Protein Family IF02492

Metagenome Isolate
129 Members
72 Samples
102 Scaffolds
147.11 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10218415|Ga0123355_102184153
Length
151 aa
Sequence
VTVLVQIVNESNNPLPKYQTAGAAGMDIQAYLPDGPIEIAPGERALIGTGIKVSIPSGFEIQVRSRSGMALKKGVTVANAPGTIDEDYRGEVGVIMINHGTETITVNSGDRVAQIVLQKVPRIEWSLTDMLSDTERGEGGFGSTKTLGRG*

πŸ“Š Sample Types

Isolate 20.9%
Metagenome 79.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 25.7%
Ixodidae 24.3%
Unclassified 17.1%
Kalotermitidae 17.1%
Passalidae 4.3%
Termopsidae 4.3%
Rhinotermitidae 2.9%
Hodotermitidae 1.4%
Pseudococcidae 1.4%
Armadillidiidae 1.4%

🌳 Taxonomy

Archaea 1
Bacteria 124
Eukaryota 0
Viruses 0
Unclassified 4

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2718218151 Rickettsia rickettsii Iowa Large Clone Isolate Ixodidae
2 2820080004 Unclassified Proteobacteria Lab288P4bin34 Isolate Unclassified
3 2820353569 Unclassified Firmicutes Nt197P3bin28 Isolate Unclassified
4 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
5 640753045 Rickettsia canadensis McKiel Isolate Ixodidae
6 641228503 Rickettsia massiliae MTU5 Isolate Ixodidae
7 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
8 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
9 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
10 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
11 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
12 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
13 2855972776 Rickettsia colombianensi Adcor 2 Isolate Ixodidae
14 2820056190 Unclassified Proteobacteria Nt197P4bin9 Isolate Unclassified
15 2548876780 Rickettsia sibirica BJ-90 Isolate Ixodidae
16 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
17 8068887342 Rickettsia asiatica Maytaro1284 Isolate Ixodidae
18 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
19 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
20 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
21 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
22 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
23 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
24 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
25 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
26 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
27 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
28 2834762790 Rickettsia fournieri AUS118 Isolate Unclassified
29 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
30 2811994999 Candidatus Rickettsia amblyommii An13 Isolate Ixodidae
31 638341178 Rickettsia sibirica 246 Isolate Unclassified
32 650716082 Rickettsia conorii heilongjiangensis 054 Isolate Pseudococcidae
33 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
34 2820101058 Unclassified Proteobacteria Emb289P4bin76 Isolate Unclassified
35 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
36 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
37 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
38 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
39 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
40 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
41 2548876922 Rickettsia sibirica mongolitimonae HA-91 Isolate Ixodidae
42 2556921622 Terasakiella pusilla DSM 6293 Isolate Unclassified
43 2511231061 Rickettsia slovaca 13-B Isolate Ixodidae
44 2597489904 Rickettsia helvetica C9P9 Isolate Ixodidae
45 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
46 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
47 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
48 2820789850 Unclassified Bacteroidetes Cu122P3bin3 Isolate Unclassified
49 2811995359 Rickettsia bellii An04 Isolate Ixodidae
50 640753044 Rickettsia bellii OSU 85-389 Isolate Ixodidae
51 644736403 Rickettsia peacockii Rustic Isolate Ixodidae
52 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
53 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
54 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
55 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
56 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
57 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
58 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
59 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
60 2718217968 Rickettsia rickettsii Iowa Small Clone Isolate Ixodidae
61 2582581025 Rickettsia tamurae buchneri ISO7 Isolate Ixodidae
62 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
63 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
64 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
65 644736402 Rickettsia africae ESF-5 Isolate Ixodidae
66 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
67 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
68 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
69 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
70 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
71 647533204 Rickettsia endosymbiont of Ixodes scapularis Isolate Ixodidae
72 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0068305_10085523 3300005083 Bacteria 7525
2 Ga0072941_1145457 3300005201 Bacteria 10391
3 Ga0123357_10002699 3300009784 Bacteria 20004
4 Ga0123356_13053372 3300010049 Bacteria 584
5 Ga0123354_10001008 3300010882 Bacteria 32139
6 Ga0123354_10032711 3300010882 Bacteria 8149
7 Ga0123354_10510057 3300010882 Bacteria 931
8 Ga0466707_254848 3300042601 Bacteria 1871
9 Ga0466716_021974 3300042605 Bacteria 12034
10 Ga0466719_480690 3300042606 Bacteria 3668
11 Ga0264413_149920 3300024493 Bacteria 1525
12 Ga0466691_123961 3300042593 Bacteria 12614
13 Ga0466696_383570 3300042596 Bacteria 1501
14 Ga0466696_395743 3300042596 Bacteria 2203
15 Ga0466735_126100 3300042624 Bacteria 1635
16 Ga0466735_213590 3300042624 Bacteria 9573
17 Ga0466704_000408 3300042643 Unclassified 3850
18 Ga0466704_307452 3300042643 Bacteria 9667
19 Ga0466704_388038 3300042643 Bacteria 49542
20 Ga0466727_232046 3300042655 Bacteria 1012
21 Ga0466710_097122 3300042613 Bacteria 1691
22 Ga0466711_149623 3300042615 Bacteria 5408
23 Ga0466715_387075 3300042616 Bacteria 1688
24 Ga0466723_318597 3300042618 Bacteria 1988
25 Ga0466726_254431 3300042619 Bacteria 13408
26 IMNBL1DRAFT_c0001285 3300000062 Bacteria 18910
27 Ga0123357_10163709 3300009784 Bacteria 2657
28 Ga0123357_10375283 3300009784 Bacteria 1327
29 Ga0466706_148547 3300042599 Bacteria 7590
30 Ga0466700_003507 3300042600 Bacteria 8143
31 Ga0160445_100117 3300012847 Bacteria 70337
32 Ga0466656_177309 3300042550 Bacteria 1454
33 Ga0466693_343873 3300042592 Bacteria 1659
34 Ga0466696_005519 3300042596 Bacteria 9214
35 Ga0466735_011321 3300042624 Bacteria 3645
36 Ga0466735_170175 3300042624 Bacteria 3386
37 Ga0466727_064569 3300042655 Bacteria 47217
38 2227298018 2225789004 Unclassified 1227
39 IMNBL1DRAFT_c0000125 3300000062 Bacteria 68757
40 JGI24705J35276_12231469 3300002504 Bacteria 3950
41 JGI24699J35502_10624727 3300002509 Bacteria 701
42 Ga0123357_10002140 3300009784 Bacteria 21771
43 Ga0123357_10007666 3300009784 Bacteria 13387
44 Ga0123355_10218415 3300009826 Archaea 2747
45 Ga0123353_11212894 3300010167 Bacteria 989
46 Ga0466707_417526 3300042601 Bacteria 3367
47 Ga0466713_068672 3300042602 Bacteria 133468
48 Ga0466692_162372 3300042591 Bacteria 12543
49 Ga0466696_205335 3300042596 Bacteria 5693
50 Ga0466705_175300 3300042612 Bacteria 5208
51 Ga0466704_075296 3300042643 Bacteria 42602
52 Ga0466704_231510 3300042643 Bacteria 12191
53 Ga0466709_033772 3300042648 Bacteria 16857
54 Ga0466715_035167 3300042616 Bacteria 10237
55 JGI24699J35502_11134074 3300002509 Bacteria 28335
56 Ga0123357_10000019 3300009784 Bacteria 142254
57 Ga0466733_177551 3300042659 Bacteria 11744
58 Ga0123356_11771999 3300010049 Bacteria 767
59 Ga0466707_100574 3300042601 Bacteria 1671
60 Ga0466693_105063 3300042592 Bacteria 1606
61 Ga0466703_381909 3300042636 Bacteria 7072
62 Ga0466703_425210 3300042636 Bacteria 5311
63 2227670447 2225789004 Bacteria 1900
64 JGI24705J35276_12237518 3300002504 Bacteria 11565
65 Ga0123357_10017367 3300009784 Unclassified 9520
66 Ga0123354_10001055 3300010882 Bacteria 31731
67 Ga0466707_252850 3300042601 Bacteria 49003
68 Ga0466707_289038 3300042601 Bacteria 1564
69 Ga0466722_011306 3300042609 Bacteria 1455
70 Ga0466722_260109 3300042609 Bacteria 210615
71 Ga0466708_261768 3300042652 Bacteria 7342
72 IMNBL1DRAFT_c0000715 3300000062 Bacteria 26478
73 JGI24702J35022_10092856 3300002462 Bacteria 1645
74 Ga0123357_10003901 3300009784 Bacteria 17309
75 Ga0123353_10314681 3300010167 Bacteria 2380
76 Ga0123353_11198836 3300010167 Bacteria 996
77 Ga0123353_11407311 3300010167 Bacteria 896
78 Ga0123354_10000692 3300010882 Bacteria 35955
79 Ga0466700_078267 3300042600 Bacteria 7640
80 2227108575 2225789004 Bacteria 38641
81 IMNBL1DRAFT_c0005712 3300000062 Bacteria 7017
82 JGI24695J34938_10363498 3300002450 Bacteria 638
83 Ga0123354_10037522 3300010882 Bacteria 7542
84 Ga0466692_011147 3300042591 Bacteria 45326
85 Ga0466691_110230 3300042593 Bacteria 2089
86 Ga0466735_170351 3300042624 Bacteria 1153
87 Ga0466718_103128 3300042617 Bacteria 1974
88 Ga0466723_231412 3300042618 Bacteria 3123
89 IMNBGM34_c006936 3300000036 Bacteria 1461
90 IMNBL1DRAFT_c0003932 3300000062 Bacteria 9193
91 Ga0123356_10534235 3300010049 Bacteria 1332
92 Ga0123354_10043588 3300010882 Unclassified 6895
93 Ga0123354_10056534 3300010882 Bacteria 5858
94 Ga0466700_002314 3300042600 Bacteria 2276
95 Ga0466698_086437 3300042610 Bacteria 2370
96 Ga0466692_019618 3300042591 Bacteria 5081
97 Ga0466693_309949 3300042592 Bacteria 1519
98 Ga0466694_398134 3300042594 Bacteria 1882
99 Ga0466734_059380 3300042623 Bacteria 1590
100 Ga0466704_563024 3300042643 Bacteria 7104
101 Ga0466709_326869 3300042648 Bacteria 10418
102 Ga0466723_232625 3300042618 Bacteria 6622

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042592 Ga0466693_343873 Ga0466693_343873_282_710 142
2 3300010167 Ga0123353_11198836 Ga0123353_111988362 143
3 3300042591 Ga0466692_011147 Ga0466692_011147_42886_43317 143
4 3300042592 Ga0466693_105063 Ga0466693_105063_139_570 143
5 3300042596 Ga0466696_005519 Ga0466696_005519_5481_5912 143
6 3300042596 Ga0466696_205335 Ga0466696_205335_161_592 143
7 3300042596 Ga0466696_395743 Ga0466696_395743_1015_1446 143
8 3300042600 Ga0466700_003507 Ga0466700_003507_4323_4754 143
9 3300042601 Ga0466707_254848 Ga0466707_254848_940_1371 143
10 3300042601 Ga0466707_417526 Ga0466707_417526_2286_2717 143
11 3300042605 Ga0466716_021974 Ga0466716_021974_3864_4295 143
12 3300042609 Ga0466722_011306 Ga0466722_011306_121_552 143
13 3300042613 Ga0466710_097122 Ga0466710_097122_1055_1486 143
14 3300042619 Ga0466726_254431 Ga0466726_254431_7250_7681 143
15 3300042624 Ga0466735_170175 Ga0466735_170175_395_826 143
16 3300042624 Ga0466735_213590 Ga0466735_213590_1235_1666 143
17 3300042643 Ga0466704_231510 Ga0466704_231510_2068_2499 143
18 3300042643 Ga0466704_563024 Ga0466704_563024_1366_1797 143
19 3300042655 Ga0466727_064569 Ga0466727_064569_7539_7970 143
20 2225789004 2227108575 2227495709 144
21 2225789004 2227298018 2227748273 144
22 2225789004 2227670447 2228275498 144
23 3300000062 IMNBL1DRAFT_c0000125 IMNBL1DRAFT_000012551 144
24 3300002509 JGI24699J35502_11134074 JGI24699J35502_1113407412 144
25 3300009784 Ga0123357_10163709 Ga0123357_101637092 144
26 3300010049 Ga0123356_13053372 Ga0123356_130533721 144
27 3300012847 Ga0160445_100117 Ga0160445_10011760 144
28 3300024493 Ga0264413_149920 Ga0264413_1499202 144
29 3300042550 Ga0466656_177309 Ga0466656_177309_107_541 144
30 3300042591 Ga0466692_019618 Ga0466692_019618_2556_2990 144
31 3300042593 Ga0466691_110230 Ga0466691_110230_1187_1621 144
32 3300042593 Ga0466691_123961 Ga0466691_123961_11778_12212 144
33 3300042594 Ga0466694_398134 Ga0466694_398134_1018_1452 144
34 3300042596 Ga0466696_383570 Ga0466696_383570_843_1277 144
35 3300042599 Ga0466706_148547 Ga0466706_148547_1277_1711 144
36 3300042600 Ga0466700_002314 Ga0466700_002314_474_908 144
37 3300042601 Ga0466707_100574 Ga0466707_100574_941_1375 144
38 3300042601 Ga0466707_252850 Ga0466707_252850_17881_18315 144
39 3300042601 Ga0466707_289038 Ga0466707_289038_173_607 144
40 3300042606 Ga0466719_480690 Ga0466719_480690_3171_3605 144
41 3300042610 Ga0466698_086437 Ga0466698_086437_1374_1808 144
42 3300042612 Ga0466705_175300 Ga0466705_175300_2901_3335 144
43 3300042615 Ga0466711_149623 Ga0466711_149623_4529_4963 144
44 3300042616 Ga0466715_035167 Ga0466715_035167_2488_2922 144
45 3300042616 Ga0466715_387075 Ga0466715_387075_835_1269 144
46 3300042618 Ga0466723_231412 Ga0466723_231412_2398_2832 144
47 3300042618 Ga0466723_232625 Ga0466723_232625_3594_4028 144
48 3300042618 Ga0466723_318597 Ga0466723_318597_916_1350 144
49 3300042623 Ga0466734_059380 Ga0466734_059380_639_1073 144
50 3300042624 Ga0466735_011321 Ga0466735_011321_3182_3616 144
51 3300042624 Ga0466735_126100 Ga0466735_126100_206_640 144
52 3300042636 Ga0466703_381909 Ga0466703_381909_157_591 144
53 3300042636 Ga0466703_425210 Ga0466703_425210_4775_5209 144
54 3300042643 Ga0466704_000408 Ga0466704_000408_870_1304 144
55 3300042643 Ga0466704_075296 Ga0466704_075296_27204_27638 144
56 3300042643 Ga0466704_307452 Ga0466704_307452_8508_8942 144
57 3300042648 Ga0466709_033772 Ga0466709_033772_14312_14746 144
58 3300042648 Ga0466709_326869 Ga0466709_326869_483_917 144
59 3300042652 Ga0466708_261768 Ga0466708_261768_81_515 144
60 3300042655 Ga0466727_232046 Ga0466727_232046_381_815 144
61 3300042659 Ga0466733_177551 Ga0466733_177551_1565_1999 144
62 iso_pr_bacteria 2820759988 2820762195 144
63 iso_pr_bacteria 2820789850 2820791440 144
64 3300000036 IMNBGM34_c006936 IMNBGM34_0069362 145
65 3300000062 IMNBL1DRAFT_c0000715 IMNBL1DRAFT_000071515 145
66 3300000062 IMNBL1DRAFT_c0001285 IMNBL1DRAFT_000128515 145
67 3300000062 IMNBL1DRAFT_c0003932 IMNBL1DRAFT_00039322 145
68 3300000062 IMNBL1DRAFT_c0005712 IMNBL1DRAFT_00057127 145
69 3300002462 JGI24702J35022_10092856 JGI24702J35022_100928562 145
70 3300002504 JGI24705J35276_12231469 JGI24705J35276_122314692 145
71 3300002509 JGI24699J35502_10624727 JGI24699J35502_106247271 145
72 3300005083 Ga0068305_10085523 Ga0068305_100855239 145
73 3300005201 Ga0072941_1145457 Ga0072941_11454573 145
74 3300009784 Ga0123357_10002140 Ga0123357_100021407 145
75 3300009784 Ga0123357_10002699 Ga0123357_1000269912 145
76 3300009784 Ga0123357_10003901 Ga0123357_100039015 145
77 3300009784 Ga0123357_10007666 Ga0123357_1000766610 145
78 3300009784 Ga0123357_10017367 Ga0123357_100173677 145
79 3300009784 Ga0123357_10375283 Ga0123357_103752832 145
80 3300010049 Ga0123356_10534235 Ga0123356_105342352 145
81 3300010049 Ga0123356_11771999 Ga0123356_117719992 145
82 3300010167 Ga0123353_11212894 Ga0123353_112128941 145
83 3300010882 Ga0123354_10000692 Ga0123354_100006927 145
84 3300010882 Ga0123354_10001008 Ga0123354_1000100823 145
85 3300010882 Ga0123354_10001055 Ga0123354_1000105517 145
86 3300010882 Ga0123354_10032711 Ga0123354_100327112 145
87 3300010882 Ga0123354_10037522 Ga0123354_100375226 145
88 3300010882 Ga0123354_10056534 Ga0123354_100565345 145
89 3300042643 Ga0466704_388038 Ga0466704_388038_34029_34466 145
90 3300042617 Ga0466718_103128 Ga0466718_103128_594_1055 146
91 iso_pr_bacteria 2820353569 2820354752 147
92 3300002450 JGI24695J34938_10363498 JGI24695J34938_103634981 148
93 iso_pr_bacteria 2511231061 2511527013 148
94 iso_pr_bacteria 2548876780 2549804278 148
95 iso_pr_bacteria 2548876922 2550336471 148
96 iso_pr_bacteria 2582581025 2584319217 148
97 iso_pr_bacteria 2597489904 2597928183 148
98 iso_pr_bacteria 2718217968 2719561341 148
99 iso_pr_bacteria 2718218151 2720312477 148
100 iso_pr_bacteria 2811994999 2812756678 148
101 iso_pr_bacteria 2834762790 2834763085 148
102 iso_pr_bacteria 2855972776 2855973673 148
103 iso_pr_bacteria 638341178 638412449 148
104 iso_pr_bacteria 640753045 640951397 148
105 iso_pr_bacteria 641228503 641233920 148
106 iso_pr_bacteria 644736402 644763143 148
107 iso_pr_bacteria 644736403 644766255 148
108 iso_pr_bacteria 647533204 647539405 148
109 iso_pr_bacteria 650716082 651051734 148
110 iso_pr_bacteria 8068887342 8068888139 148
111 3300010167 Ga0123353_11407311 Ga0123353_114073112 150
112 iso_pr_bacteria 2811995359 2814051029 150
113 iso_pr_bacteria 640753044 640955677 150
114 3300009826 Ga0123355_10218415 Ga0123355_102184153 151
115 3300042602 Ga0466713_068672 Ga0466713_068672_78451_78906 151
116 iso_pr_bacteria 2556921622 2558099823 153
117 3300042624 Ga0466735_170351 Ga0466735_170351_607_1080 157
118 3300042600 Ga0466700_078267 Ga0466700_078267_1020_1505 161
119 3300042592 Ga0466693_309949 Ga0466693_309949_817_1308 163
120 3300010167 Ga0123353_10314681 Ga0123353_103146812 164
121 3300010882 Ga0123354_10510057 Ga0123354_105100572 164
122 3300042609 Ga0466722_260109 Ga0466722_260109_82527_83024 165
123 iso_pr_bacteria 2820056190 2820057716 165
124 iso_pr_bacteria 2820080004 2820081924 165
125 3300002504 JGI24705J35276_12237518 JGI24705J35276_122375183 166
126 3300010882 Ga0123354_10043588 Ga0123354_100435881 166
127 iso_pr_bacteria 2820101058 2820101884 166
128 3300009784 Ga0123357_10000019 Ga0123357_1000001960 167
129 3300042591 Ga0466692_162372 Ga0466692_162372_4896_5426 176

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF22769 DCD dCTP deaminase-like 34 119 0.94
PF00692 dUTPase dUTPase 14 144 0.93

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.8 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.