Protein Family IF02620

Metagenome Isolate
217 Members
76 Samples
202 Scaffolds
189.07 Avg Length

🧬 Representative Sequence

ID
3300010049|Ga0123356_10000307|Ga0123356_100003071
Length
223 aa
Sequence
VAIVHNFKTFLTPIHNITIFFINFAANIKQVSQFMATTADFRNGLCIDYNGKPCSIVWFQHVKPGKGGAFVKVKMRNLDNGRILENTFTAGEKIDIIRIERRPYQFLYKDDTGFHFMHGETFEQIDLQEDMLDNSDLMKEGQYVEMMFHADEERVLTCELPPFVEMEVTYTEPAVKGDTASTNAQKSATLETGATIMVPLFINQGERIKVDTRDRSYAERVK*

📊 Sample Types

Isolate 6.9%
Metagenome 93.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 45.9%
Unclassified 21.6%
Kalotermitidae 18.9%
Rhinotermitidae 4.1%
Termopsidae 4.1%
Passalidae 2.7%
Culicidae 1.4%
Hodotermitidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 178
Eukaryota 0
Viruses 0
Unclassified 39

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
2 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
6 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
7 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
8 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
9 2820783511 Unclassified Bacteroidetes Emb289P3bin108 Isolate Unclassified
10 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
11 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
12 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
13 2820748953 Unclassified Bacteroidetes Nt197P4bin17 Isolate Unclassified
14 2820755292 Unclassified Bacteroidetes Nc150P3bin3 Isolate Unclassified
15 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
16 2820795054 Unclassified Bacteroidetes Cu122P1bin21 Isolate Unclassified
17 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
18 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
19 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
20 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
21 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
22 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
23 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
24 2820767225 Unclassified Bacteroidetes Lab288P3bin34 Isolate Unclassified
25 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
26 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
27 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
28 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
29 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
30 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
31 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
32 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
33 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
34 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
35 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
36 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
37 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
38 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
39 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
40 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
41 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
42 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
43 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
44 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
45 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
46 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
47 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
48 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
49 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
50 2820736622 Unclassified Bacteroidetes Th196P4bin26 Isolate Unclassified
51 2820753519 Unclassified Bacteroidetes Nc150P4bin20 Isolate Unclassified
52 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
53 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
54 2820797595 Unclassified Bacteroidetes Co191P3bin3 Isolate Unclassified
55 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
56 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
57 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
58 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
59 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
60 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
61 2820781750 Unclassified Bacteroidetes Emb289P3bin89 Isolate Unclassified
62 2820789850 Unclassified Bacteroidetes Cu122P3bin3 Isolate Unclassified
63 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
64 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
65 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
66 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
67 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
68 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
69 2820740053 Unclassified Bacteroidetes Th196P3bin81 Isolate Unclassified
70 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
71 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
72 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
73 2820772500 Unclassified Bacteroidetes Lab288P1bin72 Isolate Unclassified
74 2820792843 Unclassified Bacteroidetes Cu122P3bin1 Isolate Unclassified
75 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
76 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_203407 3300042612 Bacteria 8270
2 Ga0466733_182681 3300042659 Bacteria 7875
3 Ga0123353_10000888 3300010167 Bacteria 36529
4 Ga0123353_10007038 3300010167 Bacteria 15129
5 Ga0466710_371080 3300042613 Unclassified 1383
6 Ga0466710_386932 3300042613 Bacteria 14065
7 Ga0466723_177221 3300042618 Bacteria 14498
8 Ga0466728_417200 3300042620 Unclassified 3100
9 Ga0466690_063463 3300042590 Bacteria 11442
10 Ga0466690_269988 3300042590 Bacteria 10478
11 Ga0466694_028485 3300042594 Unclassified 3402
12 Ga0466694_198717 3300042594 Bacteria 1053
13 Ga0466731_055716 3300042622 Bacteria 1100
14 Ga0466735_160449 3300042624 Bacteria 1609
15 Ga0466703_018247 3300042636 Unclassified 9908
16 Ga0466701_045495 3300042598 Bacteria 33587
17 Ga0466700_493143 3300042600 Bacteria 1738
18 IMNBL1DRAFT_c0027168 3300000062 Bacteria 2158
19 Ga0123356_10028280 3300010049 Unclassified 5252
20 Ga0123356_11051372 3300010049 Bacteria 983
21 Ga0466710_286012 3300042613 Bacteria 1013
22 Ga0466710_397938 3300042613 Bacteria 2608
23 Ga0466657_280899 3300042582 Unclassified 2366
24 Ga0466690_113441 3300042590 Unclassified 1950
25 Ga0466693_035825 3300042592 Bacteria 2507
26 Ga0466695_001241 3300042595 Bacteria 1544
27 Ga0466696_027471 3300042596 Bacteria 17440
28 Ga0466735_197808 3300042624 Bacteria 1550
29 Ga0466703_332596 3300042636 Unclassified 1418
30 Ga0466724_55585 3300042649 Unclassified 3348
31 Ga0466725_406867 3300042654 Bacteria 2256
32 Ga0466727_140759 3300042655 Bacteria 3759
33 Ga0466701_100464 3300042598 Unclassified 5760
34 Ga0466714_019019 3300042603 Bacteria 3980
35 Ga0466722_065430 3300042609 Bacteria 2589
36 Ga0466722_203611 3300042609 Bacteria 107234
37 Ga0466722_231619 3300042609 Bacteria 16785
38 Ga0466698_280396 3300042610 Bacteria 1013
39 IMNBL1DRAFT_c0000093 3300000062 Bacteria 77928
40 JGI24698J34947_10055278 3300002449 Bacteria 1979
41 JGI24702J35022_10002155 3300002462 Bacteria 12143
42 JGI24705J35276_12193877 3300002504 Unclassified 1504
43 Ga0466697_159607 3300042611 Unclassified 2476
44 Ga0466705_091315 3300042612 Bacteria 5422
45 Ga0466733_211074 3300042659 Bacteria 12673
46 Ga0123353_10001797 3300010167 Bacteria 26368
47 Ga0123353_10471656 3300010167 Bacteria 1840
48 Ga0123353_11622354 3300010167 Unclassified 815
49 Ga0466715_029878 3300042616 Bacteria 5655
50 Ga0466723_063021 3300042618 Bacteria 19255
51 Ga0466728_373335 3300042620 Bacteria 11157
52 Ga0466691_085889 3300042593 Unclassified 1518
53 Ga0466696_270338 3300042596 Bacteria 15999
54 Ga0466696_393559 3300042596 Bacteria 1512
55 Ga0466699_366726 3300042597 Bacteria 1474
56 Ga0466729_220500 3300042621 Bacteria 1922
57 Ga0466704_144314 3300042643 Unclassified 6737
58 Ga0466704_191027 3300042643 Bacteria 94994
59 Ga0466724_36027 3300042649 Unclassified 3380
60 Ga0466708_049345 3300042652 Bacteria 8050
61 Ga0466708_163034 3300042652 Bacteria 32186
62 Ga0466727_325893 3300042655 Bacteria 9301
63 Ga0466701_102485 3300042598 Unclassified 1750
64 Ga0466700_138675 3300042600 Bacteria 2509
65 Ga0466707_000846 3300042601 Bacteria 4668
66 Ga0466719_287429 3300042606 Unclassified 3648
67 Ga0466722_115936 3300042609 Bacteria 15963
68 Ga0466722_173135 3300042609 Bacteria 2188
69 Ga0466722_173288 3300042609 Bacteria 6739
70 2227535719 2225789004 Bacteria 59646
71 IMNBL1DRAFT_c0001271 3300000062 Bacteria 19012
72 JGI24702J35022_10012336 3300002462 Unclassified 4754
73 JGI24702J35022_10029751 3300002462 Bacteria 2930
74 JGI24702J35022_10057913 3300002462 Bacteria 2069
75 JGI24696J40584_12770306 3300002834 Unclassified 820
76 Ga0072940_1345098 3300005200 Bacteria 1245
77 Ga0466697_148205 3300042611 Bacteria 7655
78 Ga0466732_164717 3300042656 Bacteria 2604
79 Ga0466733_207991 3300042659 Bacteria 1812
80 Ga0123354_10396386 3300010882 Bacteria 1174
81 Ga0466710_382889 3300042613 Bacteria 1502
82 Ga0466712_256644 3300042614 Unclassified 1344
83 Ga0466712_313585 3300042614 Bacteria 2063
84 Ga0466711_272630 3300042615 Bacteria 10448
85 Ga0466715_553513 3300042616 Bacteria 13120
86 Ga0466723_204338 3300042618 Bacteria 10768
87 Ga0466726_041545 3300042619 Bacteria 8369
88 Ga0466728_383001 3300042620 Unclassified 3538
89 Ga0466690_090067 3300042590 Bacteria 1404
90 Ga0466690_386871 3300042590 Bacteria 5935
91 Ga0466735_037199 3300042624 Bacteria 1147
92 Ga0466735_059974 3300042624 Bacteria 2704
93 Ga0466703_274253 3300042636 Unclassified 1530
94 Ga0466724_37270 3300042649 Unclassified 2741
95 Ga0466727_032376 3300042655 Bacteria 52244
96 Ga0466727_326592 3300042655 Bacteria 11026
97 Ga0466717_180304 3300042604 Bacteria 3157
98 Ga0466719_513073 3300042606 Bacteria 13858
99 Ga0466697_005717 3300042611 Bacteria 1141
100 2227365289 2225789004 Bacteria 1121
101 2227480171 2225789004 Bacteria 93917
102 JGI24702J35022_10015190 3300002462 Bacteria 4241
103 Ga0072941_1094460 3300005201 Bacteria 2441
104 Ga0123356_10122516 3300010049 Bacteria 2532
105 Ga0123356_10361840 3300010049 Unclassified 1578
106 Ga0123353_10023880 3300010167 Bacteria 9266
107 Ga0123353_10033498 3300010167 Bacteria 8003
108 Ga0123353_10575592 3300010167 Bacteria 1617
109 Ga0123354_10202634 3300010882 Unclassified 2175
110 Ga0466711_147712 3300042615 Bacteria 31504
111 Ga0466715_314779 3300042616 Bacteria 1012
112 Ga0466718_099763 3300042617 Bacteria 1746
113 Ga0466726_059354 3300042619 Bacteria 2460
114 Ga0466726_378378 3300042619 Bacteria 1002
115 Ga0466729_045799 3300042621 Bacteria 1253
116 Ga0160472_100044 3300012839 Bacteria 224512
117 Ga0466692_032622 3300042591 Bacteria 12184
118 Ga0466691_009133 3300042593 Bacteria 18706
119 Ga0466691_078413 3300042593 Unclassified 2194
120 Ga0466696_135190 3300042596 Bacteria 1560
121 Ga0466696_295385 3300042596 Bacteria 40357
122 Ga0466704_071303 3300042643 Unclassified 11293
123 Ga0466709_103105 3300042648 Bacteria 3306
124 Ga0466727_100812 3300042655 Bacteria 10125
125 Ga0466714_134140 3300042603 Unclassified 1653
126 JGI24695J34938_10003201 3300002450 Bacteria 11613
127 JGI24699J35502_11134222 3300002509 Bacteria 70815
128 Ga0466705_051906 3300042612 Bacteria 7505
129 Ga0123356_10000307 3300010049 Bacteria 55981
130 Ga0123356_10378269 3300010049 Bacteria 1548
131 Ga0123353_10518825 3300010167 Bacteria 1729
132 Ga0123354_10398412 3300010882 Unclassified 1168
133 Ga0466705_441924 3300042612 Bacteria 10549
134 Ga0466710_206831 3300042613 Bacteria 1065
135 Ga0466712_201320 3300042614 Bacteria 1086
136 Ga0466711_281256 3300042615 Bacteria 2935
137 Ga0466715_079130 3300042616 Bacteria 6107
138 Ga0466715_314852 3300042616 Unclassified 5190
139 Ga0466692_031989 3300042591 Bacteria 1443
140 Ga0466692_032256 3300042591 Bacteria 11879
141 Ga0466696_025874 3300042596 Bacteria 7999
142 Ga0466735_094944 3300042624 Bacteria 1264
143 Ga0466704_452371 3300042643 Unclassified 1179
144 Ga0466709_089676 3300042648 Unclassified 4874
145 Ga0466708_404961 3300042652 Bacteria 10101
146 Ga0466727_236296 3300042655 Bacteria 8613
147 Ga0466707_042117 3300042601 Bacteria 143034
148 Ga0466707_049760 3300042601 Bacteria 12161
149 Ga0466714_073411 3300042603 Bacteria 3490
150 Ga0466716_242552 3300042605 Bacteria 13235
151 Ga0466719_191975 3300042606 Unclassified 1477
152 Ga0466720_127594 3300042607 Bacteria 4029
153 Ga0466720_129111 3300042607 Bacteria 2885
154 Ga0466722_175913 3300042609 Bacteria 10949
155 JGI24702J35022_10052149 3300002462 Bacteria 2180
156 JGI24705J35276_11874454 3300002504 Bacteria 732
157 JGI24705J35276_12238434 3300002504 Bacteria 22055
158 Ga0466697_236205 3300042611 Bacteria 3262
159 Ga0466705_235933 3300042612 Bacteria 12959
160 Ga0466732_372101 3300042656 Bacteria 36127
161 Ga0123357_10658895 3300009784 Bacteria 771
162 Ga0123354_10108744 3300010882 Bacteria 3679
163 Ga0466715_624249 3300042616 Bacteria 8773
164 Ga0466726_250585 3300042619 Bacteria 4258
165 Ga0265387_1002689 3300024582 Bacteria 2491
166 Ga0466656_002175 3300042550 Bacteria 1463
167 Ga0466657_190267 3300042582 Unclassified 1359
168 Ga0466695_287068 3300042595 Bacteria 2642
169 Ga0466731_094638 3300042622 Bacteria 32908
170 Ga0466709_261326 3300042648 Unclassified 4876
171 Ga0466727_064353 3300042655 Bacteria 10913
172 Ga0466701_042702 3300042598 Bacteria 1490
173 Ga0466701_062311 3300042598 Bacteria 25793
174 Ga0466706_051635 3300042599 Bacteria 8362
175 Ga0466719_292746 3300042606 Bacteria 2703
176 Ga0466721_137082 3300042608 Bacteria 10391
177 JGI24702J35022_10002194 3300002462 Bacteria 12022
178 Ga0123357_10003992 3300009784 Bacteria 17151
179 Ga0123353_10287249 3300010167 Bacteria 2521
180 Ga0123353_10809563 3300010167 Bacteria 1292
181 Ga0123354_10000620 3300010882 Bacteria 37150
182 Ga0466710_011334 3300042613 Bacteria 1464
183 Ga0466726_193554 3300042619 Unclassified 2695
184 Ga0466726_298022 3300042619 Bacteria 2779
185 Ga0466729_112437 3300042621 Bacteria 1884
186 Ga0466690_396535 3300042590 Bacteria 4080
187 Ga0466695_355964 3300042595 Bacteria 1348
188 Ga0466699_442002 3300042597 Bacteria 1249
189 Ga0466734_036664 3300042623 Bacteria 1767
190 Ga0466734_074027 3300042623 Bacteria 2628
191 Ga0466735_016838 3300042624 Bacteria 28411
192 Ga0466727_072509 3300042655 Bacteria 26112
193 Ga0466701_085865 3300042598 Unclassified 1030
194 Ga0466707_150416 3300042601 Bacteria 1310
195 Ga0466707_222820 3300042601 Bacteria 15913
196 Ga0466716_122955 3300042605 Bacteria 9533
197 Ga0466722_033407 3300042609 Bacteria 22375
198 IMNBL1DRAFT_c0017680 3300000062 Bacteria 2990
199 IMNBL1DRAFT_c0024966 3300000062 Bacteria 2302
200 JGI24702J35022_10045456 3300002462 Bacteria 2340
201 JGI24705J35276_11996079 3300002504 Unclassified 843
202 Ga0072941_1126154 3300005201 Bacteria 4125

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042598 Ga0466701_102485 Ga0466701_102485_10_534 174
2 3300042605 Ga0466716_242552 Ga0466716_242552_11057_11590 177
3 3300042655 Ga0466727_140759 Ga0466727_140759_1115_1648 177
4 3300042659 Ga0466733_207991 Ga0466733_207991_22_561 179
5 3300042601 Ga0466707_150416 Ga0466707_150416_344_907 180
6 3300009784 Ga0123357_10658895 Ga0123357_106588951 186
7 3300042601 Ga0466707_049760 Ga0466707_049760_563_1123 186
8 3300042596 Ga0466696_027471 Ga0466696_027471_2406_2969 187
9 3300042601 Ga0466707_222820 Ga0466707_222820_8791_9354 187
10 3300042624 Ga0466735_059974 Ga0466735_059974_308_871 187
11 3300042624 Ga0466735_094944 Ga0466735_094944_399_962 187
12 3300042655 Ga0466727_032376 Ga0466727_032376_8961_9524 187
13 3300042655 Ga0466727_100812 Ga0466727_100812_2197_2760 187
14 iso_pr_bacteria 2820759988 2820762446 187
15 2225789004 2227365289 2227812709 188
16 2225789004 2227480171 2227937921 188
17 3300002509 JGI24699J35502_11134222 JGI24699J35502_1113422210 188
18 3300024582 Ga0265387_1002689 Ga0265387_10026891 188
19 3300042550 Ga0466656_002175 Ga0466656_002175_223_789 188
20 3300042582 Ga0466657_190267 Ga0466657_190267_276_842 188
21 3300042582 Ga0466657_280899 Ga0466657_280899_1735_2301 188
22 3300042590 Ga0466690_090067 Ga0466690_090067_535_1101 188
23 3300042590 Ga0466690_113441 Ga0466690_113441_558_1124 188
24 3300042590 Ga0466690_269988 Ga0466690_269988_7672_8238 188
25 3300042590 Ga0466690_386871 Ga0466690_386871_502_1068 188
26 3300042590 Ga0466690_396535 Ga0466690_396535_2736_3302 188
27 3300042591 Ga0466692_032256 Ga0466692_032256_1350_1916 188
28 3300042593 Ga0466691_078413 Ga0466691_078413_348_914 188
29 3300042593 Ga0466691_085889 Ga0466691_085889_304_870 188
30 3300042594 Ga0466694_028485 Ga0466694_028485_1631_2197 188
31 3300042594 Ga0466694_198717 Ga0466694_198717_429_995 188
32 3300042595 Ga0466695_001241 Ga0466695_001241_454_1020 188
33 3300042595 Ga0466695_287068 Ga0466695_287068_1006_1572 188
34 3300042595 Ga0466695_355964 Ga0466695_355964_326_892 188
35 3300042596 Ga0466696_025874 Ga0466696_025874_397_963 188
36 3300042596 Ga0466696_135190 Ga0466696_135190_463_1029 188
37 3300042596 Ga0466696_270338 Ga0466696_270338_14146_14712 188
38 3300042596 Ga0466696_295385 Ga0466696_295385_34950_35516 188
39 3300042596 Ga0466696_393559 Ga0466696_393559_716_1282 188
40 3300042597 Ga0466699_366726 Ga0466699_366726_152_718 188
41 3300042597 Ga0466699_442002 Ga0466699_442002_566_1132 188
42 3300042598 Ga0466701_042702 Ga0466701_042702_718_1284 188
43 3300042598 Ga0466701_045495 Ga0466701_045495_4347_4913 188
44 3300042598 Ga0466701_062311 Ga0466701_062311_5405_5971 188
45 3300042598 Ga0466701_085865 Ga0466701_085865_224_790 188
46 3300042598 Ga0466701_100464 Ga0466701_100464_2502_3068 188
47 3300042599 Ga0466706_051635 Ga0466706_051635_6375_6941 188
48 3300042600 Ga0466700_138675 Ga0466700_138675_514_1080 188
49 3300042603 Ga0466714_019019 Ga0466714_019019_781_1347 188
50 3300042603 Ga0466714_073411 Ga0466714_073411_2308_2874 188
51 3300042603 Ga0466714_134140 Ga0466714_134140_975_1541 188
52 3300042604 Ga0466717_180304 Ga0466717_180304_154_720 188
53 3300042605 Ga0466716_122955 Ga0466716_122955_4412_4978 188
54 3300042606 Ga0466719_287429 Ga0466719_287429_2163_2729 188
55 3300042606 Ga0466719_292746 Ga0466719_292746_2014_2580 188
56 3300042607 Ga0466720_127594 Ga0466720_127594_112_678 188
57 3300042607 Ga0466720_129111 Ga0466720_129111_738_1304 188
58 3300042608 Ga0466721_137082 Ga0466721_137082_4439_5005 188
59 3300042609 Ga0466722_033407 Ga0466722_033407_16982_17548 188
60 3300042610 Ga0466698_280396 Ga0466698_280396_152_718 188
61 3300042611 Ga0466697_005717 Ga0466697_005717_364_930 188
62 3300042611 Ga0466697_148205 Ga0466697_148205_693_1259 188
63 3300042611 Ga0466697_159607 Ga0466697_159607_1656_2222 188
64 3300042611 Ga0466697_236205 Ga0466697_236205_169_735 188
65 3300042612 Ga0466705_051906 Ga0466705_051906_806_1372 188
66 3300042612 Ga0466705_091315 Ga0466705_091315_1409_1975 188
67 3300042612 Ga0466705_203407 Ga0466705_203407_5425_5991 188
68 3300042612 Ga0466705_235933 Ga0466705_235933_3421_3987 188
69 3300042612 Ga0466705_441924 Ga0466705_441924_1599_2165 188
70 3300042613 Ga0466710_011334 Ga0466710_011334_715_1281 188
71 3300042613 Ga0466710_206831 Ga0466710_206831_48_614 188
72 3300042613 Ga0466710_286012 Ga0466710_286012_216_782 188
73 3300042613 Ga0466710_371080 Ga0466710_371080_38_604 188
74 3300042613 Ga0466710_382889 Ga0466710_382889_569_1135 188
75 3300042613 Ga0466710_386932 Ga0466710_386932_5069_5635 188
76 3300042613 Ga0466710_397938 Ga0466710_397938_296_862 188
77 3300042614 Ga0466712_201320 Ga0466712_201320_361_927 188
78 3300042615 Ga0466711_281256 Ga0466711_281256_2013_2579 188
79 3300042616 Ga0466715_029878 Ga0466715_029878_1862_2428 188
80 3300042616 Ga0466715_079130 Ga0466715_079130_184_750 188
81 3300042616 Ga0466715_314779 Ga0466715_314779_399_965 188
82 3300042616 Ga0466715_314852 Ga0466715_314852_4577_5143 188
83 3300042616 Ga0466715_624249 Ga0466715_624249_2592_3158 188
84 3300042617 Ga0466718_099763 Ga0466718_099763_330_896 188
85 3300042618 Ga0466723_063021 Ga0466723_063021_3244_3810 188
86 3300042618 Ga0466723_177221 Ga0466723_177221_7841_8407 188
87 3300042618 Ga0466723_204338 Ga0466723_204338_3490_4056 188
88 3300042620 Ga0466728_373335 Ga0466728_373335_2987_3553 188
89 3300042620 Ga0466728_383001 Ga0466728_383001_327_893 188
90 3300042620 Ga0466728_417200 Ga0466728_417200_2060_2626 188
91 3300042621 Ga0466729_112437 Ga0466729_112437_344_910 188
92 3300042622 Ga0466731_055716 Ga0466731_055716_96_662 188
93 3300042622 Ga0466731_094638 Ga0466731_094638_7335_7901 188
94 3300042623 Ga0466734_036664 Ga0466734_036664_344_910 188
95 3300042624 Ga0466735_160449 Ga0466735_160449_112_678 188
96 3300042636 Ga0466703_018247 Ga0466703_018247_5505_6071 188
97 3300042636 Ga0466703_274253 Ga0466703_274253_593_1159 188
98 3300042636 Ga0466703_332596 Ga0466703_332596_430_996 188
99 3300042643 Ga0466704_071303 Ga0466704_071303_8154_8720 188
100 3300042643 Ga0466704_144314 Ga0466704_144314_3809_4375 188
101 3300042643 Ga0466704_452371 Ga0466704_452371_523_1089 188
102 3300042648 Ga0466709_089676 Ga0466709_089676_3095_3661 188
103 3300042648 Ga0466709_261326 Ga0466709_261326_4065_4631 188
104 3300042649 Ga0466724_36027 Ga0466724_36027_1113_1679 188
105 3300042649 Ga0466724_37270 Ga0466724_37270_1146_1712 188
106 3300042649 Ga0466724_55585 Ga0466724_55585_234_800 188
107 3300042652 Ga0466708_049345 Ga0466708_049345_1421_1987 188
108 3300042652 Ga0466708_163034 Ga0466708_163034_24839_25405 188
109 3300042652 Ga0466708_404961 Ga0466708_404961_7033_7599 188
110 3300042655 Ga0466727_072509 Ga0466727_072509_25218_25784 188
111 3300042655 Ga0466727_326592 Ga0466727_326592_8855_9421 188
112 3300042656 Ga0466732_164717 Ga0466732_164717_1032_1598 188
113 3300042656 Ga0466732_372101 Ga0466732_372101_25530_26096 188
114 3300042659 Ga0466733_211074 Ga0466733_211074_10202_10768 188
115 iso_pr_bacteria 2820736622 2820737266 188
116 iso_pr_bacteria 2820740053 2820740690 188
117 iso_pr_bacteria 2820748953 2820750291 188
118 iso_pr_bacteria 2820753519 2820755219 188
119 iso_pr_bacteria 2820755292 2820755573 188
120 iso_pr_bacteria 2820767225 2820767571 188
121 iso_pr_bacteria 2820772500 2820773307 188
122 iso_pr_bacteria 2820781750 2820781750 188
123 iso_pr_bacteria 2820783511 2820785324 188
124 iso_pr_bacteria 2820789850 2820792418 188
125 iso_pr_bacteria 2820792843 2820794878 188
126 iso_pr_bacteria 2820795054 2820795600 188
127 iso_pr_bacteria 2820797595 2820798333 188
128 2225789004 2227535719 2228051788 189
129 3300000062 IMNBL1DRAFT_c0027168 IMNBL1DRAFT_00271682 189
130 3300002450 JGI24695J34938_10003201 JGI24695J34938_100032013 189
131 3300002462 JGI24702J35022_10002155 JGI24702J35022_100021558 189
132 3300002462 JGI24702J35022_10002194 JGI24702J35022_100021945 189
133 3300002462 JGI24702J35022_10012336 JGI24702J35022_100123363 189
134 3300002462 JGI24702J35022_10015190 JGI24702J35022_100151902 189
135 3300002462 JGI24702J35022_10029751 JGI24702J35022_100297514 189
136 3300002462 JGI24702J35022_10045456 JGI24702J35022_100454562 189
137 3300002462 JGI24702J35022_10052149 JGI24702J35022_100521492 189
138 3300002504 JGI24705J35276_11874454 JGI24705J35276_118744541 189
139 3300002504 JGI24705J35276_11996079 JGI24705J35276_119960791 189
140 3300002504 JGI24705J35276_12193877 JGI24705J35276_121938772 189
141 3300002504 JGI24705J35276_12238434 JGI24705J35276_122384343 189
142 3300002834 JGI24696J40584_12770306 JGI24696J40584_127703062 189
143 3300005200 Ga0072940_1345098 Ga0072940_13450981 189
144 3300005201 Ga0072941_1094460 Ga0072941_10944601 189
145 3300010049 Ga0123356_10028280 Ga0123356_100282802 189
146 3300010049 Ga0123356_10122516 Ga0123356_101225162 189
147 3300010049 Ga0123356_10361840 Ga0123356_103618401 189
148 3300010049 Ga0123356_10378269 Ga0123356_103782692 189
149 3300010049 Ga0123356_11051372 Ga0123356_110513721 189
150 3300010167 Ga0123353_10000888 Ga0123353_1000088820 189
151 3300010167 Ga0123353_10001797 Ga0123353_1000179724 189
152 3300010167 Ga0123353_10007038 Ga0123353_100070388 189
153 3300010167 Ga0123353_10023880 Ga0123353_100238804 189
154 3300010167 Ga0123353_10033498 Ga0123353_100334988 189
155 3300010167 Ga0123353_10287249 Ga0123353_102872492 189
156 3300010167 Ga0123353_10471656 Ga0123353_104716562 189
157 3300010167 Ga0123353_10518825 Ga0123353_105188252 189
158 3300010167 Ga0123353_10575592 Ga0123353_105755922 189
159 3300010167 Ga0123353_10809563 Ga0123353_108095631 189
160 3300010167 Ga0123353_11622354 Ga0123353_116223541 189
161 3300010882 Ga0123354_10000620 Ga0123354_1000062026 189
162 3300010882 Ga0123354_10108744 Ga0123354_101087443 189
163 3300010882 Ga0123354_10202634 Ga0123354_102026342 189
164 3300010882 Ga0123354_10396386 Ga0123354_103963862 189
165 3300010882 Ga0123354_10398412 Ga0123354_103984121 189
166 3300012839 Ga0160472_100044 Ga0160472_10004439 189
167 3300042591 Ga0466692_031989 Ga0466692_031989_117_686 189
168 3300042591 Ga0466692_032622 Ga0466692_032622_8961_9530 189
169 3300042593 Ga0466691_009133 Ga0466691_009133_12025_12594 189
170 3300042606 Ga0466719_191975 Ga0466719_191975_409_978 189
171 3300042609 Ga0466722_065430 Ga0466722_065430_911_1480 189
172 3300042609 Ga0466722_115936 Ga0466722_115936_7172_7741 189
173 3300042609 Ga0466722_173135 Ga0466722_173135_1002_1571 189
174 3300042609 Ga0466722_173288 Ga0466722_173288_4160_4729 189
175 3300042609 Ga0466722_175913 Ga0466722_175913_4230_4799 189
176 3300042609 Ga0466722_203611 Ga0466722_203611_49089_49658 189
177 3300042614 Ga0466712_256644 Ga0466712_256644_231_800 189
178 3300042614 Ga0466712_313585 Ga0466712_313585_954_1523 189
179 3300042615 Ga0466711_272630 Ga0466711_272630_6401_6970 189
180 3300042616 Ga0466715_553513 Ga0466715_553513_2340_2909 189
181 3300042619 Ga0466726_041545 Ga0466726_041545_745_1314 189
182 3300042619 Ga0466726_059354 Ga0466726_059354_1864_2433 189
183 3300042619 Ga0466726_193554 Ga0466726_193554_383_952 189
184 3300042619 Ga0466726_250585 Ga0466726_250585_2564_3133 189
185 3300042619 Ga0466726_298022 Ga0466726_298022_1874_2443 189
186 3300042621 Ga0466729_045799 Ga0466729_045799_390_959 189
187 3300042621 Ga0466729_220500 Ga0466729_220500_150_719 189
188 3300042623 Ga0466734_074027 Ga0466734_074027_899_1468 189
189 3300042624 Ga0466735_016838 Ga0466735_016838_9355_9924 189
190 3300042624 Ga0466735_037199 Ga0466735_037199_513_1082 189
191 3300042624 Ga0466735_197808 Ga0466735_197808_826_1395 189
192 3300042643 Ga0466704_191027 Ga0466704_191027_55972_56541 189
193 3300042648 Ga0466709_103105 Ga0466709_103105_2233_2802 189
194 3300042654 Ga0466725_406867 Ga0466725_406867_580_1149 189
195 3300042655 Ga0466727_064353 Ga0466727_064353_2274_2843 189
196 3300042655 Ga0466727_325893 Ga0466727_325893_1315_1884 189
197 3300042659 Ga0466733_182681 Ga0466733_182681_399_968 189
198 iso_pr_bacteria 2967483437 2967483922 189
199 3300000062 IMNBL1DRAFT_c0000093 IMNBL1DRAFT_000009353 190
200 3300000062 IMNBL1DRAFT_c0001271 IMNBL1DRAFT_00012718 190
201 3300000062 IMNBL1DRAFT_c0017680 IMNBL1DRAFT_00176802 190
202 3300000062 IMNBL1DRAFT_c0024966 IMNBL1DRAFT_00249662 190
203 3300005201 Ga0072941_1126154 Ga0072941_11261542 190
204 3300042590 Ga0466690_063463 Ga0466690_063463_9375_9947 190
205 3300042619 Ga0466726_378378 Ga0466726_378378_232_804 190
206 3300042655 Ga0466727_236296 Ga0466727_236296_8023_8595 190
207 3300042601 Ga0466707_042117 Ga0466707_042117_39583_40158 191
208 3300042606 Ga0466719_513073 Ga0466719_513073_2096_2671 191
209 3300042609 Ga0466722_231619 Ga0466722_231619_12758_13333 191
210 3300042615 Ga0466711_147712 Ga0466711_147712_9720_10301 193
211 3300042600 Ga0466700_493143 Ga0466700_493143_1050_1637 195
212 3300042601 Ga0466707_000846 Ga0466707_000846_1669_2265 198
213 3300009784 Ga0123357_10003992 Ga0123357_100039923 210
214 3300002462 JGI24702J35022_10057913 JGI24702J35022_100579132 216
215 3300010049 Ga0123356_10000307 Ga0123356_100003071 223
216 3300042592 Ga0466693_035825 Ga0466693_035825_1171_1848 225
217 3300002449 JGI24698J34947_10055278 JGI24698J34947_100552782 244

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF09285 Elong-fact-P_C Elongation factor P, C-terminal 164 220 0.99
PF08207 EFP_N Elongation factor P (EF-P) KOW-like domain 37 94 0.98
PF01132 EFP Elongation factor P (EF-P) OB domain 102 152 0.97

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.7 0.77 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.