Protein Family IF02475
Metagenome
Isolate
361
Members
204
Samples
244
Scaffolds
381.43
Avg Length
Representative Sequence
- ID
- 3300009826|Ga0123355_10164547|Ga0123355_101645472
- Length
- 420 aa
- Sequence
- MDGMSKQKNPIKKPHLLWFFCCFLCNVLREWVWSVILVKITNMTLYKVPPRWLFLKIETDEGITGWGEPVVEGRADTVRTAVLEYRDYFIGKDPMTIEDHWQVMYRGGFYRGGPEVMSAISGIDQALWDIKGKFYNAPIYDLLGGACRDKLKVYRWIGGDRPDDVANAAQEAYKQGYTAIKMNATEELHYIDNFTKIQAVCDRVAAIRDALGYNMDIAVDFHGRVHKPMAKVLAKELDQFRLMFIEEPVLPQNNEALREVARHTTTPIATGERMFSRWEFRDLLQDGYVDIIQPDLSHAGGISECKKIAAMAEAYDVALAPHCPLGPVALCACIQIDTCSPNAFIQEQSLGIHYNQSADIMDYVADPSIFKYNNGFLELLTGPGLGLSVNEDALIAADKIPHNWKNPLWRNYDGTVAEW*
Sample Types
Isolate
32.4%
Metagenome
67.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
27.2%
Unclassified
15.4%
Termitidae
9.7%
Kalotermitidae
7.2%
Curculionidae
5.1%
Culicidae
5.1%
Formicidae
4.1%
Armadillidiidae
4.1%
Tenebrionidae
3.6%
Drosophilidae
3.1%
Elmidae
3.1%
Termopsidae
2.1%
Rhinotermitidae
1.5%
Siricidae
1.0%
Passalidae
1.0%
Berytidae
1.0%
Largidae
1.0%
Apidae
1.0%
Blattidae
1.0%
Noctuidae
1.0%
Blaberidae
0.5%
Daphniidae
0.5%
Crambidae
0.5%
Taxonomy
Archaea
0
Bacteria
314
Eukaryota
0
Viruses
0
Unclassified
47
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 2 | 2912749649 | Streptomyces sp. GS7 | Isolate | Termitidae |
| 3 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 4 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 5 | 2687453742 | Burkholderiales bacterium B_Cag20 | Isolate | Unclassified |
| 6 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 7 | 2775507073 | Enterococcus sp. CR-Ec1 | Isolate | Unclassified |
| 8 | 2820483401 | Unclassified Firmicutes Lab288P1bin74 | Isolate | Unclassified |
| 9 | 2820535361 | Unclassified Firmicutes Lab288P1bin14 | Isolate | Unclassified |
| 10 | 2820576413 | Unclassified Firmicutes Emb289P3bin136 | Isolate | Unclassified |
| 11 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 12 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 13 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 14 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 15 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 16 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 17 | 8100461708 | Delftia sp. S65 | Isolate | Curculionidae |
| 18 | 8100528075 | Gluconobacter sp. Dm-44 | Isolate | Drosophilidae |
| 19 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 20 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 21 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 22 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 23 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 24 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 25 | 2997878596 | Pseudomonas bohemica IA9 | Isolate | Unclassified |
| 26 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 27 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 28 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 29 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 30 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 31 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 32 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 33 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 34 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 35 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 36 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 37 | 2820252425 | Unclassified Firmicutes Th196P3bin6 | Isolate | Unclassified |
| 38 | 2820265624 | Unclassified Firmicutes Th196P3bin36 | Isolate | Unclassified |
| 39 | 2820590132 | Unclassified Firmicutes Emb289P1bin84 | Isolate | Unclassified |
| 40 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 41 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 42 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 43 | 8100531325 | Gluconobacter sp. Dm-73 | Isolate | Drosophilidae |
| 44 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 45 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 46 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 47 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 48 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 49 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 50 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 51 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 52 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 53 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 54 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 55 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 56 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 57 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 58 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 59 | 2864761044 | Stenotrophomonas rhizophilia S00008 | Isolate | Elmidae |
| 60 | 2515154100 | Streptomyces sp. MspMP-M5 | Isolate | Unclassified |
| 61 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 62 | 2684622911 | Lactobacillus kullabergensis Lb_186 | Isolate | Unclassified |
| 63 | 2820551407 | Unclassified Firmicutes Emb289P4bin38 | Isolate | Unclassified |
| 64 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 65 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 66 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 67 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 68 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 69 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 70 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 71 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 72 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 73 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 74 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 75 | 8100455565 | Delftia sp. S67 | Isolate | Curculionidae |
| 76 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 77 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 78 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 79 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 80 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 81 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 82 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 83 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 84 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 85 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 86 | 2838140227 | Dyella sp. OAE510 | Isolate | Unclassified |
| 87 | 2877513988 | Lactobacillus kullabergensis ESL0186 | Isolate | Apidae |
| 88 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 89 | 2799112230 | Lactobacillus sp. ESL0416 | Isolate | Unclassified |
| 90 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 91 | 2820336130 | Unclassified Firmicutes Nt197P3bin70 | Isolate | Unclassified |
| 92 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 93 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 94 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 95 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 96 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 97 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 98 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 99 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 100 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 101 | 3006468911 | Streptomyces sp. RB17 | Isolate | Termitidae |
| 102 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 103 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 104 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 105 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 106 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 107 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 108 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 109 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 110 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 111 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 112 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 113 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 114 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 115 | 2940261461 | Enterococcus sp. PFB1-1 | Isolate | Blattidae |
| 116 | 2035265002 | Agrotis sp. gut microbial communities from Texas A and M University, USA | Metagenome | Noctuidae |
| 117 | 2523533511 | Streptomyces sp. Sv. ACTE SirexAA-E | Isolate | Siricidae |
| 118 | 2574180310 | Bacillus licheniformis CG-B52 | Isolate | Unclassified |
| 119 | 2820427814 | Unclassified Firmicutes Lab288P3bin44 | Isolate | Unclassified |
| 120 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 121 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 122 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 123 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 124 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 125 | 3300003097 | Cutworm gut microbial communities from Hangzhou, China | Metagenome | Noctuidae |
| 126 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 127 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 128 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 129 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 130 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 131 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 132 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 133 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 134 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 135 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 136 | 2820229114 | Unclassified Firmicutes Th196P4bin40 | Isolate | Unclassified |
| 137 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 138 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 139 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 140 | 8100534375 | Gluconobacter sp. Dm-74 | Isolate | Drosophilidae |
| 141 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 142 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 143 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 144 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 145 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 146 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 147 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 148 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 149 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 150 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 151 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 152 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 153 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 154 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 155 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 156 | 2940218408 | Enterococcus sp. PF1-24 | Isolate | Blattidae |
| 157 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 158 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 159 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 160 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 161 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 162 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 163 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 164 | 8046957834 | Streptomyces coacervatus JCM 17138 | Isolate | Unclassified |
| 165 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 166 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 167 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 168 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 169 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 170 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 171 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 172 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 173 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 174 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 175 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 176 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 177 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 178 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 179 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 180 | 2855798354 | Achromobacter insolitus AR476-2 | Isolate | Crambidae |
| 181 | 2758568558 | Lactobacillus melliventris ESL0393 | Isolate | Unclassified |
| 182 | 2799112220 | Lactobacillus sp. ESL0411 | Isolate | Unclassified |
| 183 | 2816332114 | Microbacterium saperdae DSM 20169 | Isolate | Unclassified |
| 184 | 2820501819 | Unclassified Firmicutes Lab288P1bin51 | Isolate | Unclassified |
| 185 | 2758568513 | Lactobacillus melliventris ESL0260 | Isolate | Unclassified |
| 186 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 187 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 188 | 8012935351 | Brevibacterium epidermidis UD i117 | Isolate | Unclassified |
| 189 | 8012942269 | Mammaliicoccus lentus UD i2 | Isolate | Tenebrionidae |
| 190 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 191 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 192 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 193 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 194 | 8100449422 | Delftia sp. S66 | Isolate | Curculionidae |
| 195 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 196 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 197 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 198 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 199 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 200 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 201 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 202 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 203 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 204 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_091843 | 3300042612 | Unclassified | 6183 |
| 2 | Ga0466733_109518 | 3300042659 | Bacteria | 1387 |
| 3 | Ga0562377_0265 | 3300056842 | Unclassified | 115113 |
| 4 | Ga0160468_100003 | 3300012819 | Bacteria | 705054 |
| 5 | Ga0160431_100002 | 3300012828 | Bacteria | 521722 |
| 6 | Ga0160459_100577 | 3300012831 | Unclassified | 13437 |
| 7 | Ga0466690_100489 | 3300042590 | Bacteria | 4273 |
| 8 | Ga0466691_027549 | 3300042593 | Unclassified | 6540 |
| 9 | Ga0466701_059087 | 3300042598 | Bacteria | 1786 |
| 10 | Ga0466700_022139 | 3300042600 | Bacteria | 1359 |
| 11 | Ga0466707_161594 | 3300042601 | Bacteria | 2455 |
| 12 | Ga0466713_056644 | 3300042602 | Bacteria | 143033 |
| 13 | Ga0466713_136069 | 3300042602 | Bacteria | 4655 |
| 14 | Ga0466722_034296 | 3300042609 | Bacteria | 4669 |
| 15 | Ga0466715_045012 | 3300042616 | Bacteria | 29415 |
| 16 | Ga0466715_088306 | 3300042616 | Bacteria | 4435 |
| 17 | Ga0466723_100849 | 3300042618 | Bacteria | 11159 |
| 18 | Ga0466728_271990 | 3300042620 | Bacteria | 3244 |
| 19 | Ga0466729_144661 | 3300042621 | Bacteria | 69198 |
| 20 | Ga0466729_190114 | 3300042621 | Bacteria | 2665 |
| 21 | Ga0466703_002693 | 3300042636 | Unclassified | 2085 |
| 22 | Ga0466704_134522 | 3300042643 | Unclassified | 2061 |
| 23 | Ga0466708_119803 | 3300042652 | Bacteria | 12127 |
| 24 | Ga0123355_10088498 | 3300009826 | Bacteria | 4918 |
| 25 | Ga0123353_10313692 | 3300010167 | Bacteria | 2384 |
| 26 | Ga0160464_100051 | 3300012805 | Bacteria | 140838 |
| 27 | Ga0104048_1002897 | 3300007143 | Bacteria | 2752 |
| 28 | Ga0466697_258866 | 3300042611 | Bacteria | 1921 |
| 29 | Ga0466705_019242 | 3300042612 | Bacteria | 21181 |
| 30 | Ga0562378_0024 | 3300056814 | Bacteria | 629891 |
| 31 | Ga0562376_0171 | 3300056857 | Bacteria | 137105 |
| 32 | Ga0160446_100109 | 3300012835 | Bacteria | 74405 |
| 33 | Ga0160445_100663 | 3300012847 | Unclassified | 14222 |
| 34 | Ga0160448_107313 | 3300012854 | Unclassified | 2658 |
| 35 | Ga0466691_037986 | 3300042593 | Bacteria | 11192 |
| 36 | Ga0466691_174672 | 3300042593 | Bacteria | 8318 |
| 37 | Ga0466694_082535 | 3300042594 | Unclassified | 17724 |
| 38 | Ga0466719_362925 | 3300042606 | Bacteria | 8280 |
| 39 | Ga0466719_496486 | 3300042606 | Bacteria | 2360 |
| 40 | Ga0466722_207229 | 3300042609 | Bacteria | 3955 |
| 41 | Ga0466715_228918 | 3300042616 | Bacteria | 4308 |
| 42 | Ga0466723_225852 | 3300042618 | Bacteria | 63792 |
| 43 | Ga0466728_020862 | 3300042620 | Bacteria | 5079 |
| 44 | Ga0466728_180721 | 3300042620 | Bacteria | 1802 |
| 45 | Ga0466735_117545 | 3300042624 | Bacteria | 5831 |
| 46 | Ga0466703_180317 | 3300042636 | Bacteria | 3272 |
| 47 | Ga0466704_063924 | 3300042643 | Unclassified | 20471 |
| 48 | Ga0466708_158338 | 3300042652 | Bacteria | 3255 |
| 49 | Ga0466725_244055 | 3300042654 | Bacteria | 1854 |
| 50 | Ga0123357_10388731 | 3300009784 | Bacteria | 1285 |
| 51 | Ga0123355_10175354 | 3300009826 | Bacteria | 3194 |
| 52 | Ga0123353_10138693 | 3300010167 | Bacteria | 3898 |
| 53 | Ga0123353_10832677 | 3300010167 | Bacteria | 1268 |
| 54 | Ga0160466_100275 | 3300012809 | Bacteria | 33598 |
| 55 | FGTW_contig30414 | 2065487013 | Bacteria | 82866 |
| 56 | 2227660728 | 2225789004 | Bacteria | 10504 |
| 57 | Ga0103268_1020428 | 3300007192 | Bacteria | 1494 |
| 58 | Ga0123357_10002292 | 3300009784 | Bacteria | 21223 |
| 59 | Ga0562379_1160 | 3300056790 | Unclassified | 33498 |
| 60 | Ga0562375_0035 | 3300056856 | Bacteria | 623265 |
| 61 | Ga0562375_0777 | 3300056856 | Bacteria | 55253 |
| 62 | Ga0562376_2161 | 3300056857 | Unclassified | 24637 |
| 63 | Ga0160467_103518 | 3300012829 | Unclassified | 2598 |
| 64 | Ga0160455_100001 | 3300012837 | Bacteria | 1265300 |
| 65 | Ga0160435_1001924 | 3300012857 | Bacteria | 5113 |
| 66 | Ga0466691_058355 | 3300042593 | Bacteria | 5433 |
| 67 | Ga0466691_167552 | 3300042593 | Bacteria | 7869 |
| 68 | Ga0466696_200158 | 3300042596 | Bacteria | 3666 |
| 69 | Ga0466722_094696 | 3300042609 | Bacteria | 68121 |
| 70 | Ga0466715_199860 | 3300042616 | Bacteria | 7239 |
| 71 | Ga0466718_133112 | 3300042617 | Bacteria | 1633 |
| 72 | Ga0466726_278049 | 3300042619 | Unclassified | 4024 |
| 73 | Ga0466728_050866 | 3300042620 | Bacteria | 8384 |
| 74 | Ga0466729_016486 | 3300042621 | Bacteria | 4212 |
| 75 | Ga0466703_131824 | 3300042636 | Bacteria | 23297 |
| 76 | Ga0466708_264625 | 3300042652 | Unclassified | 5384 |
| 77 | Ga0123355_10006222 | 3300009826 | Bacteria | 17638 |
| 78 | Ga0123353_10064822 | 3300010167 | Bacteria | 5863 |
| 79 | Ga0123353_10097946 | 3300010167 | Bacteria | 4726 |
| 80 | Ga0123353_10111922 | 3300010167 | Bacteria | 4396 |
| 81 | Ga0123353_10246335 | 3300010167 | Bacteria | 2773 |
| 82 | Ga0123353_10374036 | 3300010167 | Bacteria | 2134 |
| 83 | SWWA_contig31652__length_28041___numreads_1552 | 2100351016 | Bacteria | 28041 |
| 84 | IMNBL1DRAFT_c0000068 | 3300000062 | Bacteria | 94459 |
| 85 | Ga0068302_10118893 | 3300005071 | Bacteria | 2104 |
| 86 | Ga0466697_175591 | 3300042611 | Bacteria | 1423 |
| 87 | Ga0466705_236549 | 3300042612 | Bacteria | 12494 |
| 88 | Ga0562378_0593 | 3300056814 | Unclassified | 57776 |
| 89 | Ga0562374_2302 | 3300057007 | Unclassified | 17349 |
| 90 | Ga0160443_100052 | 3300012848 | Bacteria | 243926 |
| 91 | Ga0160430_100005 | 3300012852 | Bacteria | 393523 |
| 92 | Ga0466692_125699 | 3300042591 | Bacteria | 2400 |
| 93 | Ga0466691_178923 | 3300042593 | Bacteria | 12151 |
| 94 | Ga0466701_089314 | 3300042598 | Bacteria | 182031 |
| 95 | Ga0466713_102257 | 3300042602 | Bacteria | 6163 |
| 96 | Ga0466711_032117 | 3300042615 | Bacteria | 31170 |
| 97 | Ga0466726_077758 | 3300042619 | Bacteria | 8609 |
| 98 | Ga0466726_113297 | 3300042619 | Bacteria | 2784 |
| 99 | Ga0466726_164388 | 3300042619 | Bacteria | 1972 |
| 100 | Ga0466726_468149 | 3300042619 | Bacteria | 40015 |
| 101 | Ga0466728_330111 | 3300042620 | Unclassified | 3258 |
| 102 | Ga0466729_318450 | 3300042621 | Bacteria | 5575 |
| 103 | Ga0466731_171475 | 3300042622 | Bacteria | 3450 |
| 104 | Ga0466735_014128 | 3300042624 | Bacteria | 3794 |
| 105 | Ga0466730_055743 | 3300042625 | Bacteria | 5908 |
| 106 | Ga0466704_472917 | 3300042643 | Bacteria | 13429 |
| 107 | Ga0466704_603628 | 3300042643 | Bacteria | 2269 |
| 108 | Ga0466708_147858 | 3300042652 | Bacteria | 13494 |
| 109 | Ga0466727_110375 | 3300042655 | Bacteria | 3811 |
| 110 | Ga0123357_10247709 | 3300009784 | Bacteria | 1914 |
| 111 | Ga0123355_10164547 | 3300009826 | Bacteria | 3333 |
| 112 | Ga0123353_10338020 | 3300010167 | Bacteria | 2276 |
| 113 | Ga0123353_10468314 | 3300010167 | Bacteria | 1848 |
| 114 | Ga0123353_10800655 | 3300010167 | Bacteria | 1301 |
| 115 | Ga0052191_101481 | 3300003097 | Bacteria | 3950 |
| 116 | Ga0068302_10270160 | 3300005071 | Bacteria | 3374 |
| 117 | Ga0102737_1009799 | 3300007142 | Unclassified | 1637 |
| 118 | Ga0104050_1199859 | 3300007153 | Bacteria | 3382 |
| 119 | Ga0466733_007933 | 3300042659 | Bacteria | 8645 |
| 120 | Ga0562376_1058 | 3300056857 | Unclassified | 41445 |
| 121 | Ga0562376_5209 | 3300056857 | Unclassified | 9019 |
| 122 | Ga0160470_103014 | 3300012813 | Bacteria | 2877 |
| 123 | Ga0160455_100331 | 3300012837 | Bacteria | 28578 |
| 124 | Ga0160447_100381 | 3300012849 | Bacteria | 22299 |
| 125 | Ga0466690_381458 | 3300042590 | Unclassified | 4911 |
| 126 | Ga0466696_099456 | 3300042596 | Bacteria | 38984 |
| 127 | Ga0466696_222674 | 3300042596 | Bacteria | 10897 |
| 128 | Ga0466701_039140 | 3300042598 | Bacteria | 2108 |
| 129 | Ga0466713_010146 | 3300042602 | Bacteria | 22783 |
| 130 | Ga0466713_046070 | 3300042602 | Bacteria | 2754 |
| 131 | Ga0466711_288748 | 3300042615 | Bacteria | 8469 |
| 132 | Ga0466715_090995 | 3300042616 | Bacteria | 3209 |
| 133 | Ga0466715_513990 | 3300042616 | Bacteria | 111655 |
| 134 | Ga0466729_042165 | 3300042621 | Bacteria | 4558 |
| 135 | Ga0466729_254433 | 3300042621 | Bacteria | 1541 |
| 136 | Ga0466703_191120 | 3300042636 | Bacteria | 2466 |
| 137 | Ga0466704_601348 | 3300042643 | Bacteria | 5999 |
| 138 | Ga0466724_25196 | 3300042649 | Bacteria | 102119 |
| 139 | Ga0466727_047678 | 3300042655 | Bacteria | 6199 |
| 140 | Ga0466727_090497 | 3300042655 | Bacteria | 4767 |
| 141 | Ga0123356_10140818 | 3300010049 | Bacteria | 2379 |
| 142 | Ga0123356_10192088 | 3300010049 | Bacteria | 2074 |
| 143 | Ga0123353_10162170 | 3300010167 | Bacteria | 3558 |
| 144 | Ga0123353_10470368 | 3300010167 | Bacteria | 1843 |
| 145 | Ga0160464_100724 | 3300012805 | Unclassified | 18998 |
| 146 | SPBB_contig11590 | 2044078006 | Unclassified | 23047 |
| 147 | Ga0104019_1003546 | 3300007150 | Bacteria | 11424 |
| 148 | Ga0466705_197681 | 3300042612 | Bacteria | 9368 |
| 149 | Ga0562379_0392 | 3300056790 | Bacteria | 98839 |
| 150 | Ga0160432_100004 | 3300012818 | Bacteria | 604772 |
| 151 | Ga0160472_100096 | 3300012839 | Bacteria | 141667 |
| 152 | Ga0160460_101838 | 3300012845 | Unclassified | 5962 |
| 153 | Ga0160457_1000285 | 3300012858 | Unclassified | 32130 |
| 154 | Ga0466707_070461 | 3300042601 | Bacteria | 1577 |
| 155 | Ga0466719_206258 | 3300042606 | Bacteria | 1515 |
| 156 | Ga0466719_256081 | 3300042606 | Unclassified | 3679 |
| 157 | Ga0466711_154971 | 3300042615 | Bacteria | 5818 |
| 158 | Ga0466723_267539 | 3300042618 | Bacteria | 3753 |
| 159 | Ga0466726_008409 | 3300042619 | Bacteria | 4454 |
| 160 | Ga0466726_395866 | 3300042619 | Unclassified | 3784 |
| 161 | Ga0466703_048988 | 3300042636 | Bacteria | 3744 |
| 162 | Ga0466703_197361 | 3300042636 | Bacteria | 3498 |
| 163 | Ga0466703_367076 | 3300042636 | Bacteria | 3769 |
| 164 | Ga0466709_152069 | 3300042648 | Bacteria | 1348 |
| 165 | Ga0466724_08919 | 3300042649 | Bacteria | 32610 |
| 166 | Ga0466708_004545 | 3300042652 | Bacteria | 2890 |
| 167 | Ga0123355_10088769 | 3300009826 | Bacteria | 4909 |
| 168 | Ga0123353_10082260 | 3300010167 | Bacteria | 5179 |
| 169 | Ga0123353_10568581 | 3300010167 | Bacteria | 1630 |
| 170 | Ga0160442_100256 | 3300012806 | Unclassified | 35100 |
| 171 | DPOL_contig02712 | 2035918003 | Bacteria | 7646 |
| 172 | HBC_ctgsDRAFT_1000734 | 3300000333 | Bacteria | 7315 |
| 173 | JGI24702J35022_10006469 | 3300002462 | Bacteria | 6776 |
| 174 | CVPL005L_10018661 | 3300002938 | Unclassified | 3821 |
| 175 | Ga0068305_10002502 | 3300005083 | Bacteria | 32431 |
| 176 | Ga0102740_1008620 | 3300007140 | Bacteria | 1673 |
| 177 | Ga0104050_1199642 | 3300007153 | Bacteria | 7159 |
| 178 | Ga0466705_213129 | 3300042612 | Bacteria | 3607 |
| 179 | Ga0466705_220676 | 3300042612 | Bacteria | 3465 |
| 180 | Ga0562379_1097 | 3300056790 | Unclassified | 36307 |
| 181 | Ga0562379_2890 | 3300056790 | Unclassified | 12828 |
| 182 | Ga0562379_3044 | 3300056790 | Bacteria | 12109 |
| 183 | Ga0562378_2558 | 3300056814 | Unclassified | 14548 |
| 184 | Ga0562376_1272 | 3300056857 | Unclassified | 36400 |
| 185 | Ga0562374_0249 | 3300057007 | Unclassified | 108427 |
| 186 | Ga0562374_3768 | 3300057007 | Bacteria | 6630 |
| 187 | Ga0160456_100002 | 3300012820 | Bacteria | 798475 |
| 188 | Ga0160452_100003 | 3300012834 | Bacteria | 748778 |
| 189 | Ga0160455_100276 | 3300012837 | Unclassified | 35928 |
| 190 | Ga0160445_102897 | 3300012847 | Bacteria | 3717 |
| 191 | Ga0466691_179701 | 3300042593 | Bacteria | 6417 |
| 192 | Ga0466713_032341 | 3300042602 | Bacteria | 5124 |
| 193 | Ga0466713_142766 | 3300042602 | Bacteria | 5943 |
| 194 | Ga0466717_233595 | 3300042604 | Bacteria | 4852 |
| 195 | Ga0466716_282566 | 3300042605 | Bacteria | 5497 |
| 196 | Ga0466711_337863 | 3300042615 | Bacteria | 1707 |
| 197 | Ga0466715_144415 | 3300042616 | Bacteria | 40548 |
| 198 | Ga0466735_061512 | 3300042624 | Bacteria | 1587 |
| 199 | Ga0466735_167196 | 3300042624 | Bacteria | 2592 |
| 200 | Ga0466703_059263 | 3300042636 | Unclassified | 17051 |
| 201 | Ga0466704_014535 | 3300042643 | Bacteria | 6442 |
| 202 | Ga0466709_354282 | 3300042648 | Bacteria | 7534 |
| 203 | Ga0123355_10288042 | 3300009826 | Unclassified | 2258 |
| 204 | Ga0123353_10133326 | 3300010167 | Bacteria | 3985 |
| 205 | Ga0123353_10732296 | 3300010167 | Bacteria | 1380 |
| 206 | Ga0123354_10262157 | 3300010882 | Bacteria | 1723 |
| 207 | CwormDRAF_NODE_2490_len_3920_cov_35_775002 | 2035265002 | Bacteria | 3950 |
| 208 | DPOL_contig13788 | 2035918003 | Unclassified | 14739 |
| 209 | SPBB_contig10817 | 2044078006 | Bacteria | 36006 |
| 210 | Meta3P_1009176 | 3300002464 | Unclassified | 1375 |
| 211 | Ga0466705_024609 | 3300042612 | Unclassified | 6726 |
| 212 | Ga0466705_282212 | 3300042612 | Bacteria | 1590 |
| 213 | Ga0466733_216215 | 3300042659 | Bacteria | 2100 |
| 214 | Ga0562379_0883 | 3300056790 | Bacteria | 44920 |
| 215 | Ga0562378_0318 | 3300056814 | Bacteria | 98432 |
| 216 | Ga0562378_0419 | 3300056814 | Unclassified | 77116 |
| 217 | Ga0562375_0880 | 3300056856 | Unclassified | 49278 |
| 218 | Ga0562375_6549 | 3300056856 | Bacteria | 4192 |
| 219 | Ga0562376_0224 | 3300056857 | Unclassified | 114107 |
| 220 | Ga0160432_100189 | 3300012818 | Bacteria | 54738 |
| 221 | Ga0160444_100224 | 3300012841 | Bacteria | 48570 |
| 222 | Ga0466719_136870 | 3300042606 | Unclassified | 2641 |
| 223 | Ga0466719_137370 | 3300042606 | Unclassified | 14123 |
| 224 | Ga0466715_002209 | 3300042616 | Bacteria | 13944 |
| 225 | Ga0466715_280266 | 3300042616 | Bacteria | 6177 |
| 226 | Ga0466715_293579 | 3300042616 | Bacteria | 18410 |
| 227 | Ga0466723_312502 | 3300042618 | Bacteria | 14129 |
| 228 | Ga0466723_326301 | 3300042618 | Bacteria | 2835 |
| 229 | Ga0466726_162499 | 3300042619 | Unclassified | 6244 |
| 230 | Ga0466726_434338 | 3300042619 | Bacteria | 4329 |
| 231 | Ga0466704_092151 | 3300042643 | Bacteria | 9365 |
| 232 | Ga0123355_10008930 | 3300009826 | Bacteria | 15185 |
| 233 | Ga0123355_10111849 | 3300009826 | Bacteria | 4264 |
| 234 | Ga0123356_10045939 | 3300010049 | Bacteria | 4064 |
| 235 | Ga0123356_10179138 | 3300010049 | Bacteria | 2139 |
| 236 | Ga0123356_10219128 | 3300010049 | Bacteria | 1958 |
| 237 | Ga0123353_10001216 | 3300010167 | Bacteria | 31516 |
| 238 | Ga0123354_10261508 | 3300010882 | Bacteria | 1727 |
| 239 | Ga0160454_100094 | 3300012798 | Bacteria | 116013 |
| 240 | DPO_contig00193 | 2032320009 | Bacteria | 10943 |
| 241 | CVPL005W_1000560 | 3300002934 | Bacteria | 14076 |
| 242 | Ga0103261_1002129 | 3300007083 | Bacteria | 3120 |
| 243 | Ga0103260_1000410 | 3300007139 | Bacteria | 8338 |
| 244 | Ga0103264_1000369 | 3300007188 | Bacteria | 33652 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.