Protein Family IF02530
Metagenome
Metatranscriptome
Isolate
163
Members
68
Samples
116
Scaffolds
76.57
Avg Length
Representative Sequence
- ID
- 3300009826|Ga0123355_10307120|Ga0123355_103071202
- Length
- 81 aa
- Sequence
- MVKEIERHGIPVVHMCTVVPISLTVGANRIVPTVAIPYPLGDPNLPPAEEKELRRKLVRKALKALCTEVDEQTVFEDKKK*
Sample Types
Isolate
28.8%
Metagenome
69.3%
MAG
0.0%
Metatranscriptome
1.8%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
38.2%
Termitidae
36.8%
Blattidae
14.7%
Passalidae
2.9%
Rhopalidae
1.5%
Kalotermitidae
1.5%
Formicidae
1.5%
Stratiomyidae
1.5%
Hodotermitidae
1.5%
Taxonomy
Archaea
0
Bacteria
153
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 2820329821 | Unclassified Firmicutes Nt197P3bin77 | Isolate | Unclassified |
| 3 | 2820483401 | Unclassified Firmicutes Lab288P1bin74 | Isolate | Unclassified |
| 4 | 2820513949 | Unclassified Firmicutes Lab288P1bin39 | Isolate | Unclassified |
| 5 | 2820535361 | Unclassified Firmicutes Lab288P1bin14 | Isolate | Unclassified |
| 6 | 2820693137 | Unclassified Firmicutes Co191P1bin70 | Isolate | Unclassified |
| 7 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 8 | 2940286528 | Lachnospiraceae bacterium PFB1-21 | Isolate | Blattidae |
| 9 | 2820271343 | Unclassified Firmicutes Th196P3bin32 | Isolate | Unclassified |
| 10 | 2820451402 | Unclassified Firmicutes Lab288P3bin174 | Isolate | Unclassified |
| 11 | 2820522177 | Unclassified Firmicutes Lab288P1bin22 | Isolate | Unclassified |
| 12 | 2820541116 | Unclassified Firmicutes Lab288P1bin109 | Isolate | Unclassified |
| 13 | 8064531044 | Terrisporobacter mayombei DSM 6539 | Isolate | Unclassified |
| 14 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 15 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 16 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 17 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 18 | 2940230426 | Lachnospiraceae bacterium PH5-48 | Isolate | Blattidae |
| 19 | 2940283334 | Lachnospiraceae bacterium PF1-4 | Isolate | Blattidae |
| 20 | 2940295490 | Lachnospiraceae bacterium PH1-22 | Isolate | Blattidae |
| 21 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 22 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 23 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 24 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 25 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 26 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 27 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 28 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 29 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 30 | 2940277027 | Lachnospiraceae bacterium PF1-21 | Isolate | Blattidae |
| 31 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 32 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 33 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 34 | 3300022232 | Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA | Metatranscriptome | Termitidae |
| 35 | 2940233634 | Lachnoclostridium sp. PF5-10 | Isolate | Blattidae |
| 36 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 37 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 38 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 39 | 2820432912 | Unclassified Firmicutes Lab288P3bin219 | Isolate | Unclassified |
| 40 | 2820501819 | Unclassified Firmicutes Lab288P1bin51 | Isolate | Unclassified |
| 41 | 2820530790 | Unclassified Firmicutes Lab288P1bin141 | Isolate | Unclassified |
| 42 | 2820547636 | Unclassified Firmicutes Lab288P1bin10 | Isolate | Unclassified |
| 43 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 44 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 45 | 2940289514 | Lachnospiraceae bacterium PM6-15 | Isolate | Blattidae |
| 46 | 2820427814 | Unclassified Firmicutes Lab288P3bin44 | Isolate | Unclassified |
| 47 | 2820504582 | Unclassified Firmicutes Lab288P1bin5 | Isolate | Unclassified |
| 48 | 2820724199 | Unclassified Cloacimonetes Th196P3bin22 | Isolate | Unclassified |
| 49 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 50 | 3300021192 | Termite gut microbial communities from nest - French Guiana - 5_4 mRNA SA | Metatranscriptome | Termitidae |
| 51 | 2940292506 | Lachnoclostridium sp. PH5-23 | Isolate | Blattidae |
| 52 | 2820422691 | Unclassified Firmicutes Lab288P3bin58 | Isolate | Unclassified |
| 53 | 2820623020 | Unclassified Firmicutes Emb289P1bin126 | Isolate | Unclassified |
| 54 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 55 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 56 | 2940280053 | Lachnospiraceae bacterium PF1-22 | Isolate | Blattidae |
| 57 | 2944625312 | Dysgonomonas sp. PF1-3 | Isolate | Blattidae |
| 58 | 2820405014 | Unclassified Firmicutes Lab288P4bin88 | Isolate | Unclassified |
| 59 | 2820435670 | Unclassified Firmicutes Lab288P3bin217 | Isolate | Unclassified |
| 60 | 2820626145 | Unclassified Firmicutes Emb289P1bin123 | Isolate | Unclassified |
| 61 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 62 | 8030337018 | Tissierella sp. Yu-01 | Isolate | Stratiomyidae |
| 63 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 64 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 65 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 66 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 67 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 68 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466693_403917 | 3300042592 | Bacteria | 1082 |
| 2 | Ga0123355_10178706 | 3300009826 | Bacteria | 3154 |
| 3 | Ga0123355_10307120 | 3300009826 | Bacteria | 2155 |
| 4 | Ga0123355_10652408 | 3300009826 | Bacteria | 1227 |
| 5 | Ga0123355_11012666 | 3300009826 | Unclassified | 880 |
| 6 | Ga0123356_11241894 | 3300010049 | Bacteria | 910 |
| 7 | Ga0123353_10339623 | 3300010167 | Bacteria | 2269 |
| 8 | Ga0123353_11092039 | 3300010167 | Bacteria | 1060 |
| 9 | Ga0123353_11992736 | 3300010167 | Bacteria | 712 |
| 10 | JGI24695J34938_10011087 | 3300002450 | Bacteria | 4881 |
| 11 | JGI24695J34938_10083084 | 3300002450 | Bacteria | 1321 |
| 12 | Ga0415639_133936 | 3300038395 | Bacteria | 2023 |
| 13 | Ga0466695_338677 | 3300042595 | Bacteria | 2864 |
| 14 | Ga0123355_10005875 | 3300009826 | Bacteria | 18071 |
| 15 | Ga0123355_10128099 | 3300009826 | Bacteria | 3917 |
| 16 | Ga0123355_10132474 | 3300009826 | Bacteria | 3837 |
| 17 | Ga0123355_10560266 | 3300009826 | Bacteria | 1377 |
| 18 | Ga0123355_10996140 | 3300009826 | Bacteria | 891 |
| 19 | Ga0123356_10012502 | 3300010049 | Bacteria | 8231 |
| 20 | Ga0123356_10100608 | 3300010049 | Bacteria | 2772 |
| 21 | Ga0123356_13682219 | 3300010049 | Bacteria | 530 |
| 22 | Ga0123353_10093911 | 3300010167 | Bacteria | 4833 |
| 23 | Ga0123353_10114510 | 3300010167 | Bacteria | 4341 |
| 24 | Ga0123353_10224508 | 3300010167 | Bacteria | 2934 |
| 25 | Ga0466707_409312 | 3300042601 | Bacteria | 4136 |
| 26 | JGI24700J35501_10921240 | 3300002508 | Bacteria | 4706 |
| 27 | Ga0123355_10000786 | 3300009826 | Bacteria | 43435 |
| 28 | Ga0123355_10007536 | 3300009826 | Bacteria | 16330 |
| 29 | Ga0123355_10053471 | 3300009826 | Bacteria | 6546 |
| 30 | Ga0123355_10139873 | 3300009826 | Bacteria | 3707 |
| 31 | Ga0123355_10317161 | 3300009826 | Unclassified | 2105 |
| 32 | Ga0123355_10410302 | 3300009826 | Bacteria | 1739 |
| 33 | Ga0123355_11048114 | 3300009826 | Bacteria | 857 |
| 34 | Ga0123355_11143580 | 3300009826 | Bacteria | 803 |
| 35 | Ga0123356_13526412 | 3300010049 | Unclassified | 542 |
| 36 | Ga0123356_13982134 | 3300010049 | Bacteria | 509 |
| 37 | Ga0123353_10934795 | 3300010167 | Unclassified | 1175 |
| 38 | Ga0123353_12176727 | 3300010167 | Bacteria | 672 |
| 39 | Ga0466700_200631 | 3300042600 | Bacteria | 1346 |
| 40 | Ga0466733_036420 | 3300042659 | Bacteria | 12541 |
| 41 | Ga0415639_023011 | 3300038395 | Bacteria | 7396 |
| 42 | Ga0466693_151258 | 3300042592 | Bacteria | 5707 |
| 43 | Ga0123355_10253567 | 3300009826 | Bacteria | 2472 |
| 44 | Ga0123355_10311939 | 3300009826 | Bacteria | 2130 |
| 45 | Ga0123355_10373280 | 3300009826 | Bacteria | 1866 |
| 46 | Ga0123355_11042628 | 3300009826 | Bacteria | 861 |
| 47 | Ga0123356_11085806 | 3300010049 | Bacteria | 969 |
| 48 | Ga0123356_12598391 | 3300010049 | Bacteria | 634 |
| 49 | Ga0123353_11018444 | 3300010167 | Bacteria | 1110 |
| 50 | Ga0123353_11851090 | 3300010167 | Unclassified | 747 |
| 51 | Ga0123353_12331616 | 3300010167 | Bacteria | 642 |
| 52 | 2227414442 | 2225789004 | Bacteria | 1055 |
| 53 | JGI24702J35022_10011032 | 3300002462 | Bacteria | 5037 |
| 54 | Ga0466725_087547 | 3300042654 | Bacteria | 6089 |
| 55 | Ga0222432_1009276 | 3300021192 | Bacteria | 615 |
| 56 | Ga0233288_1022424 | 3300022232 | Bacteria | 548 |
| 57 | Ga0255809_1104598 | 3300022820 | Bacteria | 1722 |
| 58 | Ga0123355_10000234 | 3300009826 | Bacteria | 70892 |
| 59 | Ga0123355_10189046 | 3300009826 | Bacteria | 3038 |
| 60 | Ga0123355_10530324 | 3300009826 | Bacteria | 1435 |
| 61 | Ga0123355_10695441 | 3300009826 | Bacteria | 1169 |
| 62 | Ga0123356_10138946 | 3300010049 | Bacteria | 2394 |
| 63 | Ga0123356_11503316 | 3300010049 | Bacteria | 831 |
| 64 | Ga0123353_10017084 | 3300010167 | Bacteria | 10641 |
| 65 | Ga0123353_10218643 | 3300010167 | Bacteria | 2982 |
| 66 | Ga0123353_10240350 | 3300010167 | Bacteria | 2814 |
| 67 | Ga0123353_10928071 | 3300010167 | Bacteria | 1181 |
| 68 | Ga0123353_11578432 | 3300010167 | Bacteria | 830 |
| 69 | Ga0466714_085078 | 3300042603 | Bacteria | 3460 |
| 70 | Ga0466721_066099 | 3300042608 | Bacteria | 1669 |
| 71 | IMNBL1DRAFT_c0002568 | 3300000062 | Bacteria | 12508 |
| 72 | JGI24695J34938_10617194 | 3300002450 | Bacteria | 506 |
| 73 | JGI24703J35330_11748283 | 3300002501 | Bacteria | 13053 |
| 74 | Ga0466711_149414 | 3300042615 | Bacteria | 12828 |
| 75 | Ga0123355_10023652 | 3300009826 | Unclassified | 9869 |
| 76 | Ga0123355_10219658 | 3300009826 | Bacteria | 2736 |
| 77 | Ga0123355_10246674 | 3300009826 | Bacteria | 2521 |
| 78 | Ga0123355_10290838 | 3300009826 | Bacteria | 2242 |
| 79 | Ga0123355_10317286 | 3300009826 | Unclassified | 2104 |
| 80 | Ga0123355_10794475 | 3300009826 | Bacteria | 1057 |
| 81 | Ga0123355_10922125 | 3300009826 | Bacteria | 944 |
| 82 | Ga0123355_11067739 | 3300009826 | Unclassified | 846 |
| 83 | Ga0123355_11428445 | 3300009826 | Bacteria | 681 |
| 84 | Ga0123355_11883602 | 3300009826 | Bacteria | 560 |
| 85 | Ga0123356_13715033 | 3300010049 | Bacteria | 528 |
| 86 | Ga0123353_10482427 | 3300010167 | Bacteria | 1813 |
| 87 | Ga0123353_11304362 | 3300010167 | Bacteria | 942 |
| 88 | Ga0466706_179366 | 3300042599 | Bacteria | 2693 |
| 89 | JGI24698J34947_10090504 | 3300002449 | Bacteria | 1405 |
| 90 | CVPL010L_1010365 | 3300002932 | Bacteria | 868 |
| 91 | Ga0466733_050318 | 3300042659 | Bacteria | 7142 |
| 92 | Ga0466724_39856 | 3300042649 | Bacteria | 27534 |
| 93 | Ga0466693_064662 | 3300042592 | Bacteria | 5062 |
| 94 | Ga0123355_10005491 | 3300009826 | Bacteria | 18585 |
| 95 | Ga0123355_10097226 | 3300009826 | Bacteria | 4646 |
| 96 | Ga0123355_10166761 | 3300009826 | Bacteria | 3303 |
| 97 | Ga0123355_10187801 | 3300009826 | Bacteria | 3052 |
| 98 | Ga0123355_10217120 | 3300009826 | Bacteria | 2758 |
| 99 | Ga0123355_10565855 | 3300009826 | Bacteria | 1366 |
| 100 | Ga0123355_10937300 | 3300009826 | Bacteria | 932 |
| 101 | Ga0123353_10000037 | 3300010167 | Bacteria | 145591 |
| 102 | Ga0123353_10537671 | 3300010167 | Bacteria | 1690 |
| 103 | Ga0123354_10481772 | 3300010882 | Bacteria | 981 |
| 104 | Ga0466717_168684 | 3300042604 | Bacteria | 2157 |
| 105 | Ga0466731_009151 | 3300042622 | Bacteria | 1740 |
| 106 | Ga0466725_063175 | 3300042654 | Bacteria | 1585 |
| 107 | Ga0466710_093220 | 3300042613 | Bacteria | 1351 |
| 108 | Ga0123355_10000142 | 3300009826 | Bacteria | 85673 |
| 109 | Ga0123355_10513684 | 3300009826 | Bacteria | 1470 |
| 110 | Ga0123355_10811839 | 3300009826 | Bacteria | 1040 |
| 111 | Ga0123355_11264401 | 3300009826 | Unclassified | 745 |
| 112 | Ga0123355_11580499 | 3300009826 | Bacteria | 633 |
| 113 | Ga0123353_10795741 | 3300010167 | Bacteria | 1307 |
| 114 | Ga0123354_10661855 | 3300010882 | Unclassified | 742 |
| 115 | IMNBL1DRAFT_c0168534 | 3300000062 | Bacteria | 556 |
| 116 | Ga0072940_1105194 | 3300005200 | Bacteria | 2442 |
Family Sequences
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.58 | 0.67 | Medium |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.