Protein Family IF02581

Metagenome Isolate
115 Members
39 Samples
107 Scaffolds
113.37 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10731364|Ga0123355_107313643
Length
138 aa
Sequence
MSILSELNGLLVSILPVETGVFSGVPPDEYIVITPMADVFGVHADNFPQTETQEARLSLFSKNNYLERKNQVTKTLLSAEFVVTGRRYIGFESDTGYHHYNIDCEKFYMLNTDNSVYLSTGTRILTTGARFLLIREG*

πŸ“Š Sample Types

Isolate 2.6%
Metagenome 97.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 55.3%
Kalotermitidae 18.4%
Unclassified 10.5%
Rhinotermitidae 7.9%
Termopsidae 5.3%
Hodotermitidae 2.6%

🌳 Taxonomy

Archaea 0
Bacteria 104
Eukaryota 0
Viruses 0
Unclassified 11

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
2 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
3 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
4 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
5 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
6 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
7 2019105004 Actinobacterium Actino7 (unscreened) Isolate Unclassified
8 2065487017 Actinobacterium Actino7 (unscreened) Isolate Unclassified
9 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
10 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
11 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
12 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
13 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
14 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
15 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
16 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
17 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
18 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
19 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
20 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
21 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
22 2820131053 Unclassified Proteobacteria Emb289P3bin8 Isolate Unclassified
23 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
24 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
25 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
26 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
27 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
28 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
29 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
30 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
31 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
32 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
33 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
34 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
35 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
36 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
37 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
38 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
39 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466711_147516 3300042615 Bacteria 2072
2 Ga0466726_258791 3300042619 Bacteria 6619
3 Ga0466729_074075 3300042621 Bacteria 9292
4 Ga0466706_185875 3300042599 Bacteria 2838
5 Ga0466706_206020 3300042599 Bacteria 1615
6 Ga0466714_018373 3300042603 Bacteria 2480
7 Ga0466722_095627 3300042609 Bacteria 3521
8 Ga0415639_142706 3300038395 Unclassified 1624
9 Ga0466656_037215 3300042550 Bacteria 1684
10 Ga0466656_085063 3300042550 Bacteria 1068
11 Ga0466703_152672 3300042636 Bacteria 4425
12 Ga0123355_10434676 3300009826 Bacteria 1666
13 Ga0123355_11111151 3300009826 Bacteria 821
14 Ga0123356_10060391 3300010049 Bacteria 3538
15 Ga0123356_12494908 3300010049 Bacteria 647
16 Ga0123353_10312933 3300010167 Bacteria 2388
17 Ga0123354_10887565 3300010882 Bacteria 587
18 AustNasuHG_c1024018 3300000089 Bacteria 1938
19 JGI24703J35330_11748774 3300002501 Bacteria 33731
20 Ga0466705_157387 3300042612 Bacteria 3639
21 Ga0466723_037816 3300042618 Bacteria 1157
22 Ga0466719_424951 3300042606 Bacteria 2420
23 Ga0123355_11677952 3300009826 Bacteria 607
24 Ga0123356_11408866 3300010049 Bacteria 857
25 Ga0123356_12382954 3300010049 Bacteria 662
26 Ga0123353_10259555 3300010167 Bacteria 2685
27 JGI24703J35330_11551390 3300002501 Bacteria 1228
28 Ga0072941_1161361 3300005201 Bacteria 895
29 Ga0072941_1576552 3300005201 Bacteria 816
30 Ga0466717_157974 3300042604 Bacteria 1181
31 Ga0466719_047643 3300042606 Bacteria 10760
32 Ga0466720_134662 3300042607 Bacteria 1148
33 Ga0466698_259077 3300042610 Bacteria 1763
34 Ga0123357_10388060 3300009784 Bacteria 1287
35 Ga0123356_11209549 3300010049 Bacteria 921
36 Ga0123353_12783047 3300010167 Bacteria 573
37 AustNasuHG_c1023536 3300000089 Bacteria 1965
38 Ga0466706_088549 3300042599 Bacteria 1248
39 Ga0123356_10095041 3300010049 Bacteria 2848
40 Ga0123356_10376926 3300010049 Bacteria 1550
41 Ga0123353_10003659 3300010167 Bacteria 19498
42 AustNasuHG_c1004911 3300000089 Bacteria 4788
43 AustNasuHG_c1068403 3300000089 Bacteria 650
44 JGI24705J35276_12228440 3300002504 Bacteria 3186
45 Ga0072940_1010731 3300005200 Bacteria 54200
46 Ga0466733_123451 3300042659 Bacteria 34754
47 Ga0466711_462533 3300042615 Bacteria 8331
48 Ga0466729_017269 3300042621 Bacteria 1131
49 Ga0466706_127820 3300042599 Bacteria 1287
50 Ga0466706_166491 3300042599 Bacteria 4219
51 Ga0466713_015902 3300042602 Bacteria 2239
52 Ga0466714_039345 3300042603 Bacteria 2393
53 Ga0466699_408383 3300042597 Bacteria 2540
54 Ga0466703_199214 3300042636 Bacteria 4441
55 Ga0466708_388971 3300042652 Bacteria 5217
56 Ga0466727_175260 3300042655 Bacteria 1687
57 Ga0123355_10731364 3300009826 Bacteria 1125
58 Ga0123356_10220304 3300010049 Bacteria 1953
59 Ga0123353_10030511 3300010167 Bacteria 8332
60 Ga0123353_10161332 3300010167 Unclassified 3569
61 Ga0123353_10436185 3300010167 Bacteria 1934
62 Ga0123353_13365129 3300010167 Unclassified 508
63 Ga0466711_261513 3300042615 Bacteria 44460
64 Ga0466726_471284 3300042619 Bacteria 1919
65 Ga0466729_133078 3300042621 Bacteria 31387
66 Ga0466706_207816 3300042599 Bacteria 4784
67 Ga0466700_054377 3300042600 Bacteria 1661
68 Ga0466700_113055 3300042600 Bacteria 1715
69 Ga0466717_309441 3300042604 Bacteria 2336
70 Ga0415639_002577 3300038395 Bacteria 3229
71 Ga0466692_077025 3300042591 Bacteria 2075
72 Ga0466734_154021 3300042623 Bacteria 1139
73 Ga0466702_385429 3300042635 Bacteria 2060
74 Ga0466703_063898 3300042636 Bacteria 1580
75 Ga0466725_035920 3300042654 Bacteria 3492
76 Ga0466727_326176 3300042655 Bacteria 3386
77 Ga0123357_10833243 3300009784 Bacteria 614
78 Ga0123353_10009281 3300010167 Bacteria 13547
79 Ga0123353_10829673 3300010167 Bacteria 1271
80 Ga0123353_11042238 3300010167 Bacteria 1094
81 Ga0123353_12068081 3300010167 Bacteria 695
82 Ga0072941_1007442 3300005201 Bacteria 89058
83 Ga0466726_118607 3300042619 Bacteria 1259
84 Ga0466729_194393 3300042621 Bacteria 2141
85 Ga0466706_051330 3300042599 Bacteria 1819
86 Ga0466706_136071 3300042599 Bacteria 3171
87 Ga0466717_089127 3300042604 Bacteria 1161
88 Ga0466696_011433 3300042596 Bacteria 1437
89 Ga0466725_349177 3300042654 Bacteria 1500
90 Ga0123355_10920573 3300009826 Bacteria 945
91 Ga0123356_10119480 3300010049 Bacteria 2561
92 Ga0123356_10376776 3300010049 Unclassified 1551
93 Ga0123356_11778650 3300010049 Bacteria 766
94 Ga0123353_10078461 3300010167 Unclassified 5307
95 Ga0123353_10507838 3300010167 Bacteria 1754
96 Ga0466711_092848 3300042615 Bacteria 2166
97 Ga0466706_032313 3300042599 Unclassified 1009
98 Ga0466706_127643 3300042599 Bacteria 2015
99 Ga0466722_154774 3300042609 Bacteria 3215
100 Ga0415639_120207 3300038395 Bacteria 1693
101 Ga0466729_281572 3300042621 Bacteria 7192
102 Ga0466703_177100 3300042636 Bacteria 1233
103 Ga0466703_330020 3300042636 Bacteria 2069
104 Ga0123357_10340149 3300009784 Bacteria 1452
105 Ga0123356_10548570 3300010049 Bacteria 1317
106 Ga0123353_10001086 3300010167 Bacteria 33084
107 Ga0123353_10210003 3300010167 Bacteria 3054

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042600 Ga0466700_113055 Ga0466700_113055_1414_1695 93
2 3300042600 Ga0466700_113055 Ga0466700_113055_1414_1695 93
3 3300042615 Ga0466711_092848 Ga0466711_092848_220_534 104
4 3300009826 Ga0123355_11677952 Ga0123355_116779521 111
5 3300042615 Ga0466711_147516 Ga0466711_147516_1330_1665 111
6 3300042615 Ga0466711_147516 Ga0466711_147516_1330_1665 111
7 3300042654 Ga0466725_035920 Ga0466725_035920_2433_2768 111
8 3300038395 Ga0415639_142706 Ga0415639_142706_380_718 112
9 3300042550 Ga0466656_037215 Ga0466656_037215_378_716 112
10 3300042550 Ga0466656_085063 Ga0466656_085063_241_579 112
11 3300042591 Ga0466692_077025 Ga0466692_077025_904_1242 112
12 3300042597 Ga0466699_408383 Ga0466699_408383_2115_2453 112
13 3300042599 Ga0466706_088549 Ga0466706_088549_626_964 112
14 3300042599 Ga0466706_127643 Ga0466706_127643_385_723 112
15 3300042599 Ga0466706_127820 Ga0466706_127820_889_1227 112
16 3300042599 Ga0466706_136071 Ga0466706_136071_1771_2109 112
17 3300042599 Ga0466706_206020 Ga0466706_206020_1038_1376 112
18 3300042604 Ga0466717_309441 Ga0466717_309441_1018_1356 112
19 3300042609 Ga0466722_095627 Ga0466722_095627_1067_1405 112
20 3300042618 Ga0466723_037816 Ga0466723_037816_532_870 112
21 3300042621 Ga0466729_074075 Ga0466729_074075_3968_4306 112
22 3300042621 Ga0466729_194393 Ga0466729_194393_632_970 112
23 3300042623 Ga0466734_154021 Ga0466734_154021_471_809 112
24 3300042636 Ga0466703_152672 Ga0466703_152672_1623_1961 112
25 3300042636 Ga0466703_199214 Ga0466703_199214_3563_3901 112
26 3300042636 Ga0466703_330020 Ga0466703_330020_1191_1529 112
27 3300042654 Ga0466725_349177 Ga0466725_349177_985_1323 112
28 iso_pr_bacteria 2820131053 2820132283 112
29 3300000089 AustNasuHG_c1024018 AustNasuHG_10240184 113
30 3300000089 AustNasuHG_c1068403 AustNasuHG_10684032 113
31 3300002501 JGI24703J35330_11551390 JGI24703J35330_115513902 113
32 3300002501 JGI24703J35330_11748774 JGI24703J35330_1174877423 113
33 3300002504 JGI24705J35276_12228440 JGI24705J35276_122284404 113
34 3300005201 Ga0072941_1161361 Ga0072941_11613612 113
35 3300009784 Ga0123357_10340149 Ga0123357_103401492 113
36 3300009826 Ga0123355_10434676 Ga0123355_104346762 113
37 3300009826 Ga0123355_10920573 Ga0123355_109205732 113
38 3300010049 Ga0123356_10060391 Ga0123356_100603913 113
39 3300010049 Ga0123356_10119480 Ga0123356_101194804 113
40 3300010049 Ga0123356_10220304 Ga0123356_102203042 113
41 3300010049 Ga0123356_11209549 Ga0123356_112095492 113
42 3300010167 Ga0123353_10003659 Ga0123353_1000365922 113
43 3300010167 Ga0123353_10161332 Ga0123353_101613326 113
44 3300010167 Ga0123353_10210003 Ga0123353_102100036 113
45 3300010167 Ga0123353_10436185 Ga0123353_104361855 113
46 3300010167 Ga0123353_11042238 Ga0123353_110422382 113
47 3300010167 Ga0123353_12068081 Ga0123353_120680812 113
48 3300010882 Ga0123354_10887565 Ga0123354_108875652 113
49 3300038395 Ga0415639_002577 Ga0415639_002577_86_427 113
50 3300042596 Ga0466696_011433 Ga0466696_011433_1050_1391 113
51 3300042599 Ga0466706_032313 Ga0466706_032313_95_436 113
52 3300042599 Ga0466706_051330 Ga0466706_051330_426_767 113
53 3300042599 Ga0466706_166491 Ga0466706_166491_2586_2927 113
54 3300042599 Ga0466706_185875 Ga0466706_185875_2389_2730 113
55 3300042599 Ga0466706_207816 Ga0466706_207816_3410_3751 113
56 3300042602 Ga0466713_015902 Ga0466713_015902_1391_1732 113
57 3300042603 Ga0466714_039345 Ga0466714_039345_2010_2351 113
58 3300042604 Ga0466717_089127 Ga0466717_089127_774_1115 113
59 3300042606 Ga0466719_047643 Ga0466719_047643_7415_7756 113
60 3300042606 Ga0466719_424951 Ga0466719_424951_2005_2346 113
61 3300042609 Ga0466722_154774 Ga0466722_154774_1495_1836 113
62 3300042610 Ga0466698_259077 Ga0466698_259077_1034_1375 113
63 3300042612 Ga0466705_157387 Ga0466705_157387_2904_3245 113
64 3300042615 Ga0466711_261513 Ga0466711_261513_28263_28604 113
65 3300042615 Ga0466711_462533 Ga0466711_462533_7347_7688 113
66 3300042619 Ga0466726_118607 Ga0466726_118607_342_683 113
67 3300042619 Ga0466726_258791 Ga0466726_258791_3760_4101 113
68 3300042619 Ga0466726_471284 Ga0466726_471284_1483_1824 113
69 3300042621 Ga0466729_017269 Ga0466729_017269_238_579 113
70 3300042621 Ga0466729_281572 Ga0466729_281572_2216_2557 113
71 3300042635 Ga0466702_385429 Ga0466702_385429_1668_2009 113
72 3300042636 Ga0466703_063898 Ga0466703_063898_793_1134 113
73 3300042636 Ga0466703_177100 Ga0466703_177100_715_1056 113
74 3300042652 Ga0466708_388971 Ga0466708_388971_2834_3175 113
75 3300042655 Ga0466727_326176 Ga0466727_326176_1329_1670 113
76 3300042659 Ga0466733_123451 Ga0466733_123451_9993_10334 113
77 3300000089 AustNasuHG_c1004911 AustNasuHG_10049116 114
78 3300000089 AustNasuHG_c1023536 AustNasuHG_10235363 114
79 3300005200 Ga0072940_1010731 Ga0072940_101073136 114
80 3300005201 Ga0072941_1007442 Ga0072941_100744263 114
81 3300009784 Ga0123357_10833243 Ga0123357_108332431 114
82 3300009826 Ga0123355_11111151 Ga0123355_111111512 114
83 3300010049 Ga0123356_10376776 Ga0123356_103767763 114
84 3300010049 Ga0123356_10376926 Ga0123356_103769263 114
85 3300010049 Ga0123356_11778650 Ga0123356_117786501 114
86 3300010167 Ga0123353_10009281 Ga0123353_100092816 114
87 3300010167 Ga0123353_10030511 Ga0123353_100305116 114
88 3300010167 Ga0123353_10078461 Ga0123353_100784616 114
89 3300010167 Ga0123353_10829673 Ga0123353_108296732 114
90 3300038395 Ga0415639_120207 Ga0415639_120207_519_863 114
91 3300042603 Ga0466714_018373 Ga0466714_018373_236_580 114
92 3300042604 Ga0466717_157974 Ga0466717_157974_116_460 114
93 3300042607 Ga0466720_134662 Ga0466720_134662_51_395 114
94 iso_pr_bacteria 2019105004 2020342120 114
95 iso_pr_bacteria 2065487017 2067071021 114
96 3300005201 Ga0072941_1576552 Ga0072941_15765521 115
97 3300010049 Ga0123356_10095041 Ga0123356_100950415 115
98 3300010049 Ga0123356_10548570 Ga0123356_105485702 115
99 3300010049 Ga0123356_11408866 Ga0123356_114088662 115
100 3300010167 Ga0123353_10001086 Ga0123353_100010866 115
101 3300010167 Ga0123353_10259555 Ga0123353_102595555 115
102 3300010167 Ga0123353_12783047 Ga0123353_127830471 115
103 3300010167 Ga0123353_13365129 Ga0123353_133651291 115
104 3300042600 Ga0466700_054377 Ga0466700_054377_662_1009 115
105 3300042621 Ga0466729_133078 Ga0466729_133078_30412_30759 115
106 3300042655 Ga0466727_175260 Ga0466727_175260_452_799 115
107 3300009784 Ga0123357_10388060 Ga0123357_103880603 116
108 3300010049 Ga0123356_12382954 Ga0123356_123829542 116
109 3300010167 Ga0123353_10507838 Ga0123353_105078382 116
110 3300010167 Ga0123353_10507838 Ga0123353_105078382 116
111 3300010049 Ga0123356_12494908 Ga0123356_124949082 119
112 3300010049 Ga0123356_12494908 Ga0123356_124949082 119
113 3300010167 Ga0123353_10312933 Ga0123353_103129334 119
114 3300009826 Ga0123355_10731364 Ga0123355_107313643 138
115 3300009826 Ga0123355_10731364 Ga0123355_107313643 138

🧩 MSA Aligner

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.75 0.81 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.