Protein Family IF02537
Metagenome
Isolate
132
Members
46
Samples
127
Scaffolds
239.39
Avg Length
Representative Sequence
- ID
- 3300009826|Ga0123355_10334952|Ga0123355_103349522
- Length
- 270 aa
- Sequence
- MSETIRGEGPVAEERKVGGLSVGKATGGRRILSLVRKELLSYLHAPAFYGAAVFFLAFTSAWLFHLSDFLAVNVASMRHYFAAFPLAFVLVVPVLTMRSWAEERKTGSVELLLTMPFSEWDLVLAKFISSYALLAGMIALTIPVPLTLIPLGNFDAGVIAAEYLGALLMGASAVALGLLLSCLSRNQAGAFLATATALLLTMLAGPLVFGMGLPYQVGRLVNFLSLPFHFEGFSRGLLDSRPIVHFLSGTFLFLFLSTRVILRGKWGKA*
Sample Types
Isolate
3.8%
Metagenome
96.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
45.5%
Kalotermitidae
27.3%
Unclassified
11.4%
Rhinotermitidae
6.8%
Termopsidae
6.8%
Hodotermitidae
2.3%
Taxonomy
Archaea
1
Bacteria
124
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 10 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 11 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 12 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 13 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 14 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 15 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 16 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 17 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 18 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 19 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 20 | 2778260940 | Unclassified Fibrobacteres Mp193P3bin36 | Isolate | Unclassified |
| 21 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 22 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 23 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 24 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 25 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 26 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 27 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 28 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 29 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 30 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 31 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 32 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 33 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 34 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 35 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 36 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 37 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 38 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 39 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 40 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 41 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 42 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 43 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 44 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 45 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 46 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123355_10334952 | 3300009826 | Bacteria | 2022 |
| 2 | Ga0123356_10002029 | 3300010049 | Bacteria | 21869 |
| 3 | Ga0466720_061137 | 3300042607 | Bacteria | 41948 |
| 4 | Ga0466722_049258 | 3300042609 | Bacteria | 20749 |
| 5 | Ga0466699_383090 | 3300042597 | Bacteria | 11846 |
| 6 | Ga0466715_246472 | 3300042616 | Bacteria | 2078 |
| 7 | Ga0466726_008879 | 3300042619 | Bacteria | 1378 |
| 8 | Ga0466729_028086 | 3300042621 | Bacteria | 3146 |
| 9 | AustNasuHG_c1002519 | 3300000089 | Bacteria | 6635 |
| 10 | JGI24698J34947_10040943 | 3300002449 | Bacteria | 2389 |
| 11 | JGI24702J35022_10152738 | 3300002462 | Bacteria | 1296 |
| 12 | Ga0466720_099210 | 3300042607 | Bacteria | 15227 |
| 13 | Ga0466722_019425 | 3300042609 | Bacteria | 27873 |
| 14 | Ga0466722_031100 | 3300042609 | Bacteria | 10578 |
| 15 | Ga0466692_040099 | 3300042591 | Bacteria | 2241 |
| 16 | Ga0466691_074144 | 3300042593 | Bacteria | 6708 |
| 17 | Ga0466694_021044 | 3300042594 | Bacteria | 1175 |
| 18 | Ga0466696_250119 | 3300042596 | Bacteria | 5645 |
| 19 | Ga0466699_058797 | 3300042597 | Bacteria | 6416 |
| 20 | Ga0466699_157008 | 3300042597 | Bacteria | 2483 |
| 21 | Ga0466699_183654 | 3300042597 | Bacteria | 1207 |
| 22 | Ga0466699_343965 | 3300042597 | Bacteria | 4212 |
| 23 | Ga0466715_091879 | 3300042616 | Bacteria | 83726 |
| 24 | Ga0466718_044091 | 3300042617 | Bacteria | 10181 |
| 25 | Ga0466718_054045 | 3300042617 | Bacteria | 19690 |
| 26 | Ga0466718_109169 | 3300042617 | Bacteria | 7804 |
| 27 | Ga0466726_403062 | 3300042619 | Bacteria | 22048 |
| 28 | Ga0466704_554496 | 3300042643 | Bacteria | 9839 |
| 29 | JGI24698J34947_10002083 | 3300002449 | Bacteria | 10700 |
| 30 | Ga0466705_169593 | 3300042612 | Bacteria | 2232 |
| 31 | Ga0466732_152928 | 3300042656 | Bacteria | 33015 |
| 32 | Ga0123355_10211670 | 3300009826 | Bacteria | 2808 |
| 33 | Ga0123356_10002661 | 3300010049 | Bacteria | 18991 |
| 34 | Ga0466706_058952 | 3300042599 | Bacteria | 1968 |
| 35 | Ga0466706_237160 | 3300042599 | Bacteria | 1428 |
| 36 | Ga0466720_010754 | 3300042607 | Bacteria | 27501 |
| 37 | Ga0466720_013670 | 3300042607 | Bacteria | 11800 |
| 38 | Ga0466720_046037 | 3300042607 | Bacteria | 1499 |
| 39 | Ga0466720_099821 | 3300042607 | Bacteria | 83537 |
| 40 | Ga0466722_234328 | 3300042609 | Bacteria | 8280 |
| 41 | Ga0264413_116767 | 3300024493 | Bacteria | 7522 |
| 42 | Ga0415639_022953 | 3300038395 | Unclassified | 1851 |
| 43 | Ga0466699_391870 | 3300042597 | Bacteria | 4069 |
| 44 | Ga0466718_015771 | 3300042617 | Bacteria | 6515 |
| 45 | Ga0466718_053877 | 3300042617 | Bacteria | 29065 |
| 46 | Ga0466727_036999 | 3300042655 | Bacteria | 2282 |
| 47 | JGI24698J34947_10007206 | 3300002449 | Unclassified | 6111 |
| 48 | JGI24698J34947_10112329 | 3300002449 | Bacteria | 1200 |
| 49 | JGI24695J34938_10013804 | 3300002450 | Bacteria | 4224 |
| 50 | JGI24695J34938_10147241 | 3300002450 | Bacteria | 964 |
| 51 | Ga0466732_358772 | 3300042656 | Bacteria | 2317 |
| 52 | Ga0123355_10011440 | 3300009826 | Bacteria | 13678 |
| 53 | Ga0123353_10525803 | 3300010167 | Bacteria | 1715 |
| 54 | Ga0466719_218829 | 3300042606 | Bacteria | 5865 |
| 55 | Ga0466720_076205 | 3300042607 | Bacteria | 1658 |
| 56 | Ga0466722_178383 | 3300042609 | Bacteria | 11850 |
| 57 | Ga0466698_414922 | 3300042610 | Unclassified | 1110 |
| 58 | Ga0264413_102249 | 3300024493 | Bacteria | 30809 |
| 59 | Ga0264413_106796 | 3300024493 | Bacteria | 14843 |
| 60 | Ga0466711_253747 | 3300042615 | Bacteria | 5356 |
| 61 | Ga0466703_120600 | 3300042636 | Bacteria | 41888 |
| 62 | AustNasuHG_c1010348 | 3300000089 | Bacteria | 3252 |
| 63 | JGI24695J34938_10006300 | 3300002450 | Bacteria | 7177 |
| 64 | JGI24695J34938_10014962 | 3300002450 | Bacteria | 3997 |
| 65 | Ga0466733_001979 | 3300042659 | Bacteria | 26522 |
| 66 | Ga0466700_149399 | 3300042600 | Bacteria | 1790 |
| 67 | Ga0466700_296073 | 3300042600 | Bacteria | 1222 |
| 68 | Ga0466720_014621 | 3300042607 | Bacteria | 102324 |
| 69 | Ga0466720_088814 | 3300042607 | Bacteria | 7177 |
| 70 | Ga0466720_158522 | 3300042607 | Bacteria | 1931 |
| 71 | Ga0466698_154920 | 3300042610 | Bacteria | 1587 |
| 72 | Ga0466694_173362 | 3300042594 | Bacteria | 9386 |
| 73 | Ga0466699_103981 | 3300042597 | Bacteria | 9010 |
| 74 | Ga0466712_015119 | 3300042614 | Bacteria | 1341 |
| 75 | Ga0466735_033546 | 3300042624 | Bacteria | 20791 |
| 76 | Ga0466709_166722 | 3300042648 | Bacteria | 10912 |
| 77 | Ga0466727_230640 | 3300042655 | Unclassified | 4531 |
| 78 | AustNasuHG_c1032863 | 3300000089 | Bacteria | 1426 |
| 79 | JGI24698J34947_10000854 | 3300002449 | Bacteria | 15334 |
| 80 | JGI24698J34947_10104233 | 3300002449 | Bacteria | 1267 |
| 81 | Ga0072941_1001886 | 3300005201 | Bacteria | 139305 |
| 82 | Ga0123356_10046367 | 3300010049 | Bacteria | 4043 |
| 83 | Ga0466700_306169 | 3300042600 | Bacteria | 2089 |
| 84 | Ga0466720_032519 | 3300042607 | Bacteria | 27812 |
| 85 | Ga0466722_002674 | 3300042609 | Bacteria | 21080 |
| 86 | Ga0264413_113560 | 3300024493 | Bacteria | 5639 |
| 87 | Ga0466692_186419 | 3300042591 | Bacteria | 2041 |
| 88 | Ga0466694_024500 | 3300042594 | Bacteria | 1165 |
| 89 | Ga0466694_187983 | 3300042594 | Bacteria | 11208 |
| 90 | Ga0466699_189177 | 3300042597 | Bacteria | 3550 |
| 91 | Ga0466712_120522 | 3300042614 | Bacteria | 21561 |
| 92 | Ga0466712_190753 | 3300042614 | Unclassified | 1918 |
| 93 | Ga0466728_070719 | 3300042620 | Bacteria | 11866 |
| 94 | Ga0466731_096254 | 3300042622 | Bacteria | 1860 |
| 95 | JGI24698J34947_10031635 | 3300002449 | Bacteria | 2784 |
| 96 | JGI24698J34947_10045727 | 3300002449 | Bacteria | 2232 |
| 97 | JGI24695J34938_10008997 | 3300002450 | Bacteria | 5617 |
| 98 | Ga0072941_1001686 | 3300005201 | Bacteria | 32962 |
| 99 | Ga0072941_1005745 | 3300005201 | Bacteria | 32528 |
| 100 | Ga0072941_1029395 | 3300005201 | Bacteria | 13349 |
| 101 | Ga0072941_1031785 | 3300005201 | Archaea | 8174 |
| 102 | Ga0466720_040905 | 3300042607 | Bacteria | 14579 |
| 103 | Ga0466720_042524 | 3300042607 | Bacteria | 19203 |
| 104 | Ga0466720_047370 | 3300042607 | Unclassified | 36123 |
| 105 | Ga0466720_130442 | 3300042607 | Bacteria | 11175 |
| 106 | Ga0466691_029530 | 3300042593 | Bacteria | 7971 |
| 107 | Ga0466699_133482 | 3300042597 | Bacteria | 1416 |
| 108 | Ga0466723_036249 | 3300042618 | Bacteria | 73443 |
| 109 | Ga0466708_155790 | 3300042652 | Bacteria | 12861 |
| 110 | Ga0466708_217223 | 3300042652 | Bacteria | 11460 |
| 111 | JGI24698J34947_10000950 | 3300002449 | Bacteria | 14745 |
| 112 | JGI24698J34947_10010090 | 3300002449 | Bacteria | 5177 |
| 113 | JGI24695J34938_10027182 | 3300002450 | Bacteria | 2707 |
| 114 | Ga0072940_1180290 | 3300005200 | Bacteria | 3976 |
| 115 | Ga0123355_10165102 | 3300009826 | Bacteria | 3325 |
| 116 | Ga0123353_10176598 | 3300010167 | Unclassified | 3386 |
| 117 | Ga0466720_189910 | 3300042607 | Bacteria | 1153 |
| 118 | Ga0466720_226248 | 3300042607 | Bacteria | 26777 |
| 119 | Ga0466693_147681 | 3300042592 | Bacteria | 5381 |
| 120 | Ga0466699_282728 | 3300042597 | Bacteria | 1406 |
| 121 | Ga0466712_018104 | 3300042614 | Bacteria | 3156 |
| 122 | Ga0466712_147526 | 3300042614 | Bacteria | 4882 |
| 123 | Ga0466718_132992 | 3300042617 | Bacteria | 39671 |
| 124 | Ga0466735_184870 | 3300042624 | Bacteria | 2396 |
| 125 | Ga0466727_095485 | 3300042655 | Bacteria | 1042 |
| 126 | Ga0466727_168495 | 3300042655 | Bacteria | 2015 |
| 127 | Ga0072940_1031790 | 3300005200 | Bacteria | 5311 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042593 | Ga0466691_029530 | Ga0466691_029530_3002_3736 | 218 |
| 2 | 3300042615 | Ga0466711_253747 | Ga0466711_253747_1085_1813 | 218 |
| 3 | 3300002450 | JGI24695J34938_10008997 | JGI24695J34938_100089973 | 219 |
| 4 | 3300042609 | Ga0466722_234328 | Ga0466722_234328_1734_2483 | 222 |
| 5 | 3300042609 | Ga0466722_178383 | Ga0466722_178383_5824_6579 | 223 |
| 6 | 3300042597 | Ga0466699_133482 | Ga0466699_133482_643_1380 | 224 |
| 7 | 3300005201 | Ga0072941_1005745 | Ga0072941_100574523 | 225 |
| 8 | 3300042614 | Ga0466712_015119 | Ga0466712_015119_274_996 | 225 |
| 9 | 3300038395 | Ga0415639_022953 | Ga0415639_022953_964_1701 | 226 |
| 10 | 3300042617 | Ga0466718_044091 | Ga0466718_044091_1374_2102 | 226 |
| 11 | 3300000089 | AustNasuHG_c1002519 | AustNasuHG_10025193 | 227 |
| 12 | 3300010167 | Ga0123353_10176598 | Ga0123353_101765983 | 227 |
| 13 | 3300042616 | Ga0466715_246472 | Ga0466715_246472_302_1030 | 227 |
| 14 | 3300042648 | Ga0466709_166722 | Ga0466709_166722_4922_5650 | 227 |
| 15 | 3300000089 | AustNasuHG_c1010348 | AustNasuHG_10103482 | 228 |
| 16 | 3300005200 | Ga0072940_1180290 | Ga0072940_11802903 | 228 |
| 17 | 3300005201 | Ga0072941_1001686 | Ga0072941_10016867 | 228 |
| 18 | 3300042609 | Ga0466722_019425 | Ga0466722_019425_12958_13692 | 228 |
| 19 | 3300042616 | Ga0466715_091879 | Ga0466715_091879_27802_28530 | 228 |
| 20 | 3300042618 | Ga0466723_036249 | Ga0466723_036249_65119_65871 | 228 |
| 21 | 3300042624 | Ga0466735_184870 | Ga0466735_184870_983_1717 | 228 |
| 22 | 3300042655 | Ga0466727_036999 | Ga0466727_036999_737_1465 | 228 |
| 23 | 3300042655 | Ga0466727_230640 | Ga0466727_230640_967_1701 | 228 |
| 24 | 3300005201 | Ga0072941_1029395 | Ga0072941_102939511 | 229 |
| 25 | 3300042606 | Ga0466719_218829 | Ga0466719_218829_2587_3315 | 229 |
| 26 | 3300042609 | Ga0466722_002674 | Ga0466722_002674_11199_11927 | 229 |
| 27 | 3300042617 | Ga0466718_053877 | Ga0466718_053877_23622_24350 | 229 |
| 28 | 3300042617 | Ga0466718_132992 | Ga0466718_132992_25991_26722 | 229 |
| 29 | 3300042624 | Ga0466735_033546 | Ga0466735_033546_15318_16043 | 229 |
| 30 | 3300042643 | Ga0466704_554496 | Ga0466704_554496_2754_3488 | 229 |
| 31 | 3300042655 | Ga0466727_095485 | Ga0466727_095485_165_911 | 229 |
| 32 | 3300002462 | JGI24702J35022_10152738 | JGI24702J35022_101527382 | 230 |
| 33 | 3300005200 | Ga0072940_1031790 | Ga0072940_10317902 | 230 |
| 34 | 3300042619 | Ga0466726_403062 | Ga0466726_403062_11415_12149 | 230 |
| 35 | 3300042607 | Ga0466720_013670 | Ga0466720_013670_6346_7095 | 231 |
| 36 | 3300042620 | Ga0466728_070719 | Ga0466728_070719_6200_6934 | 231 |
| 37 | 3300042607 | Ga0466720_042524 | Ga0466720_042524_2018_2749 | 232 |
| 38 | 3300042619 | Ga0466726_008879 | Ga0466726_008879_526_1254 | 233 |
| 39 | 3300042659 | Ga0466733_001979 | Ga0466733_001979_23994_24728 | 233 |
| 40 | 3300042612 | Ga0466705_169593 | Ga0466705_169593_516_1244 | 234 |
| 41 | 3300042636 | Ga0466703_120600 | Ga0466703_120600_28227_28961 | 234 |
| 42 | 3300002449 | JGI24698J34947_10007206 | JGI24698J34947_100072062 | 235 |
| 43 | 3300002450 | JGI24695J34938_10027182 | JGI24695J34938_100271822 | 235 |
| 44 | 3300042594 | Ga0466694_187983 | Ga0466694_187983_3506_4258 | 235 |
| 45 | 3300042609 | Ga0466722_031100 | Ga0466722_031100_6010_6744 | 235 |
| 46 | 3300042610 | Ga0466698_414922 | Ga0466698_414922_253_1005 | 235 |
| 47 | 3300042652 | Ga0466708_155790 | Ga0466708_155790_7906_8640 | 235 |
| 48 | 3300005201 | Ga0072941_1031785 | Ga0072941_10317859 | 236 |
| 49 | 3300010049 | Ga0123356_10002661 | Ga0123356_1000266114 | 236 |
| 50 | 3300024493 | Ga0264413_116767 | Ga0264413_1167672 | 236 |
| 51 | 3300042607 | Ga0466720_130442 | Ga0466720_130442_2354_3103 | 236 |
| 52 | 3300042609 | Ga0466722_049258 | Ga0466722_049258_12115_12858 | 236 |
| 53 | 3300042610 | Ga0466698_154920 | Ga0466698_154920_169_921 | 236 |
| 54 | 3300042617 | Ga0466718_015771 | Ga0466718_015771_4387_5127 | 236 |
| 55 | 3300010049 | Ga0123356_10002029 | Ga0123356_1000202913 | 237 |
| 56 | 3300010049 | Ga0123356_10046367 | Ga0123356_100463673 | 237 |
| 57 | 3300042597 | Ga0466699_058797 | Ga0466699_058797_2161_2913 | 237 |
| 58 | 3300042597 | Ga0466699_282728 | Ga0466699_282728_560_1309 | 237 |
| 59 | 3300042600 | Ga0466700_306169 | Ga0466700_306169_651_1412 | 237 |
| 60 | 3300010167 | Ga0123353_10525803 | Ga0123353_105258032 | 238 |
| 61 | 3300042597 | Ga0466699_343965 | Ga0466699_343965_2794_3546 | 238 |
| 62 | 3300042600 | Ga0466700_296073 | Ga0466700_296073_412_1179 | 238 |
| 63 | 3300042621 | Ga0466729_028086 | Ga0466729_028086_1630_2379 | 238 |
| 64 | 3300009826 | Ga0123355_10211670 | Ga0123355_102116703 | 239 |
| 65 | 3300024493 | Ga0264413_102249 | Ga0264413_10224921 | 239 |
| 66 | 3300024493 | Ga0264413_106796 | Ga0264413_1067962 | 239 |
| 67 | 3300042594 | Ga0466694_173362 | Ga0466694_173362_4417_5166 | 239 |
| 68 | 3300042597 | Ga0466699_103981 | Ga0466699_103981_6308_7060 | 239 |
| 69 | 3300042607 | Ga0466720_010754 | Ga0466720_010754_21811_22581 | 239 |
| 70 | 3300042607 | Ga0466720_014621 | Ga0466720_014621_39938_40675 | 239 |
| 71 | 3300042607 | Ga0466720_040905 | Ga0466720_040905_6157_6906 | 239 |
| 72 | 3300000089 | AustNasuHG_c1032863 | AustNasuHG_10328632 | 240 |
| 73 | 3300042593 | Ga0466691_074144 | Ga0466691_074144_2786_3508 | 240 |
| 74 | 3300042596 | Ga0466696_250119 | Ga0466696_250119_2192_2932 | 241 |
| 75 | 3300042597 | Ga0466699_183654 | Ga0466699_183654_262_1014 | 241 |
| 76 | 3300042597 | Ga0466699_189177 | Ga0466699_189177_2460_3212 | 241 |
| 77 | 3300042597 | Ga0466699_391870 | Ga0466699_391870_704_1456 | 241 |
| 78 | iso_pr_bacteria | 2778260940 | 2778357501 | 241 |
| 79 | 3300042591 | Ga0466692_040099 | Ga0466692_040099_453_1181 | 242 |
| 80 | 3300042597 | Ga0466699_383090 | Ga0466699_383090_9010_9771 | 242 |
| 81 | 3300042614 | Ga0466712_120522 | Ga0466712_120522_11411_12139 | 242 |
| 82 | 3300042614 | Ga0466712_190753 | Ga0466712_190753_611_1339 | 242 |
| 83 | 3300042655 | Ga0466727_168495 | Ga0466727_168495_105_866 | 242 |
| 84 | 3300002449 | JGI24698J34947_10002083 | JGI24698J34947_100020839 | 243 |
| 85 | 3300002449 | JGI24698J34947_10040943 | JGI24698J34947_100409432 | 243 |
| 86 | 3300005201 | Ga0072941_1001886 | Ga0072941_1001886128 | 243 |
| 87 | 3300042594 | Ga0466694_024500 | Ga0466694_024500_243_992 | 243 |
| 88 | 3300042597 | Ga0466699_157008 | Ga0466699_157008_838_1617 | 243 |
| 89 | 3300042607 | Ga0466720_099821 | Ga0466720_099821_25925_26689 | 244 |
| 90 | 3300042652 | Ga0466708_217223 | Ga0466708_217223_4957_5691 | 244 |
| 91 | 3300024493 | Ga0264413_113560 | Ga0264413_1135603 | 245 |
| 92 | 3300042607 | Ga0466720_099210 | Ga0466720_099210_11456_12226 | 245 |
| 93 | 3300042622 | Ga0466731_096254 | Ga0466731_096254_592_1329 | 245 |
| 94 | iso_pr_bacteria | 2781125646 | 2781302209 | 245 |
| 95 | iso_pr_bacteria | 2781125659 | 2781326750 | 245 |
| 96 | 3300002450 | JGI24695J34938_10006300 | JGI24695J34938_100063004 | 246 |
| 97 | 3300042591 | Ga0466692_186419 | Ga0466692_186419_1181_1951 | 246 |
| 98 | 3300042607 | Ga0466720_158522 | Ga0466720_158522_919_1689 | 246 |
| 99 | 3300042656 | Ga0466732_152928 | Ga0466732_152928_11142_11912 | 246 |
| 100 | 3300042656 | Ga0466732_358772 | Ga0466732_358772_1282_2052 | 246 |
| 101 | 3300009826 | Ga0123355_10011440 | Ga0123355_1001144011 | 248 |
| 102 | 3300042592 | Ga0466693_147681 | Ga0466693_147681_1480_2226 | 248 |
| 103 | 3300002450 | JGI24695J34938_10014962 | JGI24695J34938_100149622 | 249 |
| 104 | 3300042599 | Ga0466706_237160 | Ga0466706_237160_306_1094 | 249 |
| 105 | 3300042600 | Ga0466700_149399 | Ga0466700_149399_711_1475 | 249 |
| 106 | 3300042594 | Ga0466694_021044 | Ga0466694_021044_310_1062 | 250 |
| 107 | 3300042614 | Ga0466712_018104 | Ga0466712_018104_1802_2554 | 250 |
| 108 | 3300042614 | Ga0466712_147526 | Ga0466712_147526_444_1196 | 250 |
| 109 | iso_pr_bacteria | 2781125693 | 2781434749 | 250 |
| 110 | 3300002449 | JGI24698J34947_10000854 | JGI24698J34947_1000085414 | 251 |
| 111 | 3300002449 | JGI24698J34947_10000950 | JGI24698J34947_1000095013 | 251 |
| 112 | 3300002449 | JGI24698J34947_10010090 | JGI24698J34947_100100904 | 251 |
| 113 | 3300002449 | JGI24698J34947_10031635 | JGI24698J34947_100316352 | 251 |
| 114 | 3300002449 | JGI24698J34947_10045727 | JGI24698J34947_100457272 | 251 |
| 115 | 3300002449 | JGI24698J34947_10104233 | JGI24698J34947_101042332 | 251 |
| 116 | 3300002449 | JGI24698J34947_10112329 | JGI24698J34947_101123292 | 251 |
| 117 | 3300002450 | JGI24695J34938_10147241 | JGI24695J34938_101472412 | 253 |
| 118 | 3300042607 | Ga0466720_061137 | Ga0466720_061137_23623_24384 | 253 |
| 119 | 3300042607 | Ga0466720_076205 | Ga0466720_076205_872_1633 | 253 |
| 120 | 3300042599 | Ga0466706_058952 | Ga0466706_058952_978_1742 | 254 |
| 121 | 3300042607 | Ga0466720_032519 | Ga0466720_032519_26051_26815 | 254 |
| 122 | 3300042607 | Ga0466720_046037 | Ga0466720_046037_497_1261 | 254 |
| 123 | 3300042607 | Ga0466720_189910 | Ga0466720_189910_106_870 | 254 |
| 124 | 3300042617 | Ga0466718_054045 | Ga0466718_054045_11494_12258 | 254 |
| 125 | 3300042607 | Ga0466720_226248 | Ga0466720_226248_23134_23901 | 255 |
| 126 | 3300042617 | Ga0466718_109169 | Ga0466718_109169_3304_4071 | 255 |
| 127 | 3300042607 | Ga0466720_047370 | Ga0466720_047370_8887_9657 | 256 |
| 128 | 3300002450 | JGI24695J34938_10013804 | JGI24695J34938_100138042 | 257 |
| 129 | iso_pr_bacteria | 2781125682 | 2781409824 | 258 |
| 130 | 3300009826 | Ga0123355_10165102 | Ga0123355_101651023 | 259 |
| 131 | 3300042607 | Ga0466720_088814 | Ga0466720_088814_4293_5075 | 260 |
| 132 | 3300009826 | Ga0123355_10334952 | Ga0123355_103349522 | 270 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.79 | 0.84 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.