Protein Family IF02537

Metagenome Isolate
132 Members
46 Samples
127 Scaffolds
239.39 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10334952|Ga0123355_103349522
Length
270 aa
Sequence
MSETIRGEGPVAEERKVGGLSVGKATGGRRILSLVRKELLSYLHAPAFYGAAVFFLAFTSAWLFHLSDFLAVNVASMRHYFAAFPLAFVLVVPVLTMRSWAEERKTGSVELLLTMPFSEWDLVLAKFISSYALLAGMIALTIPVPLTLIPLGNFDAGVIAAEYLGALLMGASAVALGLLLSCLSRNQAGAFLATATALLLTMLAGPLVFGMGLPYQVGRLVNFLSLPFHFEGFSRGLLDSRPIVHFLSGTFLFLFLSTRVILRGKWGKA*

📊 Sample Types

Isolate 3.8%
Metagenome 96.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 45.5%
Kalotermitidae 27.3%
Unclassified 11.4%
Rhinotermitidae 6.8%
Termopsidae 6.8%
Hodotermitidae 2.3%

🌳 Taxonomy

Archaea 1
Bacteria 124
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
2 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
6 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
7 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
8 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
9 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
10 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
11 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
12 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
13 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
14 2781125682 Treponema sp. Lab288P1bin107 Isolate Unclassified
15 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
16 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
17 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
18 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
19 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
20 2778260940 Unclassified Fibrobacteres Mp193P3bin36 Isolate Unclassified
21 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
22 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
23 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
24 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
25 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
26 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
27 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
28 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
29 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
30 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
31 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
32 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
33 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
34 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
35 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
36 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
37 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
38 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
39 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
40 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
41 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
42 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
43 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
44 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
45 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
46 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123355_10334952 3300009826 Bacteria 2022
2 Ga0123356_10002029 3300010049 Bacteria 21869
3 Ga0466720_061137 3300042607 Bacteria 41948
4 Ga0466722_049258 3300042609 Bacteria 20749
5 Ga0466699_383090 3300042597 Bacteria 11846
6 Ga0466715_246472 3300042616 Bacteria 2078
7 Ga0466726_008879 3300042619 Bacteria 1378
8 Ga0466729_028086 3300042621 Bacteria 3146
9 AustNasuHG_c1002519 3300000089 Bacteria 6635
10 JGI24698J34947_10040943 3300002449 Bacteria 2389
11 JGI24702J35022_10152738 3300002462 Bacteria 1296
12 Ga0466720_099210 3300042607 Bacteria 15227
13 Ga0466722_019425 3300042609 Bacteria 27873
14 Ga0466722_031100 3300042609 Bacteria 10578
15 Ga0466692_040099 3300042591 Bacteria 2241
16 Ga0466691_074144 3300042593 Bacteria 6708
17 Ga0466694_021044 3300042594 Bacteria 1175
18 Ga0466696_250119 3300042596 Bacteria 5645
19 Ga0466699_058797 3300042597 Bacteria 6416
20 Ga0466699_157008 3300042597 Bacteria 2483
21 Ga0466699_183654 3300042597 Bacteria 1207
22 Ga0466699_343965 3300042597 Bacteria 4212
23 Ga0466715_091879 3300042616 Bacteria 83726
24 Ga0466718_044091 3300042617 Bacteria 10181
25 Ga0466718_054045 3300042617 Bacteria 19690
26 Ga0466718_109169 3300042617 Bacteria 7804
27 Ga0466726_403062 3300042619 Bacteria 22048
28 Ga0466704_554496 3300042643 Bacteria 9839
29 JGI24698J34947_10002083 3300002449 Bacteria 10700
30 Ga0466705_169593 3300042612 Bacteria 2232
31 Ga0466732_152928 3300042656 Bacteria 33015
32 Ga0123355_10211670 3300009826 Bacteria 2808
33 Ga0123356_10002661 3300010049 Bacteria 18991
34 Ga0466706_058952 3300042599 Bacteria 1968
35 Ga0466706_237160 3300042599 Bacteria 1428
36 Ga0466720_010754 3300042607 Bacteria 27501
37 Ga0466720_013670 3300042607 Bacteria 11800
38 Ga0466720_046037 3300042607 Bacteria 1499
39 Ga0466720_099821 3300042607 Bacteria 83537
40 Ga0466722_234328 3300042609 Bacteria 8280
41 Ga0264413_116767 3300024493 Bacteria 7522
42 Ga0415639_022953 3300038395 Unclassified 1851
43 Ga0466699_391870 3300042597 Bacteria 4069
44 Ga0466718_015771 3300042617 Bacteria 6515
45 Ga0466718_053877 3300042617 Bacteria 29065
46 Ga0466727_036999 3300042655 Bacteria 2282
47 JGI24698J34947_10007206 3300002449 Unclassified 6111
48 JGI24698J34947_10112329 3300002449 Bacteria 1200
49 JGI24695J34938_10013804 3300002450 Bacteria 4224
50 JGI24695J34938_10147241 3300002450 Bacteria 964
51 Ga0466732_358772 3300042656 Bacteria 2317
52 Ga0123355_10011440 3300009826 Bacteria 13678
53 Ga0123353_10525803 3300010167 Bacteria 1715
54 Ga0466719_218829 3300042606 Bacteria 5865
55 Ga0466720_076205 3300042607 Bacteria 1658
56 Ga0466722_178383 3300042609 Bacteria 11850
57 Ga0466698_414922 3300042610 Unclassified 1110
58 Ga0264413_102249 3300024493 Bacteria 30809
59 Ga0264413_106796 3300024493 Bacteria 14843
60 Ga0466711_253747 3300042615 Bacteria 5356
61 Ga0466703_120600 3300042636 Bacteria 41888
62 AustNasuHG_c1010348 3300000089 Bacteria 3252
63 JGI24695J34938_10006300 3300002450 Bacteria 7177
64 JGI24695J34938_10014962 3300002450 Bacteria 3997
65 Ga0466733_001979 3300042659 Bacteria 26522
66 Ga0466700_149399 3300042600 Bacteria 1790
67 Ga0466700_296073 3300042600 Bacteria 1222
68 Ga0466720_014621 3300042607 Bacteria 102324
69 Ga0466720_088814 3300042607 Bacteria 7177
70 Ga0466720_158522 3300042607 Bacteria 1931
71 Ga0466698_154920 3300042610 Bacteria 1587
72 Ga0466694_173362 3300042594 Bacteria 9386
73 Ga0466699_103981 3300042597 Bacteria 9010
74 Ga0466712_015119 3300042614 Bacteria 1341
75 Ga0466735_033546 3300042624 Bacteria 20791
76 Ga0466709_166722 3300042648 Bacteria 10912
77 Ga0466727_230640 3300042655 Unclassified 4531
78 AustNasuHG_c1032863 3300000089 Bacteria 1426
79 JGI24698J34947_10000854 3300002449 Bacteria 15334
80 JGI24698J34947_10104233 3300002449 Bacteria 1267
81 Ga0072941_1001886 3300005201 Bacteria 139305
82 Ga0123356_10046367 3300010049 Bacteria 4043
83 Ga0466700_306169 3300042600 Bacteria 2089
84 Ga0466720_032519 3300042607 Bacteria 27812
85 Ga0466722_002674 3300042609 Bacteria 21080
86 Ga0264413_113560 3300024493 Bacteria 5639
87 Ga0466692_186419 3300042591 Bacteria 2041
88 Ga0466694_024500 3300042594 Bacteria 1165
89 Ga0466694_187983 3300042594 Bacteria 11208
90 Ga0466699_189177 3300042597 Bacteria 3550
91 Ga0466712_120522 3300042614 Bacteria 21561
92 Ga0466712_190753 3300042614 Unclassified 1918
93 Ga0466728_070719 3300042620 Bacteria 11866
94 Ga0466731_096254 3300042622 Bacteria 1860
95 JGI24698J34947_10031635 3300002449 Bacteria 2784
96 JGI24698J34947_10045727 3300002449 Bacteria 2232
97 JGI24695J34938_10008997 3300002450 Bacteria 5617
98 Ga0072941_1001686 3300005201 Bacteria 32962
99 Ga0072941_1005745 3300005201 Bacteria 32528
100 Ga0072941_1029395 3300005201 Bacteria 13349
101 Ga0072941_1031785 3300005201 Archaea 8174
102 Ga0466720_040905 3300042607 Bacteria 14579
103 Ga0466720_042524 3300042607 Bacteria 19203
104 Ga0466720_047370 3300042607 Unclassified 36123
105 Ga0466720_130442 3300042607 Bacteria 11175
106 Ga0466691_029530 3300042593 Bacteria 7971
107 Ga0466699_133482 3300042597 Bacteria 1416
108 Ga0466723_036249 3300042618 Bacteria 73443
109 Ga0466708_155790 3300042652 Bacteria 12861
110 Ga0466708_217223 3300042652 Bacteria 11460
111 JGI24698J34947_10000950 3300002449 Bacteria 14745
112 JGI24698J34947_10010090 3300002449 Bacteria 5177
113 JGI24695J34938_10027182 3300002450 Bacteria 2707
114 Ga0072940_1180290 3300005200 Bacteria 3976
115 Ga0123355_10165102 3300009826 Bacteria 3325
116 Ga0123353_10176598 3300010167 Unclassified 3386
117 Ga0466720_189910 3300042607 Bacteria 1153
118 Ga0466720_226248 3300042607 Bacteria 26777
119 Ga0466693_147681 3300042592 Bacteria 5381
120 Ga0466699_282728 3300042597 Bacteria 1406
121 Ga0466712_018104 3300042614 Bacteria 3156
122 Ga0466712_147526 3300042614 Bacteria 4882
123 Ga0466718_132992 3300042617 Bacteria 39671
124 Ga0466735_184870 3300042624 Bacteria 2396
125 Ga0466727_095485 3300042655 Bacteria 1042
126 Ga0466727_168495 3300042655 Bacteria 2015
127 Ga0072940_1031790 3300005200 Bacteria 5311

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042593 Ga0466691_029530 Ga0466691_029530_3002_3736 218
2 3300042615 Ga0466711_253747 Ga0466711_253747_1085_1813 218
3 3300002450 JGI24695J34938_10008997 JGI24695J34938_100089973 219
4 3300042609 Ga0466722_234328 Ga0466722_234328_1734_2483 222
5 3300042609 Ga0466722_178383 Ga0466722_178383_5824_6579 223
6 3300042597 Ga0466699_133482 Ga0466699_133482_643_1380 224
7 3300005201 Ga0072941_1005745 Ga0072941_100574523 225
8 3300042614 Ga0466712_015119 Ga0466712_015119_274_996 225
9 3300038395 Ga0415639_022953 Ga0415639_022953_964_1701 226
10 3300042617 Ga0466718_044091 Ga0466718_044091_1374_2102 226
11 3300000089 AustNasuHG_c1002519 AustNasuHG_10025193 227
12 3300010167 Ga0123353_10176598 Ga0123353_101765983 227
13 3300042616 Ga0466715_246472 Ga0466715_246472_302_1030 227
14 3300042648 Ga0466709_166722 Ga0466709_166722_4922_5650 227
15 3300000089 AustNasuHG_c1010348 AustNasuHG_10103482 228
16 3300005200 Ga0072940_1180290 Ga0072940_11802903 228
17 3300005201 Ga0072941_1001686 Ga0072941_10016867 228
18 3300042609 Ga0466722_019425 Ga0466722_019425_12958_13692 228
19 3300042616 Ga0466715_091879 Ga0466715_091879_27802_28530 228
20 3300042618 Ga0466723_036249 Ga0466723_036249_65119_65871 228
21 3300042624 Ga0466735_184870 Ga0466735_184870_983_1717 228
22 3300042655 Ga0466727_036999 Ga0466727_036999_737_1465 228
23 3300042655 Ga0466727_230640 Ga0466727_230640_967_1701 228
24 3300005201 Ga0072941_1029395 Ga0072941_102939511 229
25 3300042606 Ga0466719_218829 Ga0466719_218829_2587_3315 229
26 3300042609 Ga0466722_002674 Ga0466722_002674_11199_11927 229
27 3300042617 Ga0466718_053877 Ga0466718_053877_23622_24350 229
28 3300042617 Ga0466718_132992 Ga0466718_132992_25991_26722 229
29 3300042624 Ga0466735_033546 Ga0466735_033546_15318_16043 229
30 3300042643 Ga0466704_554496 Ga0466704_554496_2754_3488 229
31 3300042655 Ga0466727_095485 Ga0466727_095485_165_911 229
32 3300002462 JGI24702J35022_10152738 JGI24702J35022_101527382 230
33 3300005200 Ga0072940_1031790 Ga0072940_10317902 230
34 3300042619 Ga0466726_403062 Ga0466726_403062_11415_12149 230
35 3300042607 Ga0466720_013670 Ga0466720_013670_6346_7095 231
36 3300042620 Ga0466728_070719 Ga0466728_070719_6200_6934 231
37 3300042607 Ga0466720_042524 Ga0466720_042524_2018_2749 232
38 3300042619 Ga0466726_008879 Ga0466726_008879_526_1254 233
39 3300042659 Ga0466733_001979 Ga0466733_001979_23994_24728 233
40 3300042612 Ga0466705_169593 Ga0466705_169593_516_1244 234
41 3300042636 Ga0466703_120600 Ga0466703_120600_28227_28961 234
42 3300002449 JGI24698J34947_10007206 JGI24698J34947_100072062 235
43 3300002450 JGI24695J34938_10027182 JGI24695J34938_100271822 235
44 3300042594 Ga0466694_187983 Ga0466694_187983_3506_4258 235
45 3300042609 Ga0466722_031100 Ga0466722_031100_6010_6744 235
46 3300042610 Ga0466698_414922 Ga0466698_414922_253_1005 235
47 3300042652 Ga0466708_155790 Ga0466708_155790_7906_8640 235
48 3300005201 Ga0072941_1031785 Ga0072941_10317859 236
49 3300010049 Ga0123356_10002661 Ga0123356_1000266114 236
50 3300024493 Ga0264413_116767 Ga0264413_1167672 236
51 3300042607 Ga0466720_130442 Ga0466720_130442_2354_3103 236
52 3300042609 Ga0466722_049258 Ga0466722_049258_12115_12858 236
53 3300042610 Ga0466698_154920 Ga0466698_154920_169_921 236
54 3300042617 Ga0466718_015771 Ga0466718_015771_4387_5127 236
55 3300010049 Ga0123356_10002029 Ga0123356_1000202913 237
56 3300010049 Ga0123356_10046367 Ga0123356_100463673 237
57 3300042597 Ga0466699_058797 Ga0466699_058797_2161_2913 237
58 3300042597 Ga0466699_282728 Ga0466699_282728_560_1309 237
59 3300042600 Ga0466700_306169 Ga0466700_306169_651_1412 237
60 3300010167 Ga0123353_10525803 Ga0123353_105258032 238
61 3300042597 Ga0466699_343965 Ga0466699_343965_2794_3546 238
62 3300042600 Ga0466700_296073 Ga0466700_296073_412_1179 238
63 3300042621 Ga0466729_028086 Ga0466729_028086_1630_2379 238
64 3300009826 Ga0123355_10211670 Ga0123355_102116703 239
65 3300024493 Ga0264413_102249 Ga0264413_10224921 239
66 3300024493 Ga0264413_106796 Ga0264413_1067962 239
67 3300042594 Ga0466694_173362 Ga0466694_173362_4417_5166 239
68 3300042597 Ga0466699_103981 Ga0466699_103981_6308_7060 239
69 3300042607 Ga0466720_010754 Ga0466720_010754_21811_22581 239
70 3300042607 Ga0466720_014621 Ga0466720_014621_39938_40675 239
71 3300042607 Ga0466720_040905 Ga0466720_040905_6157_6906 239
72 3300000089 AustNasuHG_c1032863 AustNasuHG_10328632 240
73 3300042593 Ga0466691_074144 Ga0466691_074144_2786_3508 240
74 3300042596 Ga0466696_250119 Ga0466696_250119_2192_2932 241
75 3300042597 Ga0466699_183654 Ga0466699_183654_262_1014 241
76 3300042597 Ga0466699_189177 Ga0466699_189177_2460_3212 241
77 3300042597 Ga0466699_391870 Ga0466699_391870_704_1456 241
78 iso_pr_bacteria 2778260940 2778357501 241
79 3300042591 Ga0466692_040099 Ga0466692_040099_453_1181 242
80 3300042597 Ga0466699_383090 Ga0466699_383090_9010_9771 242
81 3300042614 Ga0466712_120522 Ga0466712_120522_11411_12139 242
82 3300042614 Ga0466712_190753 Ga0466712_190753_611_1339 242
83 3300042655 Ga0466727_168495 Ga0466727_168495_105_866 242
84 3300002449 JGI24698J34947_10002083 JGI24698J34947_100020839 243
85 3300002449 JGI24698J34947_10040943 JGI24698J34947_100409432 243
86 3300005201 Ga0072941_1001886 Ga0072941_1001886128 243
87 3300042594 Ga0466694_024500 Ga0466694_024500_243_992 243
88 3300042597 Ga0466699_157008 Ga0466699_157008_838_1617 243
89 3300042607 Ga0466720_099821 Ga0466720_099821_25925_26689 244
90 3300042652 Ga0466708_217223 Ga0466708_217223_4957_5691 244
91 3300024493 Ga0264413_113560 Ga0264413_1135603 245
92 3300042607 Ga0466720_099210 Ga0466720_099210_11456_12226 245
93 3300042622 Ga0466731_096254 Ga0466731_096254_592_1329 245
94 iso_pr_bacteria 2781125646 2781302209 245
95 iso_pr_bacteria 2781125659 2781326750 245
96 3300002450 JGI24695J34938_10006300 JGI24695J34938_100063004 246
97 3300042591 Ga0466692_186419 Ga0466692_186419_1181_1951 246
98 3300042607 Ga0466720_158522 Ga0466720_158522_919_1689 246
99 3300042656 Ga0466732_152928 Ga0466732_152928_11142_11912 246
100 3300042656 Ga0466732_358772 Ga0466732_358772_1282_2052 246
101 3300009826 Ga0123355_10011440 Ga0123355_1001144011 248
102 3300042592 Ga0466693_147681 Ga0466693_147681_1480_2226 248
103 3300002450 JGI24695J34938_10014962 JGI24695J34938_100149622 249
104 3300042599 Ga0466706_237160 Ga0466706_237160_306_1094 249
105 3300042600 Ga0466700_149399 Ga0466700_149399_711_1475 249
106 3300042594 Ga0466694_021044 Ga0466694_021044_310_1062 250
107 3300042614 Ga0466712_018104 Ga0466712_018104_1802_2554 250
108 3300042614 Ga0466712_147526 Ga0466712_147526_444_1196 250
109 iso_pr_bacteria 2781125693 2781434749 250
110 3300002449 JGI24698J34947_10000854 JGI24698J34947_1000085414 251
111 3300002449 JGI24698J34947_10000950 JGI24698J34947_1000095013 251
112 3300002449 JGI24698J34947_10010090 JGI24698J34947_100100904 251
113 3300002449 JGI24698J34947_10031635 JGI24698J34947_100316352 251
114 3300002449 JGI24698J34947_10045727 JGI24698J34947_100457272 251
115 3300002449 JGI24698J34947_10104233 JGI24698J34947_101042332 251
116 3300002449 JGI24698J34947_10112329 JGI24698J34947_101123292 251
117 3300002450 JGI24695J34938_10147241 JGI24695J34938_101472412 253
118 3300042607 Ga0466720_061137 Ga0466720_061137_23623_24384 253
119 3300042607 Ga0466720_076205 Ga0466720_076205_872_1633 253
120 3300042599 Ga0466706_058952 Ga0466706_058952_978_1742 254
121 3300042607 Ga0466720_032519 Ga0466720_032519_26051_26815 254
122 3300042607 Ga0466720_046037 Ga0466720_046037_497_1261 254
123 3300042607 Ga0466720_189910 Ga0466720_189910_106_870 254
124 3300042617 Ga0466718_054045 Ga0466718_054045_11494_12258 254
125 3300042607 Ga0466720_226248 Ga0466720_226248_23134_23901 255
126 3300042617 Ga0466718_109169 Ga0466718_109169_3304_4071 255
127 3300042607 Ga0466720_047370 Ga0466720_047370_8887_9657 256
128 3300002450 JGI24695J34938_10013804 JGI24695J34938_100138042 257
129 iso_pr_bacteria 2781125682 2781409824 258
130 3300009826 Ga0123355_10165102 Ga0123355_101651023 259
131 3300042607 Ga0466720_088814 Ga0466720_088814_4293_5075 260
132 3300009826 Ga0123355_10334952 Ga0123355_103349522 270

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF12679 ABC2_membrane_2 ABC-2 family transporter protein 85 209 0.83
PF13346 ABC2_membrane_5 ABC-2 family transporter protein 72 202 0.77
PF12698 ABC2_membrane_3 ABC-2 family transporter protein 79 213 0.73

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.79 0.84 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.