Protein Family IF02483

Metagenome Isolate
136 Members
61 Samples
104 Scaffolds
299.98 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10193211|Ga0123355_101932113
Length
346 aa
Sequence
MYRLKAAKSQGFLMIKFWKGYQGFLLDTILSLVAVYYRWGERMQINRLFEIVYLLMNKKQATANELASHFEVSKRTILRDIDTLTTAGIPIYTTQGKGGGIFIQDNFVLNKTFISEDEKKQILFSLQSMAATEFIETDQVLGRLRNFFASPNKEWIEVDFSRWGHSAADTTKFEMLKNAIINEFAVSFDYLSAYGESKGREVYPLKLSFKSKAWYLQSFCPAENDYRVFKFTRLSNLVVLDKSFKGNDYKAPKIEPPEDPSELCIVDVRLLVSSHAKFRIYDEFAESDIIVNNDGSFTLRMTQGQWIHDYILSYGTAVEVLEPRYIRDEMLVRIDKIRNRYQSKT*

📊 Sample Types

Isolate 23.5%
Metagenome 76.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 28.3%
Unclassified 25.0%
Blattidae 23.3%
Kalotermitidae 15.0%
Tenebrionidae 3.3%
Passalidae 3.3%
Rhinotermitidae 1.7%

🌳 Taxonomy

Archaea 1
Bacteria 131
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940230426 Lachnospiraceae bacterium PH5-48 Isolate Blattidae
2 2940283334 Lachnospiraceae bacterium PF1-4 Isolate Blattidae
3 2940295490 Lachnospiraceae bacterium PH1-22 Isolate Blattidae
4 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
5 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
6 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
7 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
8 2820593525 Unclassified Firmicutes Emb289P1bin7 Isolate Unclassified
9 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
10 2940277027 Lachnospiraceae bacterium PF1-21 Isolate Blattidae
11 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
12 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
13 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
14 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
15 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
16 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
17 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
18 2940236825 Breznakia sp. PM6-1 Isolate Blattidae
19 2940280053 Lachnospiraceae bacterium PF1-22 Isolate Blattidae
20 2940341480 Breznakia sp. PFB2-8 Isolate Blattidae
21 2944625312 Dysgonomonas sp. PF1-3 Isolate Blattidae
22 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
23 2590828839 Clostridium sp. 1 Isolate Termitidae
24 2820495292 Unclassified Firmicutes Lab288P1bin59 Isolate Unclassified
25 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
26 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
27 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
28 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
29 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
30 2940339133 Breznakia sp. PF5-3 Isolate Blattidae
31 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
32 2820329821 Unclassified Firmicutes Nt197P3bin77 Isolate Unclassified
33 2820483401 Unclassified Firmicutes Lab288P1bin74 Isolate Unclassified
34 2820513949 Unclassified Firmicutes Lab288P1bin39 Isolate Unclassified
35 2940233634 Lachnoclostridium sp. PF5-10 Isolate Blattidae
36 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
37 2820356982 Unclassified Firmicutes Nt197P3bin19 Isolate Unclassified
38 2820547636 Unclassified Firmicutes Lab288P1bin10 Isolate Unclassified
39 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
40 2940286528 Lachnospiraceae bacterium PFB1-21 Isolate Blattidae
41 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
42 2820522177 Unclassified Firmicutes Lab288P1bin22 Isolate Unclassified
43 2940292506 Lachnoclostridium sp. PH5-23 Isolate Blattidae
44 2940343849 Breznakia sp. PH5-24 Isolate Blattidae
45 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
46 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
47 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
48 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
49 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
50 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
51 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
52 2820481688 Unclassified Firmicutes Lab288P1bin76 Isolate Unclassified
53 2820512088 Unclassified Firmicutes Lab288P1bin4 Isolate Unclassified
54 2820533259 Unclassified Firmicutes Lab288P1bin140 Isolate Unclassified
55 2820584674 Unclassified Firmicutes Emb289P1bin98 Isolate Unclassified
56 2940289514 Lachnospiraceae bacterium PM6-15 Isolate Blattidae
57 2593339124 Clostridium sp. 4 Isolate Termitidae
58 2820474468 Unclassified Firmicutes Lab288P1bin84 Isolate Unclassified
59 2820615445 Unclassified Firmicutes Emb289P1bin132 Isolate Unclassified
60 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
61 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_063534 3300042612 Bacteria 1800
2 Ga0466705_323142 3300042612 Bacteria 2905
3 Ga0466728_266200 3300042620 Bacteria 2604
4 Ga0466729_046926 3300042621 Bacteria 9243
5 Ga0123355_10000209 3300009826 Bacteria 73367
6 Ga0123355_10000344 3300009826 Bacteria 60129
7 Ga0123355_10001114 3300009826 Bacteria 37193
8 Ga0123355_10001658 3300009826 Bacteria 30972
9 Ga0123355_10013604 3300009826 Bacteria 12674
10 Ga0123355_10049858 3300009826 Bacteria 6805
11 Ga0123355_10074452 3300009826 Bacteria 5440
12 Ga0123355_10076451 3300009826 Bacteria 5355
13 Ga0123355_10129944 3300009826 Bacteria 3883
14 Ga0123355_10305076 3300009826 Bacteria 2165
15 Ga0123355_10329957 3300009826 Bacteria 2045
16 Ga0123355_10449632 3300009826 Bacteria 1625
17 Ga0123355_10506238 3300009826 Bacteria 1486
18 Ga0466693_017748 3300042592 Bacteria 4542
19 Ga0466694_148335 3300042594 Unclassified 4775
20 Ga0123355_10001058 3300009826 Bacteria 38099
21 Ga0123355_10002354 3300009826 Bacteria 26697
22 Ga0123355_10031179 3300009826 Bacteria 8648
23 Ga0123355_10051355 3300009826 Bacteria 6692
24 Ga0123355_10193211 3300009826 Unclassified 2992
25 Ga0123355_10226590 3300009826 Bacteria 2677
26 Ga0123355_10241653 3300009826 Bacteria 2557
27 Ga0123355_10637786 3300009826 Bacteria 1249
28 Ga0466700_250414 3300042600 Bacteria 6307
29 Ga0466700_406025 3300042600 Bacteria 18685
30 IMNBL1DRAFT_c0025692 3300000062 Bacteria 2253
31 JGI24705J35276_12228002 3300002504 Bacteria 3106
32 Ga0466725_210025 3300042654 Bacteria 1790
33 Ga0562379_0064 3300056790 Bacteria 452272
34 Ga0466715_097473 3300042616 Bacteria 1865
35 Ga0466715_617329 3300042616 Bacteria 16696
36 Ga0123355_10000965 3300009826 Bacteria 39761
37 Ga0123355_10015228 3300009826 Bacteria 12073
38 Ga0123355_10220743 3300009826 Bacteria 2726
39 Ga0123355_10732789 3300009826 Bacteria 1124
40 Ga0466716_492932 3300042605 Unclassified 1617
41 Ga0466709_078717 3300042648 Bacteria 6901
42 Ga0466725_203587 3300042654 Bacteria 1033
43 Ga0123355_10000097 3300009826 Bacteria 93968
44 Ga0123355_10025121 3300009826 Bacteria 9590
45 Ga0123355_10040942 3300009826 Bacteria 7542
46 Ga0123355_10124591 3300009826 Bacteria 3986
47 Ga0123353_10912598 3300010167 Bacteria 1194
48 Ga0123354_10269868 3300010882 Bacteria 1677
49 Ga0466694_229138 3300042594 Bacteria 15188
50 Ga0123355_10041088 3300009826 Bacteria 7529
51 Ga0123355_10060172 3300009826 Bacteria 6134
52 Ga0123355_10075928 3300009826 Bacteria 5377
53 Ga0123355_10167340 3300009826 Bacteria 3295
54 Ga0123355_10248376 3300009826 Archaea 2509
55 Ga0123355_10388387 3300009826 Bacteria 1811
56 Ga0123355_10501020 3300009826 Bacteria 1498
57 Ga0123356_10503302 3300010049 Bacteria 1368
58 Ga0123354_10200204 3300010882 Bacteria 2198
59 JGI24695J34938_10036542 3300002450 Bacteria 2238
60 JGI24703J35330_11684035 3300002501 Bacteria 1837
61 Ga0466703_217589 3300042636 Bacteria 1812
62 Ga0466704_547465 3300042643 Bacteria 6276
63 Ga0123355_10000924 3300009826 Bacteria 40681
64 Ga0123355_10001109 3300009826 Bacteria 37241
65 Ga0123355_10002055 3300009826 Bacteria 28435
66 Ga0123355_10019617 3300009826 Bacteria 10769
67 Ga0123355_10395229 3300009826 Bacteria 1788
68 Ga0123356_10096108 3300010049 Bacteria 2833
69 Ga0123353_10059845 3300010167 Bacteria 6109
70 Ga0466705_053439 3300042612 Bacteria 1802
71 Ga0466711_381786 3300042615 Bacteria 2138
72 Ga0466715_521505 3300042616 Bacteria 2423
73 Ga0123355_10005414 3300009826 Bacteria 18679
74 Ga0123355_10016376 3300009826 Bacteria 11682
75 Ga0123355_10229795 3300009826 Bacteria 2651
76 Ga0123355_10338174 3300009826 Bacteria 2009
77 Ga0123355_10435245 3300009826 Bacteria 1665
78 Ga0466700_280014 3300042600 Bacteria 5519
79 Ga0466721_251692 3300042608 Unclassified 1749
80 2227136357 2225789004 Bacteria 36673
81 JGI24705J35276_12227876 3300002504 Bacteria 3080
82 Ga0072941_1277827 3300005201 Bacteria 6176
83 Ga0466703_181732 3300042636 Bacteria 3345
84 Ga0466724_18707 3300042649 Bacteria 1986
85 Ga0466693_097377 3300042592 Bacteria 2404
86 Ga0466696_058047 3300042596 Bacteria 1368
87 Ga0466696_100511 3300042596 Bacteria 1598
88 Ga0466733_107419 3300042659 Bacteria 14060
89 Ga0562375_0163 3300056856 Bacteria 195962
90 Ga0466715_091182 3300042616 Bacteria 1548
91 Ga0123355_10000432 3300009826 Bacteria 55030
92 Ga0123355_10001503 3300009826 Bacteria 32515
93 Ga0123355_10052165 3300009826 Bacteria 6637
94 Ga0123355_10097000 3300009826 Bacteria 4654
95 Ga0123355_10300361 3300009826 Bacteria 2190
96 Ga0123355_10413874 3300009826 Bacteria 1729
97 Ga0123356_10206488 3300010049 Bacteria 2009
98 Ga0123356_10484454 3300010049 Bacteria 1390
99 Ga0123353_10072521 3300010167 Bacteria 5533
100 Ga0123353_10508620 3300010167 Bacteria 1752
101 Ga0466700_142382 3300042600 Bacteria 2632
102 Ga0466700_176978 3300042600 Bacteria 10369
103 JGI24702J35022_10036910 3300002462 Bacteria 2611
104 Ga0466693_325535 3300042592 Bacteria 2423

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010049 Ga0123356_10484454 Ga0123356_104844541 284
2 3300042594 Ga0466694_148335 Ga0466694_148335_3561_4421 286
3 3300009826 Ga0123355_10076451 Ga0123355_100764515 287
4 3300042649 Ga0466724_18707 Ga0466724_18707_775_1641 288
5 3300009826 Ga0123355_10002354 Ga0123355_1000235425 289
6 3300009826 Ga0123355_10167340 Ga0123355_101673402 289
7 3300042654 Ga0466725_203587 Ga0466725_203587_140_1009 289
8 3300009826 Ga0123355_10506238 Ga0123355_105062381 290
9 3300010049 Ga0123356_10206488 Ga0123356_102064882 290
10 3300042592 Ga0466693_017748 Ga0466693_017748_123_995 290
11 3300042592 Ga0466693_097377 Ga0466693_097377_924_1796 290
12 3300042600 Ga0466700_406025 Ga0466700_406025_15577_16449 290
13 3300042608 Ga0466721_251692 Ga0466721_251692_192_1064 290
14 3300002450 JGI24695J34938_10036542 JGI24695J34938_100365423 291
15 3300009826 Ga0123355_10000965 Ga0123355_1000096526 291
16 3300009826 Ga0123355_10001658 Ga0123355_1000165815 291
17 3300009826 Ga0123355_10016376 Ga0123355_100163765 291
18 3300009826 Ga0123355_10019617 Ga0123355_100196171 291
19 3300009826 Ga0123355_10040942 Ga0123355_100409423 291
20 3300009826 Ga0123355_10049858 Ga0123355_100498588 291
21 3300009826 Ga0123355_10052165 Ga0123355_100521658 291
22 3300009826 Ga0123355_10060172 Ga0123355_100601722 291
23 3300009826 Ga0123355_10129944 Ga0123355_101299444 291
24 3300009826 Ga0123355_10241653 Ga0123355_102416532 291
25 3300009826 Ga0123355_10300361 Ga0123355_103003613 291
26 3300009826 Ga0123355_10305076 Ga0123355_103050763 291
27 3300009826 Ga0123355_10329957 Ga0123355_103299574 291
28 3300009826 Ga0123355_10338174 Ga0123355_103381742 291
29 3300009826 Ga0123355_10413874 Ga0123355_104138743 291
30 3300009826 Ga0123355_10501020 Ga0123355_105010202 291
31 3300009826 Ga0123355_10637786 Ga0123355_106377861 291
32 3300010049 Ga0123356_10096108 Ga0123356_100961084 291
33 3300010167 Ga0123353_10508620 Ga0123353_105086202 291
34 3300010167 Ga0123353_10912598 Ga0123353_109125981 291
35 3300009826 Ga0123355_10435245 Ga0123355_104352452 292
36 3300010167 Ga0123353_10072521 Ga0123353_100725217 292
37 iso_pr_bacteria 2940230426 2940233296 293
38 iso_pr_bacteria 2940233634 2940236481 293
39 iso_pr_bacteria 2940277027 2940278982 293
40 iso_pr_bacteria 2940280053 2940281625 293
41 iso_pr_bacteria 2940283334 2940286184 293
42 iso_pr_bacteria 2940286528 2940288888 293
43 iso_pr_bacteria 2940289514 2940291758 293
44 iso_pr_bacteria 2940292506 2940294711 293
45 iso_pr_bacteria 2940295490 2940297756 293
46 iso_pr_bacteria 2944625312 2944627030 293
47 3300042600 Ga0466700_176978 Ga0466700_176978_9313_10197 294
48 3300042600 Ga0466700_280014 Ga0466700_280014_735_1622 295
49 3300042616 Ga0466715_617329 Ga0466715_617329_12169_13089 295
50 3300009826 Ga0123355_10051355 Ga0123355_100513558 298
51 2225789004 2227136357 2227536043 299
52 3300000062 IMNBL1DRAFT_c0025692 IMNBL1DRAFT_00256924 300
53 iso_pr_bacteria 2940236825 2940237731 300
54 iso_pr_bacteria 2940339133 2940340032 300
55 iso_pr_bacteria 2940341480 2940341804 300
56 iso_pr_bacteria 2940343849 2940344079 300
57 3300009826 Ga0123355_10075928 Ga0123355_100759283 301
58 3300009826 Ga0123355_10395229 Ga0123355_103952293 301
59 3300010882 Ga0123354_10269868 Ga0123354_102698682 301
60 3300042592 Ga0466693_325535 Ga0466693_325535_1168_2073 301
61 iso_pr_bacteria 2820547636 2820548305 301
62 3300002504 JGI24705J35276_12228002 JGI24705J35276_122280022 302
63 3300009826 Ga0123355_10124591 Ga0123355_101245914 302
64 3300042615 Ga0466711_381786 Ga0466711_381786_454_1362 302
65 3300042616 Ga0466715_521505 Ga0466715_521505_182_1090 302
66 3300042621 Ga0466729_046926 Ga0466729_046926_7331_8239 302
67 iso_pr_bacteria 2820533259 2820533431 302
68 3300005201 Ga0072941_1277827 Ga0072941_12778274 303
69 3300009826 Ga0123355_10000432 Ga0123355_100004328 303
70 3300010049 Ga0123356_10503302 Ga0123356_105033022 303
71 3300042600 Ga0466700_250414 Ga0466700_250414_717_1628 303
72 3300042612 Ga0466705_053439 Ga0466705_053439_250_1161 303
73 3300042612 Ga0466705_323142 Ga0466705_323142_91_1002 303
74 3300042643 Ga0466704_547465 Ga0466704_547465_1818_2729 303
75 3300042654 Ga0466725_210025 Ga0466725_210025_109_1020 303
76 3300056790 Ga0562379_0064 Ga0562379_0064_87621_88532 303
77 3300056856 Ga0562375_0163 Ga0562375_0163_83897_84808 303
78 iso_pr_bacteria 2781125632 2781270701 303
79 iso_pr_bacteria 2820356982 2820357929 303
80 iso_pr_bacteria 2820474468 2820474533 303
81 iso_pr_bacteria 2820481688 2820481689 303
82 iso_pr_bacteria 2820483401 2820485030 303
83 iso_pr_bacteria 2820495292 2820495607 303
84 iso_pr_bacteria 2820512088 2820512340 303
85 iso_pr_bacteria 2820513949 2820514665 303
86 iso_pr_bacteria 2820593525 2820593858 303
87 iso_pr_bacteria 2820615445 2820615569 303
88 3300002501 JGI24703J35330_11684035 JGI24703J35330_116840353 304
89 3300002504 JGI24705J35276_12227876 JGI24705J35276_122278763 304
90 3300009826 Ga0123355_10000097 Ga0123355_1000009736 304
91 3300009826 Ga0123355_10000924 Ga0123355_1000092422 304
92 3300009826 Ga0123355_10001058 Ga0123355_1000105828 304
93 3300009826 Ga0123355_10001114 Ga0123355_1000111410 304
94 3300009826 Ga0123355_10001503 Ga0123355_100015033 304
95 3300009826 Ga0123355_10002055 Ga0123355_1000205513 304
96 3300009826 Ga0123355_10005414 Ga0123355_1000541413 304
97 3300009826 Ga0123355_10013604 Ga0123355_1001360410 304
98 3300009826 Ga0123355_10015228 Ga0123355_100152286 304
99 3300009826 Ga0123355_10031179 Ga0123355_100311799 304
100 3300009826 Ga0123355_10041088 Ga0123355_100410884 304
101 3300009826 Ga0123355_10074452 Ga0123355_100744525 304
102 3300009826 Ga0123355_10220743 Ga0123355_102207435 304
103 3300009826 Ga0123355_10226590 Ga0123355_102265904 304
104 3300009826 Ga0123355_10229795 Ga0123355_102297952 304
105 3300009826 Ga0123355_10388387 Ga0123355_103883871 304
106 3300009826 Ga0123355_10449632 Ga0123355_104496321 304
107 3300042594 Ga0466694_229138 Ga0466694_229138_7396_8310 304
108 3300042600 Ga0466700_142382 Ga0466700_142382_450_1364 304
109 iso_pr_bacteria 2590828839 2593251934 304
110 iso_pr_bacteria 2590828839 2593253521 304
111 iso_pr_bacteria 2593339124 2595062972 304
112 iso_pr_bacteria 2820584674 2820585717 304
113 3300002462 JGI24702J35022_10036910 JGI24702J35022_100369103 305
114 3300009826 Ga0123355_10000209 Ga0123355_1000020958 305
115 3300009826 Ga0123355_10000344 Ga0123355_1000034448 305
116 3300009826 Ga0123355_10001109 Ga0123355_1000110920 305
117 3300010882 Ga0123354_10200204 Ga0123354_102002043 305
118 3300042596 Ga0466696_058047 Ga0466696_058047_73_990 305
119 3300042605 Ga0466716_492932 Ga0466716_492932_156_1073 305
120 3300042616 Ga0466715_091182 Ga0466715_091182_390_1307 305
121 3300042616 Ga0466715_097473 Ga0466715_097473_218_1135 305
122 3300042659 Ga0466733_107419 Ga0466733_107419_2799_3719 306
123 3300009826 Ga0123355_10025121 Ga0123355_1002512111 307
124 3300009826 Ga0123355_10732789 Ga0123355_107327891 307
125 3300042612 Ga0466705_063534 Ga0466705_063534_413_1336 307
126 3300042636 Ga0466703_217589 Ga0466703_217589_610_1533 307
127 3300009826 Ga0123355_10097000 Ga0123355_100970003 308
128 3300042620 Ga0466728_266200 Ga0466728_266200_182_1120 312
129 iso_pr_bacteria 2820522177 2820523886 312
130 3300042596 Ga0466696_100511 Ga0466696_100511_98_1039 313
131 3300042648 Ga0466709_078717 Ga0466709_078717_4062_5003 313
132 3300009826 Ga0123355_10248376 Ga0123355_102483763 319
133 iso_pr_bacteria 2820329821 2820331744 319
134 3300042636 Ga0466703_181732 Ga0466703_181732_2196_3158 320
135 3300010167 Ga0123353_10059845 Ga0123353_100598454 321
136 3300009826 Ga0123355_10193211 Ga0123355_101932113 346

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF08279 HTH_11 HTH domain 47 98 0.93
PF08220 HTH_DeoR DeoR-like helix-turn-helix domain 47 91 0.89
PF13280 WYL WYL domain 173 336 0.88
PF19187 HTH_PafC PafC helix-turn-helix domain 44 94 0.82

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.43 0.49 Low

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.