Protein Family IF02491

Metagenome Isolate
178 Members
117 Samples
109 Scaffolds
212.71 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10216447|Ga0123355_102164474
Length
232 aa
Sequence
MDTKKAAAPLPEGSESGIHSRCSGGAWGSAPLKNKKILVTGFDPFGGEKINPALEAIKQLPDKIGDISIVKCEIPTVFGKSANVLLSVVEKEHPDAVLCIGQAGGRPNIMVERVAINSNDAYIKDNEGNQPTDNKIAADGPAAYFATLPIKAMVQDMLANGIPAAVSNSAGTFVCNHVMYSILHYAAQNRPNMKTGFVHIPYLPQQTADKPSMSLDCILKGLXXXIKAIAT*

📊 Sample Types

Isolate 38.8%
Metagenome 61.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 27.3%
Apidae 17.3%
Termitidae 15.5%
Tenebrionidae 8.2%
Elmidae 5.5%
Kalotermitidae 3.6%
Blattidae 2.7%
Curculionidae 2.7%
Formicidae 2.7%
Culicidae 2.7%
Scarabaeidae 1.8%
Armadillidiidae 1.8%
Termopsidae 1.8%
Vespidae 0.9%
Ceratopogonidae 0.9%
Hydrophilidae 0.9%
Pentatomidae 0.9%
Rhinotermitidae 0.9%
Drosophilidae 0.9%
Tephritidae 0.9%

🌳 Taxonomy

Archaea 1
Bacteria 166
Eukaryota 0
Viruses 0
Unclassified 11

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2864755708 Massilia timonae S00006 Isolate Elmidae
2 2958885890 Lactobacillus sp. ESL0234 Isolate Apidae
3 2961465228 Lactobacillus sp. ESL0233 Isolate Apidae
4 2515154100 Streptomyces sp. MspMP-M5 Isolate Unclassified
5 2595698199 Melissococcus plutonius 60 Isolate Apidae
6 2634166424 Clostridium sp. L74 Isolate Scarabaeidae
7 2758568507 Lactobacillus bombicola ESL0237 Isolate Unclassified
8 2758568508 Lactobacillus bombicola ESL0236 Isolate Unclassified
9 2758568512 Lactobacillus helsingborgensis ESL0262 Isolate Unclassified
10 2820537337 Unclassified Firmicutes Lab288P1bin137 Isolate Unclassified
11 2820623020 Unclassified Firmicutes Emb289P1bin126 Isolate Unclassified
12 2684622914 Lactobacillus helsinborgensis Lb_183 Isolate Unclassified
13 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
14 8017458139 Lactobacillus johnsonii CRL1647 Isolate Apidae
15 8017489919 Lactobacillus brevis EF Isolate Unclassified
16 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
17 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
18 2968368220 Lactobacillus bombicola OCC3 Isolate Apidae
19 2971062614 Lactobacillus bombicola BI-4G Isolate Apidae
20 2864826666 Acidovorax konjaci S00067 Isolate Elmidae
21 2864853652 Pseudomonas rhodesiae S00114 Isolate Elmidae
22 2881375749 Vagococcus entomophilus DSM 24756 Isolate Vespidae
23 2940241992 Fusobacterium sp. PH5-29 Isolate Blattidae
24 2851410423 Lactobacillus helsingborgensis ESL0183 Isolate Apidae
25 2595698193 Melissococcus plutonius B5 Isolate Apidae
26 2595698196 Melissococcus plutonius 49.3 Isolate Apidae
27 2758568501 Lactobacillus bombicola ESL0228 Isolate Unclassified
28 2758568502 Lactobacillus bombicola ESL0247 Isolate Unclassified
29 2758568503 Lactobacillus bombicola ESL0246 Isolate Unclassified
30 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
31 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
32 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
33 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
34 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
35 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
36 8004832522 Lactobacillus sp. ESL0236 Isolate Apidae
37 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
38 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
39 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
40 2864937364 Acidovorax soli S00198 Isolate Elmidae
41 2914375287 Culicoidibacter larvae CS-1 Isolate Ceratopogonidae
42 2940349480 Fusobacterium sp. PH5-44 Isolate Blattidae
43 2032320009 Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine Metagenome Curculionidae
44 2595698194 Melissococcus plutonius 90.0 Isolate Apidae
45 2595698195 Melissococcus plutonius 119 Isolate Apidae
46 2758568505 Lactobacillus bombicola ESL0225 Isolate Unclassified
47 2645727721 Lactobacillus helsingborgensis Bma5 Isolate Unclassified
48 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
49 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
50 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
51 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
52 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
53 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
54 3300007901 Neotropical army ants gut microbial communities from Monteverde, Costa Rica - Eciton burchellii Gut microbial communities of Eciton burchellii Metagenome Formicidae
55 2864745180 Pseudomonas rhodesiae S00002 Isolate Elmidae
56 2873581347 Vagococcus hydrophili HDW17B Isolate Hydrophilidae
57 2044078006 Dendroctonus frontalis bacterial communities from Mississippi, USA Metagenome Curculionidae
58 2515154106 Streptomyces sp. FxanaD5 Isolate Unclassified
59 2588253732 Klebsiella pneumoniae pneumoniae KP5-1 Isolate Pentatomidae
60 2595698197 Melissococcus plutonius H6 Isolate Apidae
61 2820522177 Unclassified Firmicutes Lab288P1bin22 Isolate Unclassified
62 2820654856 Unclassified Firmicutes Cu122P1bin2 Isolate Unclassified
63 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
64 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
65 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
66 2896843662 Levilactobacillus brevis BDGP6 Isolate Drosophilidae
67 2912749649 Streptomyces sp. GS7 Isolate Termitidae
68 2595698190 Melissococcus plutonius 21.1 Isolate Apidae
69 2627853628 Melissococcus plutonius 82 Isolate Apidae
70 2758568504 Lactobacillus bombicola ESL0245 Isolate Unclassified
71 2775507073 Enterococcus sp. CR-Ec1 Isolate Unclassified
72 2820329821 Unclassified Firmicutes Nt197P3bin77 Isolate Unclassified
73 2820513949 Unclassified Firmicutes Lab288P1bin39 Isolate Unclassified
74 2820535361 Unclassified Firmicutes Lab288P1bin14 Isolate Unclassified
75 2820681712 Unclassified Firmicutes Co191P1bin84 Isolate Unclassified
76 8012939035 Enterococcus sp. UD-01 Isolate Tenebrionidae
77 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
78 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
79 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
80 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
81 2843904799 Shewanella khirikhana TH2012 Isolate Unclassified
82 2940373808 Fusobacterium sp. PH5-7 Isolate Blattidae
83 2595698198 Melissococcus plutonius L9 Isolate Apidae
84 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
85 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
86 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
87 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
88 8017440191 Lactobacillus bombicola L5-31 Isolate Apidae
89 8021540981 Klebsiella sp. Kpp Isolate Tephritidae
90 3006468911 Streptomyces sp. RB17 Isolate Termitidae
91 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
92 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
93 2864751016 Pseudomonas oryzihabitans S00005 Isolate Elmidae
94 2622736579 Desemzia incerta DSM 20581 Isolate Unclassified
95 2740892557 Staphylococcus sp. JDR108L-110-1 Isolate Unclassified
96 2758568509 Lactobacillus bombicola ESL0234 Isolate Unclassified
97 2758568510 Lactobacillus bombicola ESL0233 Isolate Unclassified
98 2820393573 Unclassified Firmicutes Nc150P1bin9 Isolate Unclassified
99 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
100 2990166910 Pseudomonas typographi CA3A Isolate Curculionidae
101 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
102 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
103 3300026175 Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 Metagenome Formicidae
104 3300026559 Army ant gut microbial communities from Eciton burchelli, Santa Rosa, Costa Rica - colony SREbp2 Metagenome Formicidae
105 2758568506 Lactobacillus bombicola ESL0230 Isolate Unclassified
106 2820501819 Unclassified Firmicutes Lab288P1bin51 Isolate Unclassified
107 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
108 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
109 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
110 8002299145 Vagococcus allomyrinae BWB3-3 Isolate Scarabaeidae
111 8012942269 Mammaliicoccus lentus UD i2 Isolate Tenebrionidae
112 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
113 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
114 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
115 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
116 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
117 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562379_0541 3300056790 Unclassified 72448
2 Ga0562376_2058 3300056857 Unclassified 25647
3 Ga0562376_2331 3300056857 Bacteria 23008
4 Ga0123355_10467080 3300009826 Bacteria 1579
5 Ga0123356_12011329 3300010049 Bacteria 721
6 Ga0466735_169890 3300042624 Bacteria 11089
7 Ga0466724_55152 3300042649 Bacteria 3372
8 Ga0466701_077466 3300042598 Bacteria 1459
9 Ga0466697_014874 3300042611 Bacteria 1546
10 Ga0072940_1174970 3300005200 Bacteria 4340
11 Ga0074278_102634 3300005721 Unclassified 2858
12 Ga0562379_3805 3300056790 Bacteria 9042
13 Ga0562377_0015 3300056842 Bacteria 1211570
14 Ga0562377_0086 3300056842 Bacteria 338086
15 Ga0123355_10001136 3300009826 Bacteria 36890
16 Ga0123355_10030126 3300009826 Bacteria 8793
17 Ga0123354_10022885 3300010882 Bacteria 9851
18 Ga0160465_100149 3300012803 Bacteria 60805
19 Ga0466703_325536 3300042636 Bacteria 19973
20 Ga0466700_236523 3300042600 Bacteria 2984
21 Ga0160430_100004 3300012852 Bacteria 419618
22 Ga0160457_1001433 3300012858 Bacteria 6577
23 Ga0466693_253408 3300042592 Bacteria 2124
24 JGI24695J34938_10004622 3300002450 Bacteria 8945
25 JGI24697J35500_11171993 3300002507 Bacteria 1461
26 Ga0562377_0099 3300056842 Bacteria 299601
27 Ga0562374_0021 3300057007 Bacteria 1089448
28 Ga0123355_10002619 3300009826 Bacteria 25532
29 Ga0123355_10086105 3300009826 Bacteria 4998
30 Ga0466724_05921 3300042649 Bacteria 40885
31 Ga0466724_51641 3300042649 Bacteria 75820
32 Ga0160458_107219 3300012832 Bacteria 1287
33 Ga0255572_1000129 3300026175 Bacteria 64802
34 Ga0562377_0627 3300056842 Unclassified 53379
35 Ga0562377_1729 3300056842 Unclassified 20426
36 Ga0123355_10015345 3300009826 Bacteria 12029
37 Ga0123355_10039211 3300009826 Bacteria 7706
38 Ga0123355_10109896 3300009826 Bacteria 4311
39 Ga0123355_10252494 3300009826 Bacteria 2480
40 Ga0123355_10547312 3300009826 Bacteria 1401
41 Ga0160442_106849 3300012806 Bacteria 1102
42 Ga0466724_29472 3300042649 Bacteria 417400
43 Ga0466693_083789 3300042592 Bacteria 2159
44 Ga0466701_000638 3300042598 Bacteria 1743
45 JGI24696J40584_12937673 3300002834 Unclassified 1608
46 Ga0111035_102043 3300007901 Unclassified 23752
47 Ga0530661_002544 3300056564 Bacteria 6721
48 Ga0562378_1586 3300056814 Bacteria 23831
49 Ga0562375_2944 3300056856 Bacteria 17419
50 Ga0562375_5921 3300056856 Bacteria 6315
51 Ga0562376_0005 3300056857 Bacteria 2173693
52 Ga0123355_10081327 3300009826 Bacteria 5169
53 Ga0123355_10269930 3300009826 Bacteria 2365
54 Ga0466734_096572 3300042623 Bacteria 10499
55 Ga0466730_014148 3300042625 Unclassified 3266
56 Ga0466730_022530 3300042625 Bacteria 82360
57 Ga0160440_102620 3300012815 Bacteria 1846
58 Ga0160441_100878 3300012825 Unclassified 14695
59 Ga0160443_100033 3300012848 Bacteria 337370
60 Ga0255575_1004262 3300026559 Bacteria 13455
61 DPO_contig04037 2032320009 Bacteria 27294
62 Ga0562378_2555 3300056814 Bacteria 14561
63 Ga0123355_10001660 3300009826 Bacteria 30968
64 Ga0123355_10005266 3300009826 Archaea 18890
65 Ga0123355_10462575 3300009826 Bacteria 1591
66 Ga0123355_10625151 3300009826 Bacteria 1267
67 Ga0466735_147649 3300042624 Bacteria 1174
68 Ga0466724_27476 3300042649 Bacteria 555291
69 Ga0466701_022011 3300042598 Bacteria 293822
70 Ga0466701_058814 3300042598 Bacteria 8303
71 Ga0466701_094322 3300042598 Bacteria 2546
72 Ga0466722_088967 3300042609 Bacteria 12576
73 Ga0160459_101583 3300012831 Bacteria 4692
74 SPBB_contig11544 2044078006 Bacteria 50017
75 Ga0562379_0372 3300056790 Bacteria 103233
76 Ga0562377_0358 3300056842 Unclassified 87064
77 Ga0562377_1213 3300056842 Bacteria 29318
78 Ga0562375_0403 3300056856 Bacteria 96431
79 Ga0562376_0015 3300056857 Unclassified 536747
80 Ga0562374_0006 3300057007 Bacteria 2178283
81 Ga0123355_10000408 3300009826 Bacteria 55997
82 Ga0123355_10001474 3300009826 Bacteria 32752
83 Ga0123355_10216447 3300009826 Bacteria 2764
84 Ga0160466_106731 3300012809 Bacteria 1407
85 Ga0466705_210737 3300042612 Bacteria 4625
86 Ga0466734_147340 3300042623 Bacteria 4148
87 Ga0466725_267651 3300042654 Bacteria 3772
88 Ga0466701_034913 3300042598 Bacteria 3076
89 Ga0160431_100665 3300012828 Bacteria 12348
90 Ga0160431_105431 3300012828 Bacteria 2108
91 Ga0160460_102502 3300012845 Bacteria 4058
92 Ga0160443_102274 3300012848 Bacteria 4497
93 DPO_contig06898 2032320009 Bacteria 22863
94 Ga0074278_117871 3300005721 Bacteria 11634
95 Ga0562379_0059 3300056790 Bacteria 474608
96 Ga0123355_10001920 3300009826 Bacteria 29220
97 Ga0123355_10018161 3300009826 Bacteria 11142
98 Ga0123355_10080814 3300009826 Bacteria 5188
99 Ga0123355_10091143 3300009826 Bacteria 4833
100 Ga0123355_10096765 3300009826 Bacteria 4662
101 Ga0123355_11032628 3300009826 Bacteria 867
102 Ga0123355_11269714 3300009826 Bacteria 743
103 Ga0466734_071258 3300042623 Bacteria 3601
104 Ga0466730_000039 3300042625 Bacteria 3647
105 Ga0466730_085996 3300042625 Bacteria 38700
106 Ga0466704_041879 3300042643 Bacteria 16053
107 Ga0466727_299560 3300042655 Bacteria 1325
108 Ga0466711_364085 3300042615 Bacteria 228323
109 HBC_ctgsDRAFT_1006658 3300000333 Bacteria 2709

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042636 Ga0466703_325536 Ga0466703_325536_5916_6557 192
2 3300042643 Ga0466704_041879 Ga0466704_041879_2237_2878 192
3 3300042612 Ga0466705_210737 Ga0466705_210737_12_653 193
4 iso_pr_bacteria 2820537337 2820537634 199
5 3300009826 Ga0123355_10081327 Ga0123355_100813277 200
6 3300056790 Ga0562379_0541 Ga0562379_0541_18535_19173 200
7 3300056814 Ga0562378_2555 Ga0562378_2555_3326_3964 200
8 3300056842 Ga0562377_0086 Ga0562377_0086_299898_300536 200
9 3300056842 Ga0562377_0099 Ga0562377_0099_39316_39954 200
10 3300056842 Ga0562377_1213 Ga0562377_1213_18664_19302 200
11 3300056857 Ga0562376_0015 Ga0562376_0015_376063_376701 200
12 3300056857 Ga0562376_2058 Ga0562376_2058_21011_21649 200
13 3300057007 Ga0562374_0021 Ga0562374_0021_551328_551966 200
14 3300009826 Ga0123355_10001660 Ga0123355_1000166020 201
15 3300009826 Ga0123355_10001920 Ga0123355_1000192020 201
16 3300009826 Ga0123355_10086105 Ga0123355_100861052 201
17 iso_pr_bacteria 2820522177 2820524056 201
18 iso_pr_bacteria 2820681712 2820682077 201
19 3300009826 Ga0123355_10091143 Ga0123355_100911434 202
20 3300012848 Ga0160443_102274 Ga0160443_1022743 202
21 3300009826 Ga0123355_10001136 Ga0123355_1000113634 203
22 3300009826 Ga0123355_10080814 Ga0123355_100808145 203
23 3300009826 Ga0123355_10462575 Ga0123355_104625751 203
24 iso_pr_bacteria 2820513949 2820514335 203
25 3300009826 Ga0123355_10005266 Ga0123355_1000526613 204
26 3300009826 Ga0123355_10030126 Ga0123355_100301263 204
27 3300009826 Ga0123355_10109896 Ga0123355_101098964 204
28 3300042615 Ga0466711_364085 Ga0466711_364085_189647_190261 204
29 iso_pr_bacteria 2896843662 2896845955 204
30 iso_pr_bacteria 8017489919 8017490463 204
31 3300002450 JGI24695J34938_10004622 JGI24695J34938_100046222 205
32 3300009826 Ga0123355_10467080 Ga0123355_104670803 205
33 3300012828 Ga0160431_105431 Ga0160431_1054311 205
34 iso_pr_bacteria 2820535361 2820535916 205
35 3300009826 Ga0123355_10015345 Ga0123355_100153454 206
36 3300009826 Ga0123355_11269714 Ga0123355_112697142 206
37 3300009826 Ga0123355_10002619 Ga0123355_100026198 207
38 3300009826 Ga0123355_10018161 Ga0123355_1001816111 207
39 3300042598 Ga0466701_000638 Ga0466701_000638_745_1371 208
40 3300009826 Ga0123355_10547312 Ga0123355_105473122 209
41 3300042598 Ga0466701_077466 Ga0466701_077466_62_691 209
42 iso_pr_bacteria 2820623020 2820624216 209
43 iso_pr_bacteria 2864745180 2864745227 209
44 iso_pr_bacteria 2864853652 2864858290 209
45 3300009826 Ga0123355_10000408 Ga0123355_1000040842 210
46 3300009826 Ga0123355_10039211 Ga0123355_1003921111 210
47 3300009826 Ga0123355_10096765 Ga0123355_100967655 210
48 iso_pr_bacteria 2820654856 2820656430 210
49 3300009826 Ga0123355_10001474 Ga0123355_1000147421 211
50 3300009826 Ga0123355_10252494 Ga0123355_102524941 211
51 3300012806 Ga0160442_106849 Ga0160442_1068491 211
52 3300012809 Ga0160466_106731 Ga0160466_1067312 211
53 3300012825 Ga0160441_100878 Ga0160441_1008786 211
54 3300012831 Ga0160459_101583 Ga0160459_1015834 211
55 3300012832 Ga0160458_107219 Ga0160458_1072192 211
56 3300012845 Ga0160460_102502 Ga0160460_1025024 212
57 3300056564 Ga0530661_002544 Ga0530661_002544_283_921 212
58 3300056842 Ga0562377_0358 Ga0562377_0358_5556_6194 212
59 3300056842 Ga0562377_0627 Ga0562377_0627_4886_5524 212
60 3300056842 Ga0562377_1729 Ga0562377_1729_16490_17128 212
61 3300056857 Ga0562376_2331 Ga0562376_2331_5890_6528 212
62 iso_pr_bacteria 2864751016 2864755079 212
63 2032320009 DPO_contig04037 DPOB_598190 213
64 2032320009 DPO_contig06898 DPOB_294120 213
65 3300009826 Ga0123355_11032628 Ga0123355_110326281 213
66 3300012815 Ga0160440_102620 Ga0160440_1026202 213
67 3300012828 Ga0160431_100665 Ga0160431_1006656 213
68 3300042609 Ga0466722_088967 Ga0466722_088967_10563_11204 213
69 3300042624 Ga0466735_147649 Ga0466735_147649_273_914 213
70 3300042624 Ga0466735_169890 Ga0466735_169890_10088_10729 213
71 3300056790 Ga0562379_3805 Ga0562379_3805_3198_3839 213
72 3300056856 Ga0562375_0403 Ga0562375_0403_90367_91008 213
73 3300056856 Ga0562375_2944 Ga0562375_2944_10682_11323 213
74 3300056857 Ga0562376_0005 Ga0562376_0005_1203524_1204165 213
75 3300057007 Ga0562374_0006 Ga0562374_0006_2019831_2020472 213
76 iso_pr_bacteria 2740892557 2743950426 213
77 iso_pr_bacteria 8012942269 8012944697 213
78 2044078006 SPBB_contig11544 SPBB_393690 214
79 3300002507 JGI24697J35500_11171993 JGI24697J35500_111719931 214
80 3300010882 Ga0123354_10022885 Ga0123354_100228856 214
81 3300042592 Ga0466693_253408 Ga0466693_253408_263_907 214
82 3300042625 Ga0466730_085996 Ga0466730_085996_23127_23771 214
83 3300056790 Ga0562379_0372 Ga0562379_0372_20448_21092 214
84 iso_pr_bacteria 2588253732 2588528370 214
85 iso_pr_bacteria 2634166424 2635616633 214
86 iso_pr_bacteria 2820329821 2820330769 214
87 iso_pr_bacteria 2820393573 2820396240 214
88 iso_pr_bacteria 2912749649 2912752567 214
89 iso_pr_bacteria 2940373808 2940376957 214
90 iso_pr_bacteria 8021540981 8021543528 214
91 3300005200 Ga0072940_1174970 Ga0072940_11749704 215
92 3300009826 Ga0123355_10625151 Ga0123355_106251511 215
93 3300010049 Ga0123356_12011329 Ga0123356_120113291 215
94 3300042649 Ga0466724_05921 Ga0466724_05921_24857_25504 215
95 3300056814 Ga0562378_1586 Ga0562378_1586_21577_22224 215
96 iso_pr_bacteria 2595698190 2596206749 215
97 iso_pr_bacteria 2595698193 2596212054 215
98 iso_pr_bacteria 2595698194 2596213993 215
99 iso_pr_bacteria 2595698195 2596215802 215
100 iso_pr_bacteria 2595698196 2596217585 215
101 iso_pr_bacteria 2595698197 2596219422 215
102 iso_pr_bacteria 2595698198 2596221300 215
103 iso_pr_bacteria 2595698199 2596223058 215
104 iso_pr_bacteria 2622736579 2623391911 215
105 iso_pr_bacteria 2627853628 2628281503 215
106 iso_pr_bacteria 2645727721 2646684708 215
107 iso_pr_bacteria 2684622914 2686079501 215
108 iso_pr_bacteria 2758568501 2760245671 215
109 iso_pr_bacteria 2758568502 2760247302 215
110 iso_pr_bacteria 2758568503 2760248964 215
111 iso_pr_bacteria 2758568504 2760250626 215
112 iso_pr_bacteria 2758568505 2760252247 215
113 iso_pr_bacteria 2758568506 2760254013 215
114 iso_pr_bacteria 2758568507 2760255548 215
115 iso_pr_bacteria 2758568508 2760257247 215
116 iso_pr_bacteria 2758568509 2760258947 215
117 iso_pr_bacteria 2758568510 2760260765 215
118 iso_pr_bacteria 2758568512 2760264174 215
119 iso_pr_bacteria 2775507073 2777018806 215
120 iso_pr_bacteria 2851410423 2851411687 215
121 iso_pr_bacteria 2873581347 2873584111 215
122 iso_pr_bacteria 2958885890 2958887018 215
123 iso_pr_bacteria 2961465228 2961466475 215
124 iso_pr_bacteria 2968368220 2968369683 215
125 iso_pr_bacteria 2971062614 2971063646 215
126 iso_pr_bacteria 8002299145 8002302698 215
127 iso_pr_bacteria 8004832522 8004833643 215
128 iso_pr_bacteria 8012939035 8012941140 215
129 iso_pr_bacteria 8017440191 8017440693 215
130 iso_pr_bacteria 8017458139 8017458601 215
131 3300000333 HBC_ctgsDRAFT_1006658 HBC_ctgsDRAFT_10066584 216
132 3300005721 Ga0074278_102634 Ga0074278_1026342 216
133 3300005721 Ga0074278_117871 Ga0074278_1178713 216
134 3300009826 Ga0123355_10269930 Ga0123355_102699302 216
135 3300012858 Ga0160457_1001433 Ga0160457_10014336 216
136 3300026175 Ga0255572_1000129 Ga0255572_100012918 216
137 3300026559 Ga0255575_1004262 Ga0255575_10042629 216
138 iso_pr_bacteria 2515154106 2515600316 216
139 iso_pr_bacteria 2881375749 2881377595 216
140 iso_pr_bacteria 2914375287 2914376107 216
141 iso_pr_bacteria 2940241992 2940243816 216
142 iso_pr_bacteria 2940349480 2940351314 216
143 iso_pr_bacteria 2990166910 2990170175 216
144 iso_pr_bacteria 3006468911 3006475390 216
145 3300007901 Ga0111035_102043 Ga0111035_1020434 217
146 3300042625 Ga0466730_000039 Ga0466730_000039_523_1176 217
147 iso_pr_bacteria 2843904799 2843908511 217
148 3300042598 Ga0466701_022011 Ga0466701_022011_29137_29793 218
149 3300042598 Ga0466701_034913 Ga0466701_034913_1999_2655 218
150 3300042649 Ga0466724_27476 Ga0466724_27476_302724_303380 218
151 3300042649 Ga0466724_29472 Ga0466724_29472_29024_29680 218
152 3300056790 Ga0562379_0059 Ga0562379_0059_74233_74889 218
153 3300056842 Ga0562377_0015 Ga0562377_0015_129432_130088 218
154 3300056856 Ga0562375_5921 Ga0562375_5921_95_751 218
155 3300012852 Ga0160430_100004 Ga0160430_100004319 220
156 3300042598 Ga0466701_094322 Ga0466701_094322_177_839 220
157 3300042625 Ga0466730_022530 Ga0466730_022530_77058_77720 220
158 3300042654 Ga0466725_267651 Ga0466725_267651_2597_3259 220
159 3300042623 Ga0466734_071258 Ga0466734_071258_2473_3138 221
160 iso_pr_bacteria 2820501819 2820502163 221
161 iso_pr_bacteria 2864755708 2864756352 221
162 3300042598 Ga0466701_058814 Ga0466701_058814_4109_4777 222
163 3300042611 Ga0466697_014874 Ga0466697_014874_79_747 222
164 3300042649 Ga0466724_55152 Ga0466724_55152_1646_2314 222
165 iso_pr_bacteria 2864826666 2864826760 222
166 3300012848 Ga0160443_100033 Ga0160443_100033304 223
167 3300042592 Ga0466693_083789 Ga0466693_083789_203_874 223
168 3300042625 Ga0466730_014148 Ga0466730_014148_525_1196 223
169 3300042649 Ga0466724_51641 Ga0466724_51641_40483_41154 223
170 3300002834 JGI24696J40584_12937673 JGI24696J40584_129376731 224
171 3300042623 Ga0466734_096572 Ga0466734_096572_3335_4009 224
172 iso_pr_bacteria 2864937364 2864939453 224
173 3300012803 Ga0160465_100149 Ga0160465_10014946 226
174 3300042623 Ga0466734_147340 Ga0466734_147340_1037_1720 227
175 3300042655 Ga0466727_299560 Ga0466727_299560_558_1241 227
176 iso_pr_bacteria 2515154100 2515556798 227
177 3300042600 Ga0466700_236523 Ga0466700_236523_20_712 230
178 3300009826 Ga0123355_10216447 Ga0123355_102164474 232

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01470 Peptidase_C15 Pyroglutamyl peptidase 35 230 0.98

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.84 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.