Protein Family IF02553

Metagenome Isolate
154 Members
66 Samples
132 Scaffolds
315.18 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10435961|Ga0123355_104359612
Length
360 aa
Sequence
MAMAHNLICAVFLNEERTTFVQKLSKFLVIHHCLMLIKEEPQMNSKVAVLIPCYNESLTIAKVVAEFKQALPNADIYVFDNNSTDGSDELAKSAGAIVHYEYKQGKGNVMRTMFRDIQADCYLMTDADDAFPADIAQSMINLILEGKADMVCGDRLSSTYFSQNKRRFHGAGNIIIKKLVNIFFGGNIKDIMTGYRAFSPLFVKTFPILSKGFEIETEMTIHALDKNLKIIEMPAQYRDRPEGSVSKLHTFKDGFKVLLTIFTLVKDYRPLPFFSLFALLLTALSGILFAPVFIEYLQTGLVPRFPTLIVSMFMLLSALLSLSCGLILDSLKRRERQEMEFKLNLMQMIRYSNANKEKK*

📊 Sample Types

Isolate 14.3%
Metagenome 85.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 30.8%
Termitidae 24.6%
Kalotermitidae 21.5%
Apidae 9.2%
Termopsidae 4.6%
Rhinotermitidae 3.1%
Hodotermitidae 1.5%
Dytiscidae 1.5%
Passalidae 1.5%
Cerambycidae 1.5%

🌳 Taxonomy

Archaea 0
Bacteria 140
Eukaryota 0
Viruses 0
Unclassified 14

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 8110340172 Bifidobacterium choladohabitans B14384H11 Isolate Apidae
2 2820367663 Unclassified Firmicutes Nt197P3bin105 Isolate Unclassified
3 2756170272 Convivina intestini DSM 28795 Isolate Unclassified
4 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
5 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
6 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
7 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
8 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
9 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
10 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
11 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
12 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
13 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
14 2820873081 Unclassified Actinobacteria Lab288P1bin96 Isolate Unclassified
15 2820907832 Unclassified Actinobacteria Emb289P4bin29 Isolate Unclassified
16 2820921285 Unclassified Actinobacteria Emb289P3bin53 Isolate Unclassified
17 2820285501 Unclassified Firmicutes Th196P3bin142 Isolate Unclassified
18 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
19 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
20 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
21 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
22 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
23 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
24 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
25 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
26 2820939604 Unclassified Actinobacteria Emb289P1bin4 Isolate Unclassified
27 2873632256 Weissella coleopterorum HDW19 Isolate Dytiscidae
28 2820292184 Unclassified Firmicutes Th196P3bin109 Isolate Unclassified
29 2820737921 Unclassified Bacteroidetes Th196P4bin18 Isolate Unclassified
30 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
31 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
32 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
33 8024982947 Bifidobacterium asteroides ESL0200 Isolate Apidae
34 2568526170 Bifidobacterium sp. A11 Isolate Apidae
35 2820412446 Unclassified Firmicutes Lab288P4bin39 Isolate Unclassified
36 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
37 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
38 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
39 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
40 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
41 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
42 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
43 2820833147 Unclassified Actinobacteria Lab288P4bin85 Isolate Unclassified
44 2820870086 Unclassified Actinobacteria Lab288P3bin107 Isolate Unclassified
45 2820871393 Unclassified Actinobacteria Lab288P3bin101 Isolate Unclassified
46 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
47 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
48 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
49 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
50 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
51 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
52 2820942695 Unclassified Actinobacteria Cu122P5bin37 Isolate Unclassified
53 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
54 2684622920 Bifidobacterium asteroides Bi_200 Isolate Unclassified
55 2651870343 Fructobacillus sp. EFB-N1 Isolate Apidae
56 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
57 2084038013 Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae Metagenome Cerambycidae
58 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
59 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
60 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
61 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
62 2820880921 Unclassified Actinobacteria Lab288P1bin60 Isolate Unclassified
63 2820934415 Unclassified Actinobacteria Emb289P1bin68 Isolate Unclassified
64 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
65 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
66 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466656_365506 3300042550 Bacteria 2520
2 Ga0466711_292280 3300042615 Bacteria 2761
3 Ga0466723_062833 3300042618 Bacteria 23048
4 Ga0466726_070115 3300042619 Bacteria 6897
5 Ga0466726_099866 3300042619 Bacteria 3210
6 Ga0466728_245975 3300042620 Bacteria 3021
7 Ga0466728_484564 3300042620 Bacteria 1978
8 Ga0466735_207335 3300042624 Bacteria 2839
9 Ga0466707_093312 3300042601 Bacteria 3896
10 Ga0466707_205073 3300042601 Bacteria 53746
11 Ga0466713_133121 3300042602 Bacteria 46740
12 Ga0123355_10000628 3300009826 Bacteria 47784
13 Ga0123355_10083889 3300009826 Unclassified 5077
14 Ga0123353_10008776 3300010167 Bacteria 13848
15 Ga0123353_10026030 3300010167 Unclassified 8925
16 Ga0123353_10196866 3300010167 Bacteria 3175
17 Ga0123353_10206951 3300010167 Bacteria 3081
18 Ga0123353_10626616 3300010167 Bacteria 1529
19 Ga0123353_10818488 3300010167 Bacteria 1283
20 Ga0466732_188928 3300042656 Bacteria 1203
21 Ga0466696_155696 3300042596 Bacteria 3049
22 Ga0466712_124917 3300042614 Bacteria 16363
23 Ga0466715_089915 3300042616 Bacteria 43716
24 Ga0466723_321084 3300042618 Bacteria 2623
25 Ga0466728_011518 3300042620 Bacteria 8454
26 Ga0466703_117580 3300042636 Bacteria 35608
27 Ga0466722_239506 3300042609 Bacteria 3782
28 Ga0123357_10472201 3300009784 Bacteria 1068
29 Ga0123355_10435961 3300009826 Unclassified 1663
30 Ga0123356_10063912 3300010049 Bacteria 3440
31 Ga0123356_10193839 3300010049 Bacteria 2065
32 Ga0123353_10000049 3300010167 Bacteria 131325
33 Ga0123353_10385640 3300010167 Bacteria 2093
34 Ga0123353_10523901 3300010167 Bacteria 1719
35 Ga0123354_10078385 3300010882 Bacteria 4697
36 Ga0466727_091964 3300042655 Bacteria 2965
37 Ga0466700_062180 3300042600 Bacteria 11765
38 2227108568 2225789004 Bacteria 39212
39 JGI24702J35022_10015399 3300002462 Bacteria 4210
40 Ga0123353_10028946 3300010167 Bacteria 8526
41 Ga0123353_10070277 3300010167 Unclassified 5625
42 Ga0123353_10164655 3300010167 Bacteria 3526
43 Ga0466733_016466 3300042659 Bacteria 11010
44 Ga0466690_279151 3300042590 Unclassified 1994
45 Ga0466695_282062 3300042595 Bacteria 2206
46 Ga0466705_434874 3300042612 Bacteria 13977
47 Ga0466728_036972 3300042620 Bacteria 13453
48 Ga0466728_356632 3300042620 Unclassified 6528
49 Ga0466703_053569 3300042636 Unclassified 2072
50 Ga0466716_181544 3300042605 Bacteria 3820
51 AglaG_contig25748 2084038013 Bacteria 12359
52 HBC_ctgsDRAFT_1023288 3300000333 Bacteria 1517
53 JGI24705J35276_12237762 3300002504 Bacteria 12959
54 Ga0123357_10052602 3300009784 Bacteria 5499
55 Ga0123356_10005593 3300010049 Bacteria 12784
56 Ga0123356_10054453 3300010049 Bacteria 3726
57 Ga0123356_10059910 3300010049 Bacteria 3552
58 Ga0123356_10362692 3300010049 Bacteria 1576
59 Ga0123353_10000181 3300010167 Bacteria 80450
60 Ga0123353_10423601 3300010167 Bacteria 1971
61 Ga0466697_066164 3300042611 Bacteria 3944
62 Ga0264413_128986 3300024493 Bacteria 6564
63 Ga0466690_260943 3300042590 Bacteria 1639
64 Ga0466691_199275 3300042593 Bacteria 2320
65 Ga0466705_399832 3300042612 Bacteria 4739
66 Ga0466729_124520 3300042621 Bacteria 2352
67 Ga0466704_144800 3300042643 Bacteria 19711
68 Ga0466706_045532 3300042599 Bacteria 3808
69 Ga0466707_395995 3300042601 Bacteria 2354
70 Ga0466713_019666 3300042602 Bacteria 67660
71 Ga0466716_269390 3300042605 Bacteria 7274
72 Ga0466719_066860 3300042606 Bacteria 19321
73 Ga0123357_10041002 3300009784 Bacteria 6296
74 Ga0123357_10240173 3300009784 Bacteria 1964
75 Ga0123355_10000019 3300009826 Bacteria 155447
76 Ga0123355_10234756 3300009826 Bacteria 2611
77 Ga0123356_10231830 3300010049 Bacteria 1911
78 Ga0123356_10512183 3300010049 Bacteria 1357
79 Ga0466697_226291 3300042611 Bacteria 1348
80 Ga0466705_128995 3300042612 Bacteria 2148
81 Ga0466733_052543 3300042659 Bacteria 2567
82 Ga0466691_199056 3300042593 Bacteria 4520
83 Ga0466696_441932 3300042596 Bacteria 3567
84 Ga0466711_194018 3300042615 Bacteria 2388
85 Ga0466726_115727 3300042619 Bacteria 5099
86 Ga0466728_246314 3300042620 Bacteria 2103
87 Ga0466703_219620 3300042636 Bacteria 7749
88 Ga0466704_298669 3300042643 Bacteria 6668
89 Ga0466724_17703 3300042649 Bacteria 7055
90 Ga0466713_099093 3300042602 Bacteria 8251
91 Ga0466713_102403 3300042602 Bacteria 56108
92 Ga0466713_131327 3300042602 Bacteria 7047
93 Ga0466716_457707 3300042605 Unclassified 2671
94 Ga0466719_249511 3300042606 Bacteria 22228
95 Ga0466722_173348 3300042609 Bacteria 1005
96 Ga0068305_10009288 3300005083 Unclassified 6585
97 Ga0074278_106802 3300005721 Unclassified 1995
98 Ga0123357_10000075 3300009784 Bacteria 78678
99 Ga0123355_10028504 3300009826 Bacteria 9028
100 Ga0123354_10239382 3300010882 Bacteria 1872
101 Ga0466697_091809 3300042611 Bacteria 1149
102 Ga0466705_097553 3300042612 Bacteria 17096
103 Ga0466705_279506 3300042612 Bacteria 7521
104 Ga0466705_303497 3300042612 Bacteria 14374
105 Ga0466732_057104 3300042656 Bacteria 2507
106 Ga0466696_195034 3300042596 Bacteria 3799
107 Ga0466715_080954 3300042616 Bacteria 158723
108 Ga0466723_070657 3300042618 Unclassified 3904
109 Ga0466728_105369 3300042620 Bacteria 20110
110 Ga0466702_001075 3300042635 Bacteria 4345
111 Ga0466703_275384 3300042636 Bacteria 3875
112 Ga0466704_163825 3300042643 Bacteria 2375
113 Ga0123356_10005575 3300010049 Bacteria 12798
114 Ga0123353_10204334 3300010167 Bacteria 3105
115 Ga0123354_10000166 3300010882 Bacteria 53754
116 Ga0123354_10138163 3300010882 Bacteria 3033
117 Ga0466733_192122 3300042659 Bacteria 6070
118 Ga0466705_435278 3300042612 Bacteria 1072
119 Ga0466711_465749 3300042615 Bacteria 10838
120 Ga0466715_008622 3300042616 Bacteria 9831
121 Ga0466715_034626 3300042616 Bacteria 2197
122 Ga0466723_148153 3300042618 Unclassified 2063
123 Ga0466702_066288 3300042635 Bacteria 2100
124 Ga0466703_054491 3300042636 Bacteria 2070
125 Ga0466704_048650 3300042643 Unclassified 18367
126 Ga0466704_479714 3300042643 Bacteria 5602
127 Ga0466709_352149 3300042648 Bacteria 153873
128 Ga0466708_372741 3300042652 Bacteria 2851
129 Ga0466727_284097 3300042655 Bacteria 24358
130 Ga0466719_364633 3300042606 Bacteria 1387
131 Ga0123355_10001043 3300009826 Bacteria 38382
132 Ga0123353_10443371 3300010167 Unclassified 1914

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042611 Ga0466697_226291 Ga0466697_226291_265_1275 288
2 3300042612 Ga0466705_399832 Ga0466705_399832_3680_4600 291
3 3300009784 Ga0123357_10000075 Ga0123357_1000007544 292
4 3300010167 Ga0123353_10070277 Ga0123353_100702772 293
5 3300042602 Ga0466713_102403 Ga0466713_102403_50471_51409 293
6 3300042611 Ga0466697_091809 Ga0466697_091809_43_924 293
7 3300010167 Ga0123353_10204334 Ga0123353_102043342 294
8 3300010167 Ga0123353_10523901 Ga0123353_105239012 294
9 3300042595 Ga0466695_282062 Ga0466695_282062_723_1631 294
10 3300042609 Ga0466722_173348 Ga0466722_173348_28_912 294
11 3300042606 Ga0466719_066860 Ga0466719_066860_17742_18629 295
12 iso_pr_bacteria 2820871393 2820872852 296
13 3300010167 Ga0123353_10443371 Ga0123353_104433712 297
14 3300042590 Ga0466690_279151 Ga0466690_279151_457_1449 298
15 3300010049 Ga0123356_10005593 Ga0123356_100055939 299
16 3300010167 Ga0123353_10626616 Ga0123353_106266161 299
17 3300010049 Ga0123356_10005575 Ga0123356_100055752 300
18 3300010167 Ga0123353_10423601 Ga0123353_104236012 301
19 3300042590 Ga0466690_260943 Ga0466690_260943_82_1002 301
20 3300042655 Ga0466727_284097 Ga0466727_284097_9760_10710 301
21 3300042599 Ga0466706_045532 Ga0466706_045532_1469_2419 302
22 iso_pr_bacteria 2820737921 2820739414 302
23 3300042600 Ga0466700_062180 Ga0466700_062180_504_1415 303
24 3300042611 Ga0466697_066164 Ga0466697_066164_336_1247 303
25 3300042636 Ga0466703_117580 Ga0466703_117580_21701_22651 303
26 3300042649 Ga0466724_17703 Ga0466724_17703_2921_3832 303
27 3300005083 Ga0068305_10009288 Ga0068305_100092887 304
28 3300042606 Ga0466719_364633 Ga0466719_364633_132_1046 304
29 3300002462 JGI24702J35022_10015399 JGI24702J35022_100153992 305
30 3300010049 Ga0123356_10059910 Ga0123356_100599103 305
31 3300042636 Ga0466703_053569 Ga0466703_053569_713_1630 305
32 3300042636 Ga0466703_054491 Ga0466703_054491_711_1628 305
33 3300009826 Ga0123355_10000628 Ga0123355_1000062822 306
34 3300024493 Ga0264413_128986 Ga0264413_1289864 306
35 3300042550 Ga0466656_365506 Ga0466656_365506_1007_1927 306
36 3300042612 Ga0466705_434874 Ga0466705_434874_11789_12709 306
37 3300042612 Ga0466705_435278 Ga0466705_435278_49_969 306
38 3300042624 Ga0466735_207335 Ga0466735_207335_620_1540 306
39 3300042643 Ga0466704_479714 Ga0466704_479714_399_1319 306
40 3300042648 Ga0466709_352149 Ga0466709_352149_82139_83059 306
41 3300042619 Ga0466726_115727 Ga0466726_115727_2859_3782 307
42 3300042655 Ga0466727_091964 Ga0466727_091964_1008_1931 307
43 2225789004 2227108568 2227495436 308
44 3300009784 Ga0123357_10472201 Ga0123357_104722011 308
45 3300042601 Ga0466707_395995 Ga0466707_395995_247_1173 308
46 3300042605 Ga0466716_269390 Ga0466716_269390_3840_4766 308
47 3300042612 Ga0466705_128995 Ga0466705_128995_1048_2013 308
48 3300042621 Ga0466729_124520 Ga0466729_124520_1081_2007 308
49 iso_pr_bacteria 2820833147 2820833902 308
50 iso_pr_bacteria 2820921285 2820921787 308
51 iso_pr_bacteria 2820942695 2820943142 308
52 3300009784 Ga0123357_10240173 Ga0123357_102401732 309
53 3300010167 Ga0123353_10000049 Ga0123353_1000004997 309
54 3300010882 Ga0123354_10000166 Ga0123354_1000016658 309
55 3300042593 Ga0466691_199056 Ga0466691_199056_166_1125 309
56 3300042619 Ga0466726_099866 Ga0466726_099866_676_1605 309
57 3300042643 Ga0466704_298669 Ga0466704_298669_3924_4853 309
58 3300042656 Ga0466732_057104 Ga0466732_057104_414_1343 309
59 iso_pr_bacteria 2820907832 2820907875 309
60 2084038013 AglaG_contig25748 AglaG_04150660 310
61 3300002504 JGI24705J35276_12237762 JGI24705J35276_122377625 310
62 3300009784 Ga0123357_10041002 Ga0123357_100410024 310
63 3300010167 Ga0123353_10196866 Ga0123353_101968663 310
64 3300010882 Ga0123354_10239382 Ga0123354_102393821 310
65 3300042615 Ga0466711_292280 Ga0466711_292280_210_1142 310
66 3300042620 Ga0466728_105369 Ga0466728_105369_7104_8036 310
67 3300009784 Ga0123357_10052602 Ga0123357_100526022 311
68 3300010049 Ga0123356_10231830 Ga0123356_102318302 311
69 3300010049 Ga0123356_10512183 Ga0123356_105121831 311
70 3300010167 Ga0123353_10206951 Ga0123353_102069512 311
71 3300010167 Ga0123353_10385640 Ga0123353_103856401 311
72 3300010167 Ga0123353_10818488 Ga0123353_108184882 311
73 3300010882 Ga0123354_10138163 Ga0123354_101381632 311
74 3300042620 Ga0466728_356632 Ga0466728_356632_2175_3110 311
75 3300042635 Ga0466702_001075 Ga0466702_001075_1377_2312 311
76 3300042659 Ga0466733_052543 Ga0466733_052543_787_1722 311
77 3300042605 Ga0466716_457707 Ga0466716_457707_1355_2293 312
78 3300042612 Ga0466705_097553 Ga0466705_097553_8199_9137 312
79 3300042619 Ga0466726_070115 Ga0466726_070115_2730_3668 312
80 3300042643 Ga0466704_048650 Ga0466704_048650_11255_12193 312
81 3300042659 Ga0466733_192122 Ga0466733_192122_2181_3119 312
82 iso_pr_bacteria 2651870343 2654486998 312
83 3300009826 Ga0123355_10000019 Ga0123355_1000001913 313
84 3300042606 Ga0466719_249511 Ga0466719_249511_13455_14396 313
85 3300042659 Ga0466733_016466 Ga0466733_016466_4986_5927 313
86 3300010882 Ga0123354_10078385 Ga0123354_100783854 314
87 3300042596 Ga0466696_155696 Ga0466696_155696_517_1461 314
88 3300042652 Ga0466708_372741 Ga0466708_372741_1850_2794 314
89 iso_pr_bacteria 2820292184 2820292586 314
90 3300010049 Ga0123356_10193839 Ga0123356_101938391 315
91 3300010167 Ga0123353_10026030 Ga0123353_100260303 315
92 3300042614 Ga0466712_124917 Ga0466712_124917_5130_6077 315
93 3300042620 Ga0466728_246314 Ga0466728_246314_209_1156 315
94 3300042612 Ga0466705_303497 Ga0466705_303497_12668_13618 316
95 3300042615 Ga0466711_194018 Ga0466711_194018_20_970 316
96 3300042635 Ga0466702_066288 Ga0466702_066288_608_1558 316
97 3300042643 Ga0466704_144800 Ga0466704_144800_5189_6139 316
98 iso_pr_bacteria 2873632256 2873632388 316
99 3300009826 Ga0123355_10234756 Ga0123355_102347562 317
100 3300010167 Ga0123353_10164655 Ga0123353_101646552 317
101 3300042593 Ga0466691_199275 Ga0466691_199275_1340_2293 317
102 3300042596 Ga0466696_441932 Ga0466696_441932_492_1445 317
103 3300042602 Ga0466713_099093 Ga0466713_099093_2526_3479 317
104 3300042602 Ga0466713_131327 Ga0466713_131327_2465_3418 317
105 iso_pr_bacteria 2820285501 2820287287 317
106 3300042643 Ga0466704_163825 Ga0466704_163825_466_1449 318
107 3300042656 Ga0466732_188928 Ga0466732_188928_47_1003 318
108 iso_pr_bacteria 2756170272 2756775811 318
109 3300042596 Ga0466696_195034 Ga0466696_195034_2063_3022 319
110 3300042620 Ga0466728_036972 Ga0466728_036972_12104_13063 319
111 3300042616 Ga0466715_080954 Ga0466715_080954_274_1260 320
112 3300042618 Ga0466723_148153 Ga0466723_148153_787_1749 320
113 3300042636 Ga0466703_275384 Ga0466703_275384_997_1959 320
114 3300010049 Ga0123356_10054453 Ga0123356_100544533 321
115 3300042612 Ga0466705_279506 Ga0466705_279506_4457_5422 321
116 3300042618 Ga0466723_321084 Ga0466723_321084_983_1951 322
117 iso_pr_bacteria 2820412446 2820413809 322
118 3300009826 Ga0123355_10083889 Ga0123355_100838892 323
119 3300042618 Ga0466723_070657 Ga0466723_070657_323_1294 323
120 3300009826 Ga0123355_10001043 Ga0123355_100010434 324
121 3300042636 Ga0466703_219620 Ga0466703_219620_6201_7175 324
122 3300010167 Ga0123353_10028946 Ga0123353_100289467 325
123 3300042616 Ga0466715_008622 Ga0466715_008622_8260_9237 325
124 3300042620 Ga0466728_245975 Ga0466728_245975_1545_2522 325
125 iso_pr_bacteria 2684622920 2686088755 325
126 iso_pr_bacteria 8024982947 8024983164 325
127 iso_pr_bacteria 8110340172 8110341555 325
128 3300000333 HBC_ctgsDRAFT_1023288 HBC_ctgsDRAFT_10232882 326
129 3300005721 Ga0074278_106802 Ga0074278_1068022 326
130 3300042602 Ga0466713_133121 Ga0466713_133121_10126_11106 326
131 iso_pr_bacteria 2820367663 2820367674 326
132 3300042616 Ga0466715_089915 Ga0466715_089915_40301_41284 327
133 3300042616 Ga0466715_034626 Ga0466715_034626_763_1755 330
134 3300042620 Ga0466728_484564 Ga0466728_484564_190_1182 330
135 3300010167 Ga0123353_10008776 Ga0123353_100087764 331
136 3300042615 Ga0466711_465749 Ga0466711_465749_7765_8763 332
137 3300042602 Ga0466713_019666 Ga0466713_019666_51419_52420 333
138 3300042620 Ga0466728_011518 Ga0466728_011518_3909_4952 334
139 3300042605 Ga0466716_181544 Ga0466716_181544_2380_3387 335
140 3300010049 Ga0123356_10063912 Ga0123356_100639124 336
141 iso_pr_bacteria 2568526170 2569120408 336
142 iso_pr_bacteria 2820939604 2820940771 336
143 iso_pr_bacteria 2820880921 2820881567 338
144 iso_pr_bacteria 2820934415 2820934589 338
145 3300009826 Ga0123355_10028504 Ga0123355_100285049 341
146 3300042609 Ga0466722_239506 Ga0466722_239506_761_1798 345
147 3300042601 Ga0466707_093312 Ga0466707_093312_671_1732 353
148 3300042601 Ga0466707_205073 Ga0466707_205073_8142_9242 354
149 3300010049 Ga0123356_10362692 Ga0123356_103626922 356
150 iso_pr_bacteria 2820870086 2820870333 358
151 iso_pr_bacteria 2820873081 2820873411 358
152 3300010167 Ga0123353_10000181 Ga0123353_1000018146 359
153 3300009826 Ga0123355_10435961 Ga0123355_104359612 360
154 3300042618 Ga0466723_062833 Ga0466723_062833_309_1517 362

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00535 Glycos_transf_2 Glycosyl transferase family 2 49 198 0.92

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.76 0.81 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.