300042607 Ga0466720_088215 Ga0466720_088215_38_550 170
111 3300042624 Ga0466735_042470 Ga0466735_042470_1741_2256 171
112 3300042591 Ga0466692_034584 Ga0466692_034584_2454_2972 172
113 3300002450 JGI24695J34938_10005409 JGI24695J34938_100054093 174
114 3300002450 JGI24695J34938_10000063 JGI24695J34938_1000006353 176
115 iso_pr_bacteria 2781125659 2781327162 176
116 3300010049 Ga0123356_10001693 Ga0123356_1000169311 177
117 iso_pr_bacteria 2781125650 2781307903 207

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02130 YbeY Endoribonuclease YbeY 32 144 0.92

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.84 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.