Protein Family IF02506

Metagenome Isolate
200 Members
111 Samples
159 Scaffolds
540.24 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10247627|Ga0123355_102476272
Length
588 aa
Sequence
MNDTKQKQLGVTLWNIADKLRGAMNADDFRDYMLSFLFLRYLSDNYEDSAKKFLGDEYLECERYIEANMLSDKTEVGSDKPADNIPYFNIEQAAKSLLLRDEDSTDTQLLTPLSVWYTQNSDDIVMFEKEMRRNNHYVIKPDYLWSNISELARTQSGELLKTLQKGFRFIENESFESAFQGLFSEVNLDSEKLGKNYETRNAMLCSIISELTKGLAEFCNENDLLGNAYEYLIGQFAAGSGKKAGEFYTPQQASSILSRIVILDSHDPSAGNNPXXXXGKRDHINNLLDFACGSGSLLIKVRDHLLPEQIGKIYGQEKNITTYNLARMNMLLHGFKVSEFEIFHGDSLSNDWNILNEMNPAKKLECDAVVANPPFSYRWTPSETLSEDFRFKSHGVAPKSAADFAFLLHGFHYLSDKGTMAIILPHGVLFRGGAEEKIRTKLLKDGNIDAVIGLPANLFFSTSIPVCILVLKKCKRPDDVLFINASEYFERGKRQNILLQEHIDKIVDTYQYRREDDKKYSRRVLMDEIEKNGYNLNISRYVSTSVEEEIVDLATVKVDLDRIEYDISNAKARHNQFLRELGLPELP*

📊 Sample Types

Isolate 20.5%
Metagenome 79.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 23.9%
Unclassified 17.4%
Formicidae 13.8%
Kalotermitidae 12.8%
Blattidae 6.4%
Culicidae 4.6%
Elmidae 3.7%
Drosophilidae 2.8%
Apidae 2.8%
Passalidae 2.8%
Hydrophilidae 1.8%
Rhinotermitidae 1.8%
Scarabaeidae 0.9%
Curculionidae 0.9%
Tenebrionidae 0.9%
Hodotermitidae 0.9%
Termopsidae 0.9%
Pteromalidae 0.9%

🌳 Taxonomy

Archaea 1
Bacteria 194
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2524614872 Arsenophonus nasoniae DSM 15247 Isolate Unclassified
2 2820477775 Unclassified Firmicutes Lab288P1bin79 Isolate Unclassified
3 2864863795 Acinetobacter johnsonii S00116 Isolate Elmidae
4 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
5 2964266314 Entomospira nematocera BR208 Isolate Culicidae
6 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
7 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
8 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
9 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
10 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
11 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
12 8001394582 Limnobaculum allomyrinae BWR-B9 Isolate Scarabaeidae
13 8011329375 Pseudomonas sp. S31 Isolate Curculionidae
14 3004010258 Citrobacter sp. JGM124 Isolate Drosophilidae
15 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
16 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
17 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
18 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
19 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
20 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
21 2781125683 Treponema sp. Lab288P1bin34 Isolate Unclassified
22 2820698910 Unclassified Firmicutes Co191P1bin64 Isolate Unclassified
23 2828301124 Sphingomonas leidyi DSM 4733 Isolate Unclassified
24 2880115952 Vibrio parahaemolyticus PB1937 Isolate Unclassified
25 2882250448 Bizionia sp. APA-3 Isolate
26 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
27 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
28 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
29 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
30 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
31 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
32 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
33 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
34 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
35 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
36 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
37 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
38 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
39 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
40 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
41 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
42 2820159668 Unclassified Proteobacteria Cu122P3bin5 Isolate Unclassified
43 2832298047 Apibacter sp. wkB309 Isolate Apidae
44 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
45 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
46 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
47 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
48 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
49 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
50 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
51 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
52 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
53 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
54 2785510743 Apibacter sp. ESL0404 Isolate Apidae
55 2850895757 Vibrio campbellii 170502 Isolate Unclassified
56 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
57 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
58 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
59 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
60 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
61 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
62 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
63 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
64 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
65 2820663833 Unclassified Firmicutes Co191P3bin41 Isolate Unclassified
66 2820737921 Unclassified Bacteroidetes Th196P4bin18 Isolate Unclassified
67 2820792843 Unclassified Bacteroidetes Cu122P3bin1 Isolate Unclassified
68 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
69 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
70 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
71 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
72 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
73 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
74 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
75 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
76 2518285616 Brachymonas chironomi DSM 19884 Isolate Unclassified
77 2597489902 Providencia rettgeri Dmel1 Isolate Drosophilidae
78 2603880165 Burkholderiales A1 Isolate Unclassified
79 2799112231 Apibacter sp. ESL0432 Isolate Unclassified
80 2836755666 Arsenophonus nasoniae FIN Isolate Pteromalidae
81 2864840607 Acinetobacter johnsonii S00071 Isolate Elmidae
82 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
83 8063589291 Entomospira nematocera BR208 Isolate Culicidae
84 3004667792 Bacteroides sp. 519 Isolate Blattidae
85 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
86 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
87 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
88 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
89 2820103659 Unclassified Proteobacteria Emb289P4bin67 Isolate Unclassified
90 2820795054 Unclassified Bacteroidetes Cu122P1bin21 Isolate Unclassified
91 2864804954 Acinetobacter johnsonii S00050 Isolate Elmidae
92 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
93 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
94 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
95 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
96 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
97 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
98 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
99 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
100 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
101 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
102 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
103 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
104 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
105 2841260384 Providencia alcalifaciens Dmel2 Isolate Drosophilidae
106 2864836148 Arcicella rosea S00070 Isolate Elmidae
107 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
108 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
109 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
110 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
111 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_047522 3300042612 Bacteria 12961
2 Ga0466733_114684 3300042659 Bacteria 4778
3 Ga0160447_102725 3300012849 Bacteria 6035
4 Ga0466694_096283 3300042594 Bacteria 4837
5 Ga0466695_253928 3300042595 Bacteria 8530
6 Ga0466735_110001 3300042624 Bacteria 2013
7 Ga0466703_078263 3300042636 Bacteria 11583
8 Ga0466709_173991 3300042648 Bacteria 6998
9 Ga0466709_299967 3300042648 Bacteria 10483
10 Ga0466708_030551 3300042652 Bacteria 10203
11 Ga0466725_016500 3300042654 Bacteria 36157
12 Ga0466711_095278 3300042615 Bacteria 9389
13 Ga0466700_165707 3300042600 Bacteria 3099
14 Ga0466700_380389 3300042600 Unclassified 3851
15 2226999822 2225789003 Bacteria 6176
16 IMNBL1DRAFT_c0004427 3300000062 Bacteria 8462
17 IMNBL1DRAFT_c0004491 3300000062 Bacteria 8355
18 IMNBL1DRAFT_c0016893 3300000062 Bacteria 3100
19 CVPL005W_1000294 3300002934 Bacteria 22286
20 CVPL005L_10000506 3300002938 Bacteria 39509
21 Ga0102739_1000455 3300007095 Bacteria 8380
22 Ga0102738_1002614 3300007141 Bacteria 2682
23 Ga0103267_1004872 3300007190 Bacteria 3706
24 Ga0466705_222137 3300042612 Bacteria 9155
25 Ga0466693_147294 3300042592 Bacteria 3681
26 Ga0466734_142074 3300042623 Bacteria 3408
27 Ga0466735_061284 3300042624 Bacteria 6910
28 Ga0466730_064130 3300042625 Bacteria 7729
29 Ga0466704_237894 3300042643 Unclassified 10281
30 Ga0466705_451081 3300042612 Bacteria 13817
31 Ga0466728_284441 3300042620 Bacteria 8287
32 Ga0466706_037111 3300042599 Bacteria 10424
33 Ga0123355_10247627 3300009826 Bacteria 2515
34 Ga0123356_10011835 3300010049 Bacteria 8493
35 Ga0123356_10237135 3300010049 Bacteria 1893
36 Ga0123353_10249582 3300010167 Bacteria 2750
37 2227303001 2225789004 Bacteria 29616
38 JGI24695J34938_10001310 3300002450 Bacteria 21669
39 JGI24695J34938_10001989 3300002450 Bacteria 16296
40 Ga0103263_100727 3300007042 Bacteria 4482
41 Ga0102736_1000882 3300007052 Bacteria 5902
42 Ga0103266_1000036 3300007067 Bacteria 136459
43 Ga0103266_1000489 3300007067 Bacteria 10771
44 Ga0102735_1001269 3300007080 Bacteria 6400
45 Ga0466697_187610 3300042611 Bacteria 10215
46 Ga0466732_242870 3300042656 Bacteria 97652
47 Ga0415639_133000 3300038395 Bacteria 2839
48 Ga0466691_110329 3300042593 Bacteria 11349
49 Ga0466691_199124 3300042593 Bacteria 8930
50 Ga0466735_051034 3300042624 Bacteria 7833
51 Ga0466730_036583 3300042625 Bacteria 5678
52 Ga0466711_310021 3300042615 Bacteria 9751
53 Ga0466728_111751 3300042620 Bacteria 9728
54 Ga0466706_143804 3300042599 Bacteria 3210
55 Ga0466719_276031 3300042606 Bacteria 2892
56 Ga0466722_196873 3300042609 Bacteria 1999
57 2227466314 2225789004 Bacteria 5140
58 JGI24695J34938_10015259 3300002450 Bacteria 3946
59 Ga0072940_1069609 3300005200 Bacteria 7314
60 Ga0102734_1000687 3300007129 Bacteria 11618
61 Ga0466697_110983 3300042611 Bacteria 1772
62 Ga0466705_316276 3300042612 Bacteria 3173
63 Ga0466733_033179 3300042659 Bacteria 4030
64 Ga0466690_169422 3300042590 Bacteria 39612
65 Ga0466696_201597 3300042596 Bacteria 5625
66 Ga0466731_138772 3300042622 Bacteria 5490
67 Ga0466724_48039 3300042649 Bacteria 20678
68 Ga0466708_199641 3300042652 Bacteria 7983
69 Ga0466708_367292 3300042652 Bacteria 6900
70 Ga0466725_270089 3300042654 Bacteria 33955
71 Ga0466715_274802 3300042616 Bacteria 12580
72 Ga0466715_365159 3300042616 Bacteria 12981
73 Ga0466706_041866 3300042599 Bacteria 8860
74 Ga0466706_243039 3300042599 Bacteria 118582
75 Ga0466716_174768 3300042605 Bacteria 4562
76 Ga0123355_10188151 3300009826 Bacteria 3048
77 Ga0123353_10026689 3300010167 Archaea 8831
78 AustNasuHG_c1015540 3300000089 Unclassified 2567
79 HBC_ctgsDRAFT_1002157 3300000333 Bacteria 4451
80 JGI24698J34947_10037586 3300002449 Bacteria 2514
81 Ga0102735_1000619 3300007080 Bacteria 10500
82 Ga0103264_1003032 3300007188 Bacteria 7671
83 Ga0103267_1000007 3300007190 Bacteria 77495
84 Ga0466733_059338 3300042659 Bacteria 11566
85 Ga0415639_003189 3300038395 Bacteria 31308
86 Ga0466690_130978 3300042590 Bacteria 9619
87 Ga0466691_171679 3300042593 Bacteria 2775
88 Ga0466695_073735 3300042595 Bacteria 9387
89 Ga0466696_476295 3300042596 Bacteria 1811
90 Ga0466734_077417 3300042623 Bacteria 3864
91 Ga0466725_166270 3300042654 Bacteria 6192
92 Ga0466711_329435 3300042615 Bacteria 12131
93 Ga0466723_010097 3300042618 Bacteria 5108
94 Ga0466714_143060 3300042603 Bacteria 1940
95 Ga0123355_10029878 3300009826 Bacteria 8829
96 Ga0123355_10249012 3300009826 Bacteria 2505
97 IMNBL1DRAFT_c0008725 3300000062 Bacteria 5123
98 Ga0102739_1002042 3300007095 Bacteria 3194
99 Ga0102740_1000006 3300007140 Bacteria 81736
100 Ga0102738_1000124 3300007141 Bacteria 22465
101 Ga0562374_0048 3300057007 Bacteria 546035
102 Ga0466657_068092 3300042582 Bacteria 157899
103 Ga0466695_372940 3300042595 Bacteria 2988
104 Ga0466696_163213 3300042596 Bacteria 3265
105 Ga0466696_163250 3300042596 Bacteria 6048
106 Ga0466729_197427 3300042621 Bacteria 17759
107 Ga0466704_507585 3300042643 Bacteria 2299
108 Ga0466724_48921 3300042649 Bacteria 62106
109 Ga0466715_225720 3300042616 Bacteria 14185
110 Ga0466728_199551 3300042620 Bacteria 8701
111 Ga0123355_10002617 3300009826 Bacteria 25544
112 Ga0123355_10012571 3300009826 Bacteria 13121
113 Ga0123355_10031799 3300009826 Bacteria 8562
114 Ga0123355_10117348 3300009826 Bacteria 4138
115 Ga0123355_10131596 3300009826 Bacteria 3854
116 Ga0123355_10183832 3300009826 Bacteria 3096
117 JGI24698J34947_10001554 3300002449 Bacteria 12146
118 JGI24698J34947_10002130 3300002449 Bacteria 10593
119 Meta3P_1000891 3300002464 Unclassified 7296
120 Ga0072941_1017138 3300005201 Bacteria 8184
121 Ga0103265_1000217 3300007068 Bacteria 9290
122 Ga0103261_1001466 3300007083 Bacteria 3771
123 Ga0102734_1000193 3300007129 Bacteria 19551
124 Ga0102737_1000439 3300007142 Bacteria 13702
125 Ga0466690_147994 3300042590 Bacteria 3145
126 Ga0466709_106644 3300042648 Bacteria 2605
127 Ga0466709_333181 3300042648 Bacteria 1789
128 Ga0466708_115938 3300042652 Unclassified 1695
129 Ga0466711_079553 3300042615 Bacteria 2972
130 Ga0466711_194010 3300042615 Bacteria 15427
131 Ga0466706_062541 3300042599 Bacteria 3210
132 Ga0466707_214625 3300042601 Bacteria 7984
133 Ga0466719_287635 3300042606 Bacteria 4759
134 Ga0466722_219399 3300042609 Bacteria 26296
135 Ga0123356_10059835 3300010049 Bacteria 3553
136 HBC_ctgsDRAFT_1007828 3300000333 Bacteria 2524
137 JGI24702J35022_10017919 3300002462 Bacteria 3866
138 Ga0072940_1213565 3300005200 Bacteria 2242
139 Ga0103266_1000010 3300007067 Bacteria 102423
140 Ga0466705_162485 3300042612 Bacteria 4915
141 Ga0466694_343645 3300042594 Bacteria 2277
142 Ga0466703_033631 3300042636 Bacteria 13045
143 Ga0466704_083555 3300042643 Bacteria 9791
144 Ga0466709_061562 3300042648 Bacteria 14740
145 Ga0466724_17851 3300042649 Bacteria 12578
146 Ga0466724_69112 3300042649 Bacteria 2756
147 Ga0466708_062073 3300042652 Bacteria 36526
148 Ga0466711_001363 3300042615 Bacteria 7083
149 Ga0466728_421585 3300042620 Bacteria 85151
150 Ga0466713_006292 3300042602 Bacteria 8412
151 Ga0466721_050053 3300042608 Bacteria 3440
152 Ga0123355_10025408 3300009826 Bacteria 9534
153 Ga0160471_100210 3300012812 Bacteria 20427
154 JGI24702J35022_10003232 3300002462 Bacteria 9858
155 JGI24702J35022_10017515 3300002462 Bacteria 3913
156 JGI24700J35501_10929089 3300002508 Bacteria 8553
157 Ga0072941_1005047 3300005201 Bacteria 68948
158 Ga0103263_100174 3300007042 Bacteria 10631
159 Ga0123357_10000780 3300009784 Bacteria 32190

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042652 Ga0466708_115938 Ga0466708_115938_17_1381 454
2 iso_pr_bacteria 2820737921 2820739719 477
3 3300002462 JGI24702J35022_10017515 JGI24702J35022_100175154 478
4 3300005201 Ga0072941_1005047 Ga0072941_100504713 482
5 3300042659 Ga0466733_059338 Ga0466733_059338_145_1638 497
6 3300009826 Ga0123355_10002617 Ga0123355_1000261723 503
7 3300002449 JGI24698J34947_10037586 JGI24698J34947_100375862 511
8 3300007080 Ga0102735_1000619 Ga0102735_10006193 513
9 3300012849 Ga0160447_102725 Ga0160447_1027252 513
10 3300042649 Ga0466724_48039 Ga0466724_48039_15909_17465 518
11 3300042582 Ga0466657_068092 Ga0466657_068092_66088_67722 519
12 3300042596 Ga0466696_476295 Ga0466696_476295_234_1796 520
13 iso_pr_bacteria 2873610414 2873610746 520
14 3300042599 Ga0466706_243039 Ga0466706_243039_17563_19191 522
15 iso_pr_bacteria 2864840607 2864841694 522
16 iso_pr_bacteria 2864863795 2864864855 522
17 3300000062 IMNBL1DRAFT_c0004491 IMNBL1DRAFT_00044916 523
18 3300042599 Ga0466706_037111 Ga0466706_037111_318_1889 523
19 iso_pr_bacteria 2864804954 2864805760 523
20 3300000089 AustNasuHG_c1015540 AustNasuHG_10155402 524
21 3300009826 Ga0123355_10012571 Ga0123355_100125715 525
22 3300009826 Ga0123355_10031799 Ga0123355_100317993 525
23 3300042648 Ga0466709_299967 Ga0466709_299967_2269_3873 525
24 iso_pr_bacteria 2820663833 2820666707 525
25 iso_pr_bacteria 2820698910 2820701250 525
26 3300002450 JGI24695J34938_10001310 JGI24695J34938_1000131019 526
27 3300009826 Ga0123355_10188151 Ga0123355_101881512 526
28 2225789004 2227303001 2227752930 527
29 3300042654 Ga0466725_270089 Ga0466725_270089_26846_28429 527
30 iso_pr_bacteria 2820477775 2820479031 528
31 3300007190 Ga0103267_1004872 Ga0103267_10048722 529
32 3300009826 Ga0123355_10249012 Ga0123355_102490121 529
33 3300042620 Ga0466728_199551 Ga0466728_199551_1817_3433 529
34 3300042616 Ga0466715_225720 Ga0466715_225720_11334_12926 530
35 3300042643 Ga0466704_507585 Ga0466704_507585_338_1972 530
36 3300000333 HBC_ctgsDRAFT_1002157 HBC_ctgsDRAFT_10021572 531
37 3300002464 Meta3P_1000891 Meta3P_10008913 531
38 3300042623 Ga0466734_142074 Ga0466734_142074_810_2405 531
39 3300042603 Ga0466714_143060 Ga0466714_143060_245_1843 532
40 3300042654 Ga0466725_166270 Ga0466725_166270_2042_3640 532
41 3300000333 HBC_ctgsDRAFT_1007828 HBC_ctgsDRAFT_10078282 533
42 3300042609 Ga0466722_196873 Ga0466722_196873_134_1735 533
43 3300042615 Ga0466711_079553 Ga0466711_079553_250_1878 533
44 3300042624 Ga0466735_051034 Ga0466735_051034_5650_7251 533
45 3300042649 Ga0466724_69112 Ga0466724_69112_825_2426 533
46 3300042656 Ga0466732_242870 Ga0466732_242870_55646_57247 533
47 3300005200 Ga0072940_1069609 Ga0072940_10696094 534
48 3300038395 Ga0415639_003189 Ga0415639_003189_14748_16352 534
49 3300042596 Ga0466696_163213 Ga0466696_163213_96_1700 534
50 3300042623 Ga0466734_077417 Ga0466734_077417_2093_3697 534
51 3300042648 Ga0466709_061562 Ga0466709_061562_12916_14520 534
52 3300042649 Ga0466724_48921 Ga0466724_48921_9299_10903 534
53 3300002462 JGI24702J35022_10003232 JGI24702J35022_100032321 535
54 3300007129 Ga0102734_1000193 Ga0102734_100019312 535
55 3300042595 Ga0466695_253928 Ga0466695_253928_488_2095 535
56 3300042601 Ga0466707_214625 Ga0466707_214625_6168_7775 535
57 3300042606 Ga0466719_276031 Ga0466719_276031_520_2127 535
58 3300042606 Ga0466719_287635 Ga0466719_287635_849_2456 535
59 3300042612 Ga0466705_222137 Ga0466705_222137_1889_3496 535
60 3300042612 Ga0466705_316276 Ga0466705_316276_1373_2980 535
61 3300042618 Ga0466723_010097 Ga0466723_010097_377_1984 535
62 3300042621 Ga0466729_197427 Ga0466729_197427_2635_4242 535
63 3300042624 Ga0466735_110001 Ga0466735_110001_46_1653 535
64 3300042625 Ga0466730_036583 Ga0466730_036583_722_2329 535
65 3300042649 Ga0466724_17851 Ga0466724_17851_7382_8989 535
66 3300042652 Ga0466708_367292 Ga0466708_367292_3091_4698 535
67 3300042659 Ga0466733_114684 Ga0466733_114684_145_1752 535
68 3300057007 Ga0562374_0048 Ga0562374_0048_159271_160878 535
69 iso_pr_bacteria 2603880165 2606015052 535
70 iso_pr_bacteria 2820159668 2820161239 535
71 iso_pr_bacteria 2820792843 2820793935 535
72 iso_pr_bacteria 2820795054 2820796543 535
73 iso_pr_bacteria 3004010258 3004010407 535
74 iso_pr_bacteria 8001394582 8001397719 535
75 iso_pr_bacteria 8011329375 8011333246 535
76 3300002449 JGI24698J34947_10001554 JGI24698J34947_100015547 536
77 3300002449 JGI24698J34947_10002130 JGI24698J34947_100021304 536
78 3300002462 JGI24702J35022_10017919 JGI24702J35022_100179194 536
79 3300002938 CVPL005L_10000506 CVPL005L_1000050624 536
80 3300007067 Ga0103266_1000489 Ga0103266_10004895 536
81 3300007068 Ga0103265_1000217 Ga0103265_10002176 536
82 3300007080 Ga0102735_1001269 Ga0102735_10012694 536
83 3300007140 Ga0102740_1000006 Ga0102740_100000662 536
84 3300007190 Ga0103267_1000007 Ga0103267_100000739 536
85 3300010049 Ga0123356_10237135 Ga0123356_102371352 536
86 3300010167 Ga0123353_10026689 Ga0123353_100266894 536
87 3300042593 Ga0466691_171679 Ga0466691_171679_109_1719 536
88 3300042600 Ga0466700_165707 Ga0466700_165707_332_1942 536
89 3300042611 Ga0466697_110983 Ga0466697_110983_120_1730 536
90 3300042616 Ga0466715_274802 Ga0466715_274802_6110_7720 536
91 3300042654 Ga0466725_016500 Ga0466725_016500_31843_33453 536
92 iso_pr_bacteria 2841260384 2841262842 536
93 3300007042 Ga0103263_100727 Ga0103263_1007274 537
94 3300007052 Ga0102736_1000882 Ga0102736_10008825 537
95 3300007095 Ga0102739_1000455 Ga0102739_10004555 537
96 3300042595 Ga0466695_073735 Ga0466695_073735_3028_4641 537
97 3300042609 Ga0466722_219399 Ga0466722_219399_7264_8877 537
98 3300042622 Ga0466731_138772 Ga0466731_138772_100_1713 537
99 3300042648 Ga0466709_106644 Ga0466709_106644_874_2487 537
100 iso_pr_bacteria 2518285616 2518643224 537
101 iso_pr_bacteria 2820103659 2820105068 537
102 3300007042 Ga0103263_100174 Ga0103263_1001744 538
103 3300007083 Ga0103261_1001466 Ga0103261_10014664 538
104 3300007095 Ga0102739_1002042 Ga0102739_10020422 538
105 3300007141 Ga0102738_1000124 Ga0102738_10001242 538
106 3300009784 Ga0123357_10000780 Ga0123357_1000078023 538
107 3300042590 Ga0466690_147994 Ga0466690_147994_1335_2951 538
108 3300042636 Ga0466703_033631 Ga0466703_033631_2695_4311 538
109 3300007067 Ga0103266_1000010 Ga0103266_10000103 539
110 3300007141 Ga0102738_1002614 Ga0102738_10026142 539
111 3300042599 Ga0466706_143804 Ga0466706_143804_19_1638 539
112 3300042615 Ga0466711_001363 Ga0466711_001363_5215_6834 539
113 3300042615 Ga0466711_095278 Ga0466711_095278_1849_3468 539
114 3300042615 Ga0466711_194010 Ga0466711_194010_9391_11010 539
115 iso_pr_bacteria 2964266314 2964266564 539
116 iso_pr_bacteria 8063589291 8063590378 539
117 3300005200 Ga0072940_1213565 Ga0072940_12135652 540
118 3300010049 Ga0123356_10059835 Ga0123356_100598352 540
119 3300042625 Ga0466730_064130 Ga0466730_064130_5807_7429 540
120 iso_pr_bacteria 2597489902 2597923276 540
121 2225789003 2226999822 2227353497 541
122 3300007188 Ga0103264_1003032 Ga0103264_10030322 541
123 3300042590 Ga0466690_130978 Ga0466690_130978_4575_6200 541
124 3300042593 Ga0466691_110329 Ga0466691_110329_1853_3478 541
125 3300042595 Ga0466695_372940 Ga0466695_372940_1289_2914 541
126 3300042596 Ga0466696_163250 Ga0466696_163250_99_1724 541
127 3300042600 Ga0466700_380389 Ga0466700_380389_128_1753 541
128 3300042605 Ga0466716_174768 Ga0466716_174768_2740_4365 541
129 3300042612 Ga0466705_047522 Ga0466705_047522_5746_7371 541
130 3300042612 Ga0466705_162485 Ga0466705_162485_653_2278 541
131 3300042620 Ga0466728_111751 Ga0466728_111751_3575_5200 541
132 3300042620 Ga0466728_421585 Ga0466728_421585_82718_84343 541
133 3300042636 Ga0466703_078263 Ga0466703_078263_4143_5768 541
134 3300042643 Ga0466704_083555 Ga0466704_083555_7138_8763 541
135 3300042643 Ga0466704_237894 Ga0466704_237894_3573_5198 541
136 3300042648 Ga0466709_173991 Ga0466709_173991_919_2544 541
137 3300042648 Ga0466709_333181 Ga0466709_333181_51_1676 541
138 3300042652 Ga0466708_030551 Ga0466708_030551_3735_5360 541
139 iso_pr_bacteria 2695420931 2698112480 541
140 iso_pr_bacteria 2873600114 2873603783 541
141 iso_pr_bacteria 2940193328 2940195607 541
142 iso_pr_bacteria 2940244548 2940248236 541
143 iso_pr_bacteria 2940248789 2940252411 541
144 iso_pr_bacteria 2940253009 2940256603 541
145 iso_pr_bacteria 2940257232 2940260755 541
146 iso_pr_bacteria 2940336608 2940338879 541
147 3300000062 IMNBL1DRAFT_c0004427 IMNBL1DRAFT_00044279 542
148 3300000062 IMNBL1DRAFT_c0016893 IMNBL1DRAFT_00168932 542
149 3300007129 Ga0102734_1000687 Ga0102734_10006875 542
150 iso_pr_bacteria 3004667792 3004669075 542
151 3300002934 CVPL005W_1000294 CVPL005W_100029410 543
152 3300042596 Ga0466696_201597 Ga0466696_201597_2037_3668 543
153 iso_pr_bacteria 2785510743 2785736301 543
154 iso_pr_bacteria 2799112231 2799234254 543
155 iso_pr_bacteria 2832298047 2832299596 543
156 3300042590 Ga0466690_169422 Ga0466690_169422_37954_39588 544
157 3300042599 Ga0466706_062541 Ga0466706_062541_75_1709 544
158 3300007142 Ga0102737_1000439 Ga0102737_10004399 545
159 3300042593 Ga0466691_199124 Ga0466691_199124_172_1809 545
160 3300042615 Ga0466711_329435 Ga0466711_329435_5578_7215 545
161 2225789004 2227466314 2227905918 546
162 iso_pr_bacteria 2828301124 2828302171 546
163 iso_pr_bacteria 2850895757 2850898429 546
164 iso_pr_bacteria 2880115952 2880118868 546
165 3300042652 Ga0466708_062073 Ga0466708_062073_855_2498 547
166 3300009826 Ga0123355_10029878 Ga0123355_100298781 548
167 3300009826 Ga0123355_10117348 Ga0123355_101173483 548
168 3300000062 IMNBL1DRAFT_c0008725 IMNBL1DRAFT_00087253 549
169 iso_pr_bacteria 2864836148 2864838689 549
170 3300042624 Ga0466735_061284 Ga0466735_061284_779_2431 550
171 iso_pr_bacteria 2882250448 2882252533 550
172 iso_pr_bacteria 2524614872 2526113973 552
173 iso_pr_bacteria 2836755666 2836760512 552
174 3300007067 Ga0103266_1000036 Ga0103266_100003615 554
175 3300042612 Ga0466705_451081 Ga0466705_451081_7544_9211 555
176 3300012812 Ga0160471_100210 Ga0160471_1002103 563
177 3300009826 Ga0123355_10183832 Ga0123355_101838322 569
178 3300042594 Ga0466694_343645 Ga0466694_343645_327_2081 569
179 3300042611 Ga0466697_187610 Ga0466697_187610_6451_8205 571
180 3300042615 Ga0466711_310021 Ga0466711_310021_1857_3572 571
181 3300038395 Ga0415639_133000 Ga0415639_133000_240_1970 576
182 3300042599 Ga0466706_041866 Ga0466706_041866_6241_7983 580
183 3300042602 Ga0466713_006292 Ga0466713_006292_4392_6137 581
184 3300042659 Ga0466733_033179 Ga0466733_033179_1238_2986 582
185 3300010167 Ga0123353_10249582 Ga0123353_102495822 583
186 3300002508 JGI24700J35501_10929089 JGI24700J35501_109290893 584
187 3300005201 Ga0072941_1017138 Ga0072941_10171385 584
188 3300042592 Ga0466693_147294 Ga0466693_147294_1773_3527 584
189 3300042594 Ga0466694_096283 Ga0466694_096283_1613_3367 584
190 3300042616 Ga0466715_365159 Ga0466715_365159_1528_3282 584
191 3300042652 Ga0466708_199641 Ga0466708_199641_5172_6926 584
192 iso_pr_bacteria 2781125683 2781410356 584
193 3300002450 JGI24695J34938_10015259 JGI24695J34938_100152592 585
194 3300009826 Ga0123355_10025408 Ga0123355_100254082 585
195 3300009826 Ga0123355_10131596 Ga0123355_101315963 585
196 3300010049 Ga0123356_10011835 Ga0123356_100118355 585
197 3300042608 Ga0466721_050053 Ga0466721_050053_167_1927 586
198 3300042620 Ga0466728_284441 Ga0466728_284441_2296_4056 586
199 3300002450 JGI24695J34938_10001989 JGI24695J34938_100019898 587
200 3300009826 Ga0123355_10247627 Ga0123355_102476272 588

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02384 N6_Mtase N-6 DNA Methylase 221 549 0.95
PF12161 HsdM_N HsdM N-terminal domain 12 210 0.86
PF07669 Eco57I Eco57I restriction-modification methylase 313 454 0.69

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF07669 GO:0006304 DNA modification BP

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.81 0.85 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.