Protein Family IF02465
Metagenome
Isolate
218
Members
89
Samples
185
Scaffolds
461.36
Avg Length
Representative Sequence
- ID
- 3300009826|Ga0123355_10148249|Ga0123355_101482491
- Length
- 447 aa
- Sequence
- MKKIPYKIYLTEEEIPKAWYNVRADMKTDHRPILNPGTLMPVTAEELSPVFCDELIKQELNDTDRYIEIPEEIRDFYKMYRPSPLVRAYSLEEALDTPAKIYYKYEGGNTSGSHKLNSAIAQAYYAKKQGLKGVTTETGAGQWGTALSMACGYFGLDLKVYMVKVSAEQKPYRKGVMETFGASVTLSPSDTTNIGRLMLQNDPQTGGSLGSTDGYKYVLGSVLNQVILHQTVIGQEAKLAFEKIGDYPDIIIGSAGGGSNLGGIMLPFMADKLAGEKSPYFIAVEPSSCPSLTRGKFAYDFCDTGMVTPLAKMYTLGATFIPPKNHAGGLRYHGMSPILSQLYHDGYIDEARAVGQKELFDAAVKFAKLEGTLPAPESAHAIKAALDEAVKCKETGEAKTILFCLSGTGYFDLGAYMSYNEGTLTDLVPTDEDLERGLSAIPKVDK*
Sample Types
Isolate
15.1%
Metagenome
84.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
39.8%
Termitidae
36.4%
Kalotermitidae
13.6%
Rhinotermitidae
3.4%
Termopsidae
3.4%
Passalidae
2.3%
Hodotermitidae
1.1%
Taxonomy
Archaea
1
Bacteria
208
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820350530 | Unclassified Firmicutes Nt197P3bin37 | Isolate | Unclassified |
| 2 | 2820442516 | Unclassified Firmicutes Lab288P3bin200 | Isolate | Unclassified |
| 3 | 2820551407 | Unclassified Firmicutes Emb289P4bin38 | Isolate | Unclassified |
| 4 | 2820594669 | Unclassified Firmicutes Emb289P1bin61 | Isolate | Unclassified |
| 5 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 6 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 7 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 8 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 9 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 10 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 11 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 12 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 13 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 14 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 15 | 2820836992 | Unclassified Actinobacteria Lab288P4bin32 | Isolate | Unclassified |
| 16 | 2820516196 | Unclassified Firmicutes Lab288P1bin3 | Isolate | Unclassified |
| 17 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 18 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 19 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 20 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 21 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 22 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 23 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 24 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 25 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 26 | 2820220859 | Unclassified Firmicutes Th196P4bin59 | Isolate | Unclassified |
| 27 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 28 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 29 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 30 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 31 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 32 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 33 | 2585428085 | Sporobacter termitidis DSM 10068 | Isolate | Termitidae |
| 34 | 2820275298 | Unclassified Firmicutes Th196P3bin17 | Isolate | Unclassified |
| 35 | 2820405014 | Unclassified Firmicutes Lab288P4bin88 | Isolate | Unclassified |
| 36 | 2820620956 | Unclassified Firmicutes Emb289P1bin128 | Isolate | Unclassified |
| 37 | 2820626145 | Unclassified Firmicutes Emb289P1bin123 | Isolate | Unclassified |
| 38 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 39 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 40 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 41 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 42 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 43 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 44 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 45 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 46 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 47 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 48 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 49 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 50 | 2820799971 | Unclassified Actinobacteria Th196P4bin46 | Isolate | Unclassified |
| 51 | 2820823448 | Unclassified Actinobacteria Nt197P3bin113 | Isolate | Unclassified |
| 52 | 2820831444 | Unclassified Actinobacteria Nc150P4bin21 | Isolate | Unclassified |
| 53 | 2820916033 | Unclassified Actinobacteria Emb289P3bin63 | Isolate | Unclassified |
| 54 | 2820566695 | Unclassified Firmicutes Emb289P3bin50 | Isolate | Unclassified |
| 55 | 2820666966 | Unclassified Firmicutes Co191P3bin39 | Isolate | Unclassified |
| 56 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 57 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 58 | 2820822094 | Unclassified Actinobacteria Nt197P3bin131 | Isolate | Unclassified |
| 59 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 60 | 2228664001 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4a from Florida USA | Metagenome | Termitidae |
| 61 | 2820314258 | Unclassified Firmicutes Nt197P4bin16 | Isolate | Unclassified |
| 62 | 2820327087 | Unclassified Firmicutes Nt197P3bin79 | Isolate | Unclassified |
| 63 | 2820340373 | Unclassified Firmicutes Nt197P3bin67 | Isolate | Unclassified |
| 64 | 2820344559 | Unclassified Firmicutes Nt197P3bin63 | Isolate | Unclassified |
| 65 | 2820459456 | Unclassified Firmicutes Lab288P3bin148 | Isolate | Unclassified |
| 66 | 2820647881 | Unclassified Firmicutes Cu122P5bin16 | Isolate | Unclassified |
| 67 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 68 | 2820231849 | Unclassified Firmicutes Th196P4bin1 | Isolate | Unclassified |
| 69 | 2820504582 | Unclassified Firmicutes Lab288P1bin5 | Isolate | Unclassified |
| 70 | 2820563109 | Unclassified Firmicutes Emb289P3bin58 | Isolate | Unclassified |
| 71 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 72 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 73 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 74 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 75 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 76 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 77 | 2820800812 | Unclassified Actinobacteria Th196P4bin28 | Isolate | Unclassified |
| 78 | 2820013017 | Unclassified Spirochaetes Th196P3bin152 | Isolate | Unclassified |
| 79 | 2820246658 | Unclassified Firmicutes Th196P3bin70 | Isolate | Unclassified |
| 80 | 2820444930 | Unclassified Firmicutes Lab288P3bin199 | Isolate | Unclassified |
| 81 | 2820637417 | Unclassified Firmicutes Emb289P1bin108 | Isolate | Unclassified |
| 82 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 83 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 84 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 85 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 86 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 87 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 88 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 89 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466712_092696 | 3300042614 | Bacteria | 3752 |
| 2 | Ga0123355_10067441 | 3300009826 | Bacteria | 5757 |
| 3 | Ga0123356_10004384 | 3300010049 | Bacteria | 14583 |
| 4 | Ga0123356_10028007 | 3300010049 | Unclassified | 5279 |
| 5 | Ga0123356_10087400 | 3300010049 | Bacteria | 2961 |
| 6 | Ga0123353_10008352 | 3300010167 | Bacteria | 14130 |
| 7 | Ga0123353_10100676 | 3300010167 | Unclassified | 4658 |
| 8 | Ga0123353_10153545 | 3300010167 | Unclassified | 3673 |
| 9 | Ga0123353_10169898 | 3300010167 | Bacteria | 3462 |
| 10 | Ga0123353_10209012 | 3300010167 | Bacteria | 3063 |
| 11 | Ga0123353_10320877 | 3300010167 | Unclassified | 2351 |
| 12 | Ga0123354_10046854 | 3300010882 | Bacteria | 6599 |
| 13 | Ga0123354_10145191 | 3300010882 | Bacteria | 2908 |
| 14 | Ga0466729_229878 | 3300042621 | Bacteria | 4184 |
| 15 | 2227524066 | 2225789004 | Bacteria | 3284 |
| 16 | JGI24695J34938_10051012 | 3300002450 | Bacteria | 1813 |
| 17 | Ga0072940_1323512 | 3300005200 | Bacteria | 2009 |
| 18 | Ga0466714_166845 | 3300042603 | Bacteria | 1907 |
| 19 | Ga0466722_252105 | 3300042609 | Bacteria | 44336 |
| 20 | Ga0466698_072601 | 3300042610 | Bacteria | 1720 |
| 21 | Ga0415639_005660 | 3300038395 | Bacteria | 69302 |
| 22 | Ga0466693_121857 | 3300042592 | Bacteria | 33009 |
| 23 | Ga0466696_052765 | 3300042596 | Bacteria | 20018 |
| 24 | Ga0466711_182952 | 3300042615 | Bacteria | 9864 |
| 25 | Ga0466723_002382 | 3300042618 | Bacteria | 33048 |
| 26 | Ga0123355_10000650 | 3300009826 | Bacteria | 47147 |
| 27 | Ga0123356_10008426 | 3300010049 | Bacteria | 10252 |
| 28 | Ga0123353_10002746 | 3300010167 | Bacteria | 21956 |
| 29 | Ga0123353_10014113 | 3300010167 | Bacteria | 11496 |
| 30 | Ga0123353_10031227 | 3300010167 | Bacteria | 8247 |
| 31 | Ga0123353_10058710 | 3300010167 | Bacteria | 6165 |
| 32 | Ga0123353_10105927 | 3300010167 | Bacteria | 4531 |
| 33 | Ga0123353_10214068 | 3300010167 | Bacteria | 3020 |
| 34 | Ga0123354_10024912 | 3300010882 | Bacteria | 9433 |
| 35 | Ga0123354_10040843 | 3300010882 | Bacteria | 7174 |
| 36 | Ga0466702_264075 | 3300042635 | Bacteria | 2507 |
| 37 | 2230930032 | 2228664001 | Bacteria | 4415 |
| 38 | JGI24698J34947_10076156 | 3300002449 | Bacteria | 1592 |
| 39 | JGI24702J35022_10000804 | 3300002462 | Bacteria | 19405 |
| 40 | JGI24702J35022_10025554 | 3300002462 | Bacteria | 3185 |
| 41 | Ga0123357_10001928 | 3300009784 | Unclassified | 22610 |
| 42 | Ga0466706_122935 | 3300042599 | Bacteria | 1543 |
| 43 | Ga0466714_095330 | 3300042603 | Bacteria | 2417 |
| 44 | Ga0466714_140985 | 3300042603 | Bacteria | 3835 |
| 45 | Ga0466717_102305 | 3300042604 | Bacteria | 35520 |
| 46 | Ga0466721_024461 | 3300042608 | Bacteria | 2468 |
| 47 | Ga0466698_292285 | 3300042610 | Bacteria | 3887 |
| 48 | Ga0466693_031959 | 3300042592 | Bacteria | 5914 |
| 49 | Ga0466696_005522 | 3300042596 | Bacteria | 2127 |
| 50 | Ga0466696_053516 | 3300042596 | Bacteria | 3248 |
| 51 | Ga0466696_292037 | 3300042596 | Bacteria | 1910 |
| 52 | Ga0466699_252016 | 3300042597 | Bacteria | 1944 |
| 53 | Ga0466732_455362 | 3300042656 | Bacteria | 1819 |
| 54 | Ga0466715_126788 | 3300042616 | Bacteria | 18667 |
| 55 | Ga0466715_245116 | 3300042616 | Bacteria | 56913 |
| 56 | Ga0123355_10365881 | 3300009826 | Bacteria | 1894 |
| 57 | Ga0123356_10039226 | 3300010049 | Bacteria | 4412 |
| 58 | Ga0123356_10223166 | 3300010049 | Bacteria | 1942 |
| 59 | Ga0123353_10002221 | 3300010167 | Bacteria | 24044 |
| 60 | Ga0123353_10051972 | 3300010167 | Unclassified | 6542 |
| 61 | Ga0123353_10149807 | 3300010167 | Bacteria | 3726 |
| 62 | Ga0123353_10442439 | 3300010167 | Bacteria | 1917 |
| 63 | Ga0466729_214468 | 3300042621 | Bacteria | 4695 |
| 64 | Ga0466731_130185 | 3300042622 | Bacteria | 1719 |
| 65 | Ga0466702_058018 | 3300042635 | Bacteria | 1549 |
| 66 | Ga0466704_505648 | 3300042643 | Bacteria | 44878 |
| 67 | Ga0466708_220377 | 3300042652 | Bacteria | 5637 |
| 68 | 2227083609 | 2225789004 | Bacteria | 9990 |
| 69 | IMNBL1DRAFT_c0002952 | 3300000062 | Bacteria | 11301 |
| 70 | AustNasuHG_c1007160 | 3300000089 | Bacteria | 3974 |
| 71 | AustNasuHG_c1029124 | 3300000089 | Bacteria | 1627 |
| 72 | JGI24695J34938_10004744 | 3300002450 | Bacteria | 8794 |
| 73 | JGI24702J35022_10005541 | 3300002462 | Bacteria | 7361 |
| 74 | JGI24705J35276_12223307 | 3300002504 | Bacteria | 2496 |
| 75 | Ga0466707_393556 | 3300042601 | Bacteria | 121495 |
| 76 | Ga0466717_046336 | 3300042604 | Bacteria | 8617 |
| 77 | Ga0466721_214422 | 3300042608 | Bacteria | 12139 |
| 78 | Ga0466722_086496 | 3300042609 | Bacteria | 2135 |
| 79 | Ga0466722_183422 | 3300042609 | Bacteria | 24688 |
| 80 | Ga0466692_076735 | 3300042591 | Bacteria | 1542 |
| 81 | Ga0466695_214930 | 3300042595 | Bacteria | 1732 |
| 82 | Ga0466696_107112 | 3300042596 | Bacteria | 2682 |
| 83 | Ga0466705_281988 | 3300042612 | Bacteria | 6527 |
| 84 | Ga0466705_344355 | 3300042612 | Bacteria | 21068 |
| 85 | Ga0466733_000635 | 3300042659 | Bacteria | 6194 |
| 86 | Ga0466705_521894 | 3300042612 | Bacteria | 138507 |
| 87 | Ga0466723_206273 | 3300042618 | Bacteria | 3521 |
| 88 | Ga0466726_190944 | 3300042619 | Bacteria | 3510 |
| 89 | Ga0466728_019771 | 3300042620 | Bacteria | 56099 |
| 90 | Ga0123356_10007428 | 3300010049 | Bacteria | 10934 |
| 91 | Ga0123356_10249494 | 3300010049 | Bacteria | 1852 |
| 92 | Ga0123353_10002375 | 3300010167 | Bacteria | 23381 |
| 93 | Ga0123353_10071739 | 3300010167 | Bacteria | 5565 |
| 94 | Ga0466702_290235 | 3300042635 | Bacteria | 2905 |
| 95 | IMNBL1DRAFT_c0009646 | 3300000062 | Bacteria | 4737 |
| 96 | JGI24702J35022_10037080 | 3300002462 | Bacteria | 2604 |
| 97 | Ga0068302_10022400 | 3300005071 | Bacteria | 9068 |
| 98 | Ga0068305_10246485 | 3300005083 | Bacteria | 4157 |
| 99 | Ga0466707_069854 | 3300042601 | Bacteria | 2326 |
| 100 | Ga0466714_082941 | 3300042603 | Bacteria | 1836 |
| 101 | Ga0466714_097571 | 3300042603 | Bacteria | 3200 |
| 102 | Ga0466719_364060 | 3300042606 | Bacteria | 1857 |
| 103 | Ga0466722_045557 | 3300042609 | Bacteria | 252817 |
| 104 | Ga0466722_099050 | 3300042609 | Bacteria | 13220 |
| 105 | Ga0264413_118197 | 3300024493 | Bacteria | 20610 |
| 106 | Ga0415639_065018 | 3300038395 | Bacteria | 1843 |
| 107 | Ga0466693_423698 | 3300042592 | Bacteria | 4017 |
| 108 | Ga0466694_330344 | 3300042594 | Bacteria | 5589 |
| 109 | Ga0466696_256199 | 3300042596 | Bacteria | 5237 |
| 110 | Ga0123357_10082334 | 3300009784 | Bacteria | 4226 |
| 111 | Ga0123355_10000482 | 3300009826 | Bacteria | 52802 |
| 112 | Ga0123355_10102870 | 3300009826 | Unclassified | 4491 |
| 113 | Ga0123356_10001010 | 3300010049 | Bacteria | 31261 |
| 114 | Ga0123353_10178368 | 3300010167 | Bacteria | 3366 |
| 115 | Ga0123353_10395563 | 3300010167 | Bacteria | 2059 |
| 116 | Ga0123353_10440191 | 3300010167 | Bacteria | 1923 |
| 117 | Ga0123354_10003309 | 3300010882 | Bacteria | 22168 |
| 118 | Ga0466703_346065 | 3300042636 | Bacteria | 2036 |
| 119 | Ga0466704_354926 | 3300042643 | Bacteria | 3195 |
| 120 | JGI24695J34938_10000116 | 3300002450 | Bacteria | 71709 |
| 121 | JGI24702J35022_10000005 | 3300002462 | Bacteria | 97723 |
| 122 | JGI24702J35022_10010804 | 3300002462 | Bacteria | 5095 |
| 123 | JGI24696J40584_12961316 | 3300002834 | Bacteria | 13499 |
| 124 | Ga0466706_087918 | 3300042599 | Bacteria | 1776 |
| 125 | Ga0466713_103292 | 3300042602 | Bacteria | 50986 |
| 126 | Ga0466716_254710 | 3300042605 | Bacteria | 6371 |
| 127 | Ga0466691_228432 | 3300042593 | Bacteria | 5130 |
| 128 | Ga0466705_175203 | 3300042612 | Bacteria | 27231 |
| 129 | Ga0466732_051850 | 3300042656 | Bacteria | 5585 |
| 130 | Ga0466733_113704 | 3300042659 | Bacteria | 1773 |
| 131 | Ga0466715_064229 | 3300042616 | Bacteria | 47985 |
| 132 | Ga0466715_081361 | 3300042616 | Bacteria | 4874 |
| 133 | Ga0123355_10149904 | 3300009826 | Bacteria | 3546 |
| 134 | Ga0123356_10002854 | 3300010049 | Bacteria | 18281 |
| 135 | Ga0123353_10027269 | 3300010167 | Bacteria | 8751 |
| 136 | Ga0123353_10067305 | 3300010167 | Bacteria | 5751 |
| 137 | Ga0123353_10196780 | 3300010167 | Bacteria | 3176 |
| 138 | Ga0123353_10216536 | 3300010167 | Bacteria | 2999 |
| 139 | Ga0466702_070425 | 3300042635 | Bacteria | 43516 |
| 140 | Ga0466704_164591 | 3300042643 | Bacteria | 88701 |
| 141 | Ga0466708_100580 | 3300042652 | Bacteria | 73079 |
| 142 | Ga0466719_077282 | 3300042606 | Bacteria | 92925 |
| 143 | Ga0466719_296006 | 3300042606 | Bacteria | 2609 |
| 144 | Ga0466720_217745 | 3300042607 | Bacteria | 1883 |
| 145 | Ga0466696_272260 | 3300042596 | Bacteria | 4370 |
| 146 | Ga0466723_234019 | 3300042618 | Bacteria | 4109 |
| 147 | Ga0123355_10148249 | 3300009826 | Bacteria | 3571 |
| 148 | Ga0123356_10000573 | 3300010049 | Bacteria | 40859 |
| 149 | Ga0123356_10008097 | 3300010049 | Bacteria | 10468 |
| 150 | Ga0123356_10346603 | 3300010049 | Unclassified | 1608 |
| 151 | Ga0123353_10069420 | 3300010167 | Bacteria | 5661 |
| 152 | Ga0123353_10173093 | 3300010167 | Archaea | 3425 |
| 153 | Ga0466703_026485 | 3300042636 | Bacteria | 12930 |
| 154 | Ga0466704_179314 | 3300042643 | Bacteria | 15306 |
| 155 | Ga0466727_089758 | 3300042655 | Bacteria | 159388 |
| 156 | IMNBL1DRAFT_c0001961 | 3300000062 | Bacteria | 14823 |
| 157 | JGI24695J34938_10014417 | 3300002450 | Unclassified | 4098 |
| 158 | Ga0466713_115343 | 3300042602 | Bacteria | 67413 |
| 159 | Ga0466714_093173 | 3300042603 | Bacteria | 4247 |
| 160 | Ga0466717_259680 | 3300042604 | Bacteria | 6275 |
| 161 | Ga0466717_295668 | 3300042604 | Bacteria | 8673 |
| 162 | Ga0466722_110552 | 3300042609 | Bacteria | 5357 |
| 163 | Ga0466698_362630 | 3300042610 | Bacteria | 3864 |
| 164 | Ga0415639_093970 | 3300038395 | Bacteria | 6980 |
| 165 | Ga0466657_401935 | 3300042582 | Bacteria | 2617 |
| 166 | Ga0466696_466134 | 3300042596 | Bacteria | 4019 |
| 167 | Ga0466715_476699 | 3300042616 | Bacteria | 1842 |
| 168 | Ga0466715_545602 | 3300042616 | Bacteria | 41156 |
| 169 | Ga0466718_134175 | 3300042617 | Bacteria | 3113 |
| 170 | Ga0466723_185844 | 3300042618 | Bacteria | 2979 |
| 171 | Ga0123355_10000939 | 3300009826 | Bacteria | 40311 |
| 172 | Ga0123356_10023120 | 3300010049 | Bacteria | 5855 |
| 173 | Ga0123356_10047492 | 3300010049 | Bacteria | 3995 |
| 174 | Ga0123356_10151414 | 3300010049 | Bacteria | 2303 |
| 175 | Ga0123356_10178912 | 3300010049 | Bacteria | 2141 |
| 176 | Ga0123356_10272193 | 3300010049 | Bacteria | 1784 |
| 177 | Ga0123353_10290832 | 3300010167 | Bacteria | 2501 |
| 178 | Ga0123353_10395382 | 3300010167 | Bacteria | 2060 |
| 179 | Ga0466704_155328 | 3300042643 | Bacteria | 9427 |
| 180 | Ga0466708_063734 | 3300042652 | Bacteria | 25187 |
| 181 | AustNasuHG_c1001606 | 3300000089 | Bacteria | 8150 |
| 182 | Ga0466700_243609 | 3300042600 | Bacteria | 4127 |
| 183 | Ga0466707_331371 | 3300042601 | Bacteria | 8724 |
| 184 | Ga0466691_187865 | 3300042593 | Bacteria | 2433 |
| 185 | Ga0466696_459044 | 3300042596 | Bacteria | 1958 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042656 | Ga0466732_455362 | Ga0466732_455362_463_1800 | 445 |
| 2 | 3300009826 | Ga0123355_10148249 | Ga0123355_101482491 | 447 |
| 3 | iso_pr_bacteria | 2820314258 | 2820315783 | 447 |
| 4 | 3300042616 | Ga0466715_064229 | Ga0466715_064229_759_2108 | 449 |
| 5 | 3300042612 | Ga0466705_344355 | Ga0466705_344355_11548_12927 | 450 |
| 6 | 3300002462 | JGI24702J35022_10000005 | JGI24702J35022_1000000519 | 451 |
| 7 | 3300042635 | Ga0466702_058018 | Ga0466702_058018_99_1463 | 454 |
| 8 | iso_pr_bacteria | 2820275298 | 2820276128 | 454 |
| 9 | iso_pr_bacteria | 2820340373 | 2820340483 | 454 |
| 10 | iso_pr_bacteria | 2820350530 | 2820352635 | 454 |
| 11 | 3300042582 | Ga0466657_401935 | Ga0466657_401935_274_1641 | 455 |
| 12 | 3300042603 | Ga0466714_095330 | Ga0466714_095330_210_1577 | 455 |
| 13 | 3300042603 | Ga0466714_166845 | Ga0466714_166845_275_1642 | 455 |
| 14 | iso_pr_bacteria | 2820327087 | 2820327431 | 455 |
| 15 | iso_pr_bacteria | 2820405014 | 2820405716 | 455 |
| 16 | 3300009826 | Ga0123355_10365881 | Ga0123355_103658812 | 456 |
| 17 | 3300010882 | Ga0123354_10024912 | Ga0123354_100249126 | 456 |
| 18 | 3300042596 | Ga0466696_256199 | Ga0466696_256199_168_1538 | 456 |
| 19 | 3300042596 | Ga0466696_466134 | Ga0466696_466134_2504_3874 | 456 |
| 20 | 3300042599 | Ga0466706_087918 | Ga0466706_087918_171_1541 | 456 |
| 21 | 3300042635 | Ga0466702_264075 | Ga0466702_264075_968_2338 | 456 |
| 22 | 3300042659 | Ga0466733_000635 | Ga0466733_000635_4706_6076 | 456 |
| 23 | iso_pr_bacteria | 2820459456 | 2820459891 | 456 |
| 24 | iso_pr_bacteria | 2820504582 | 2820505024 | 456 |
| 25 | iso_pr_bacteria | 2820647881 | 2820650059 | 456 |
| 26 | 2225789004 | 2227524066 | 2228030048 | 457 |
| 27 | 3300010167 | Ga0123353_10058710 | Ga0123353_100587104 | 457 |
| 28 | 3300042609 | Ga0466722_099050 | Ga0466722_099050_637_2010 | 457 |
| 29 | 3300042615 | Ga0466711_182952 | Ga0466711_182952_2495_3868 | 457 |
| 30 | 3300042619 | Ga0466726_190944 | Ga0466726_190944_1928_3301 | 457 |
| 31 | 3300042636 | Ga0466703_346065 | Ga0466703_346065_627_2000 | 457 |
| 32 | 3300042652 | Ga0466708_063734 | Ga0466708_063734_10573_11946 | 457 |
| 33 | iso_pr_bacteria | 2820620956 | 2820621640 | 457 |
| 34 | iso_pr_bacteria | 2820666966 | 2820668067 | 457 |
| 35 | 2225789004 | 2227083609 | 2227459237 | 458 |
| 36 | 3300002450 | JGI24695J34938_10000116 | JGI24695J34938_1000011662 | 458 |
| 37 | 3300009826 | Ga0123355_10000650 | Ga0123355_1000065037 | 458 |
| 38 | 3300010167 | Ga0123353_10105927 | Ga0123353_101059272 | 458 |
| 39 | 3300010167 | Ga0123353_10395563 | Ga0123353_103955631 | 458 |
| 40 | 3300038395 | Ga0415639_093970 | Ga0415639_093970_2932_4308 | 458 |
| 41 | 3300042596 | Ga0466696_107112 | Ga0466696_107112_261_1637 | 458 |
| 42 | 3300042597 | Ga0466699_252016 | Ga0466699_252016_485_1861 | 458 |
| 43 | 3300042603 | Ga0466714_082941 | Ga0466714_082941_410_1786 | 458 |
| 44 | 3300042603 | Ga0466714_140985 | Ga0466714_140985_2418_3794 | 458 |
| 45 | 3300042604 | Ga0466717_259680 | Ga0466717_259680_3961_5337 | 458 |
| 46 | 3300042618 | Ga0466723_185844 | Ga0466723_185844_11_1387 | 458 |
| 47 | 3300042618 | Ga0466723_234019 | Ga0466723_234019_1400_2776 | 458 |
| 48 | 3300042643 | Ga0466704_164591 | Ga0466704_164591_11021_12397 | 458 |
| 49 | 3300042656 | Ga0466732_051850 | Ga0466732_051850_2218_3594 | 458 |
| 50 | iso_pr_bacteria | 2820220859 | 2820222270 | 458 |
| 51 | iso_pr_bacteria | 2820231849 | 2820234097 | 458 |
| 52 | iso_pr_bacteria | 2820246658 | 2820247734 | 458 |
| 53 | iso_pr_bacteria | 2820344559 | 2820345093 | 458 |
| 54 | iso_pr_bacteria | 2820516196 | 2820517685 | 458 |
| 55 | iso_pr_bacteria | 2820566695 | 2820568900 | 458 |
| 56 | 3300000062 | IMNBL1DRAFT_c0001961 | IMNBL1DRAFT_00019612 | 459 |
| 57 | 3300002450 | JGI24695J34938_10051012 | JGI24695J34938_100510121 | 459 |
| 58 | 3300002462 | JGI24702J35022_10000804 | JGI24702J35022_1000080419 | 459 |
| 59 | 3300002462 | JGI24702J35022_10010804 | JGI24702J35022_100108042 | 459 |
| 60 | 3300005083 | Ga0068305_10246485 | Ga0068305_102464855 | 459 |
| 61 | 3300010049 | Ga0123356_10004384 | Ga0123356_1000438414 | 459 |
| 62 | 3300010049 | Ga0123356_10007428 | Ga0123356_100074284 | 459 |
| 63 | 3300010049 | Ga0123356_10008426 | Ga0123356_100084261 | 459 |
| 64 | 3300010049 | Ga0123356_10039226 | Ga0123356_100392263 | 459 |
| 65 | 3300010049 | Ga0123356_10178912 | Ga0123356_101789123 | 459 |
| 66 | 3300010167 | Ga0123353_10008352 | Ga0123353_100083523 | 459 |
| 67 | 3300010167 | Ga0123353_10031227 | Ga0123353_100312271 | 459 |
| 68 | 3300010167 | Ga0123353_10069420 | Ga0123353_100694202 | 459 |
| 69 | 3300010882 | Ga0123354_10046854 | Ga0123354_100468546 | 459 |
| 70 | 3300024493 | Ga0264413_118197 | Ga0264413_1181977 | 459 |
| 71 | 3300038395 | Ga0415639_005660 | Ga0415639_005660_1474_2853 | 459 |
| 72 | 3300038395 | Ga0415639_065018 | Ga0415639_065018_227_1606 | 459 |
| 73 | 3300042595 | Ga0466695_214930 | Ga0466695_214930_239_1618 | 459 |
| 74 | 3300042599 | Ga0466706_122935 | Ga0466706_122935_18_1397 | 459 |
| 75 | 3300042601 | Ga0466707_393556 | Ga0466707_393556_41147_42526 | 459 |
| 76 | 3300042604 | Ga0466717_046336 | Ga0466717_046336_1134_2513 | 459 |
| 77 | 3300042604 | Ga0466717_102305 | Ga0466717_102305_17240_18619 | 459 |
| 78 | 3300042604 | Ga0466717_295668 | Ga0466717_295668_1030_2409 | 459 |
| 79 | 3300042606 | Ga0466719_364060 | Ga0466719_364060_73_1452 | 459 |
| 80 | 3300042607 | Ga0466720_217745 | Ga0466720_217745_451_1830 | 459 |
| 81 | 3300042608 | Ga0466721_024461 | Ga0466721_024461_271_1650 | 459 |
| 82 | 3300042608 | Ga0466721_214422 | Ga0466721_214422_4629_6008 | 459 |
| 83 | 3300042610 | Ga0466698_292285 | Ga0466698_292285_255_1634 | 459 |
| 84 | 3300042614 | Ga0466712_092696 | Ga0466712_092696_1649_3028 | 459 |
| 85 | 3300042635 | Ga0466702_290235 | Ga0466702_290235_1424_2803 | 459 |
| 86 | 3300042643 | Ga0466704_354926 | Ga0466704_354926_1699_3078 | 459 |
| 87 | iso_pr_bacteria | 2820442516 | 2820444535 | 459 |
| 88 | iso_pr_bacteria | 2820444930 | 2820445570 | 459 |
| 89 | iso_pr_bacteria | 2820551407 | 2820553385 | 459 |
| 90 | iso_pr_bacteria | 2820563109 | 2820565191 | 459 |
| 91 | iso_pr_bacteria | 2820637417 | 2820637911 | 459 |
| 92 | iso_pr_bacteria | 2820822094 | 2820822966 | 459 |
| 93 | 3300000062 | IMNBL1DRAFT_c0009646 | IMNBL1DRAFT_00096463 | 460 |
| 94 | 3300000089 | AustNasuHG_c1001606 | AustNasuHG_10016067 | 460 |
| 95 | 3300000089 | AustNasuHG_c1007160 | AustNasuHG_10071602 | 460 |
| 96 | 3300000089 | AustNasuHG_c1029124 | AustNasuHG_10291241 | 460 |
| 97 | 3300002450 | JGI24695J34938_10004744 | JGI24695J34938_100047446 | 460 |
| 98 | 3300002450 | JGI24695J34938_10014417 | JGI24695J34938_100144173 | 460 |
| 99 | 3300002462 | JGI24702J35022_10005541 | JGI24702J35022_100055413 | 460 |
| 100 | 3300002462 | JGI24702J35022_10037080 | JGI24702J35022_100370802 | 460 |
| 101 | 3300009784 | Ga0123357_10001928 | Ga0123357_1000192825 | 460 |
| 102 | 3300009784 | Ga0123357_10082334 | Ga0123357_100823344 | 460 |
| 103 | 3300009826 | Ga0123355_10000482 | Ga0123355_1000048244 | 460 |
| 104 | 3300009826 | Ga0123355_10102870 | Ga0123355_101028702 | 460 |
| 105 | 3300010049 | Ga0123356_10001010 | Ga0123356_1000101014 | 460 |
| 106 | 3300010049 | Ga0123356_10002854 | Ga0123356_100028546 | 460 |
| 107 | 3300010049 | Ga0123356_10023120 | Ga0123356_100231205 | 460 |
| 108 | 3300010049 | Ga0123356_10028007 | Ga0123356_100280071 | 460 |
| 109 | 3300010049 | Ga0123356_10047492 | Ga0123356_100474922 | 460 |
| 110 | 3300010049 | Ga0123356_10249494 | Ga0123356_102494942 | 460 |
| 111 | 3300010049 | Ga0123356_10272193 | Ga0123356_102721931 | 460 |
| 112 | 3300010049 | Ga0123356_10346603 | Ga0123356_103466031 | 460 |
| 113 | 3300010167 | Ga0123353_10002375 | Ga0123353_100023753 | 460 |
| 114 | 3300010167 | Ga0123353_10014113 | Ga0123353_1001411310 | 460 |
| 115 | 3300010167 | Ga0123353_10051972 | Ga0123353_100519725 | 460 |
| 116 | 3300010167 | Ga0123353_10100676 | Ga0123353_101006764 | 460 |
| 117 | 3300010167 | Ga0123353_10149807 | Ga0123353_101498072 | 460 |
| 118 | 3300010167 | Ga0123353_10153545 | Ga0123353_101535452 | 460 |
| 119 | 3300010167 | Ga0123353_10169898 | Ga0123353_101698981 | 460 |
| 120 | 3300010167 | Ga0123353_10173093 | Ga0123353_101730931 | 460 |
| 121 | 3300010167 | Ga0123353_10178368 | Ga0123353_101783682 | 460 |
| 122 | 3300010167 | Ga0123353_10196780 | Ga0123353_101967802 | 460 |
| 123 | 3300010167 | Ga0123353_10209012 | Ga0123353_102090121 | 460 |
| 124 | 3300010167 | Ga0123353_10216536 | Ga0123353_102165361 | 460 |
| 125 | 3300010167 | Ga0123353_10320877 | Ga0123353_103208771 | 460 |
| 126 | 3300010167 | Ga0123353_10442439 | Ga0123353_104424392 | 460 |
| 127 | 3300042592 | Ga0466693_121857 | Ga0466693_121857_24649_26031 | 460 |
| 128 | 3300042596 | Ga0466696_052765 | Ga0466696_052765_2885_4267 | 460 |
| 129 | 3300042600 | Ga0466700_243609 | Ga0466700_243609_2115_3497 | 460 |
| 130 | 3300042601 | Ga0466707_331371 | Ga0466707_331371_6984_8366 | 460 |
| 131 | 3300042610 | Ga0466698_072601 | Ga0466698_072601_68_1450 | 460 |
| 132 | 3300042610 | Ga0466698_362630 | Ga0466698_362630_306_1688 | 460 |
| 133 | 3300042616 | Ga0466715_545602 | Ga0466715_545602_33059_34441 | 460 |
| 134 | 3300042618 | Ga0466723_206273 | Ga0466723_206273_1476_2858 | 460 |
| 135 | 3300042635 | Ga0466702_070425 | Ga0466702_070425_20733_22115 | 460 |
| 136 | 3300042643 | Ga0466704_155328 | Ga0466704_155328_7696_9078 | 460 |
| 137 | 3300042659 | Ga0466733_113704 | Ga0466733_113704_227_1609 | 460 |
| 138 | iso_pr_bacteria | 2585428085 | 2587833704 | 460 |
| 139 | iso_pr_bacteria | 2820013017 | 2820013276 | 460 |
| 140 | 2228664001 | 2230930032 | 2230625867 | 461 |
| 141 | 3300002449 | JGI24698J34947_10076156 | JGI24698J34947_100761561 | 461 |
| 142 | 3300009826 | Ga0123355_10149904 | Ga0123355_101499041 | 461 |
| 143 | 3300010049 | Ga0123356_10223166 | Ga0123356_102231662 | 461 |
| 144 | 3300010167 | Ga0123353_10071739 | Ga0123353_100717392 | 461 |
| 145 | 3300042591 | Ga0466692_076735 | Ga0466692_076735_129_1514 | 461 |
| 146 | 3300042592 | Ga0466693_423698 | Ga0466693_423698_229_1614 | 461 |
| 147 | 3300042596 | Ga0466696_005522 | Ga0466696_005522_174_1559 | 461 |
| 148 | 3300042596 | Ga0466696_459044 | Ga0466696_459044_538_1923 | 461 |
| 149 | 3300042601 | Ga0466707_069854 | Ga0466707_069854_525_1910 | 461 |
| 150 | 3300042602 | Ga0466713_103292 | Ga0466713_103292_28294_29679 | 461 |
| 151 | 3300042609 | Ga0466722_086496 | Ga0466722_086496_383_1768 | 461 |
| 152 | 3300042609 | Ga0466722_110552 | Ga0466722_110552_3929_5314 | 461 |
| 153 | 3300042612 | Ga0466705_281988 | Ga0466705_281988_381_1766 | 461 |
| 154 | 3300042612 | Ga0466705_521894 | Ga0466705_521894_25234_26619 | 461 |
| 155 | 3300042616 | Ga0466715_245116 | Ga0466715_245116_25151_26536 | 461 |
| 156 | 3300042616 | Ga0466715_476699 | Ga0466715_476699_361_1746 | 461 |
| 157 | 3300042618 | Ga0466723_002382 | Ga0466723_002382_23822_25207 | 461 |
| 158 | 3300042652 | Ga0466708_100580 | Ga0466708_100580_50240_51625 | 461 |
| 159 | 3300042652 | Ga0466708_220377 | Ga0466708_220377_752_2137 | 461 |
| 160 | iso_pr_bacteria | 2820594669 | 2820595853 | 461 |
| 161 | 3300000062 | IMNBL1DRAFT_c0002952 | IMNBL1DRAFT_00029527 | 462 |
| 162 | 3300005071 | Ga0068302_10022400 | Ga0068302_100224008 | 462 |
| 163 | 3300042596 | Ga0466696_272260 | Ga0466696_272260_601_1989 | 462 |
| 164 | 3300042605 | Ga0466716_254710 | Ga0466716_254710_754_2142 | 462 |
| 165 | 3300042606 | Ga0466719_296006 | Ga0466719_296006_416_1804 | 462 |
| 166 | 3300042609 | Ga0466722_045557 | Ga0466722_045557_146120_147508 | 462 |
| 167 | 3300042609 | Ga0466722_252105 | Ga0466722_252105_15323_16711 | 462 |
| 168 | 3300042612 | Ga0466705_175203 | Ga0466705_175203_3041_4429 | 462 |
| 169 | 3300042616 | Ga0466715_081361 | Ga0466715_081361_2571_3959 | 462 |
| 170 | 3300042617 | Ga0466718_134175 | Ga0466718_134175_1139_2527 | 462 |
| 171 | 3300042622 | Ga0466731_130185 | Ga0466731_130185_31_1419 | 462 |
| 172 | 3300042643 | Ga0466704_505648 | Ga0466704_505648_41301_42689 | 462 |
| 173 | iso_pr_bacteria | 2820626145 | 2820627081 | 462 |
| 174 | iso_pr_bacteria | 2820836992 | 2820838003 | 462 |
| 175 | 3300002504 | JGI24705J35276_12223307 | JGI24705J35276_122233071 | 463 |
| 176 | 3300009826 | Ga0123355_10067441 | Ga0123355_100674412 | 463 |
| 177 | 3300010167 | Ga0123353_10067305 | Ga0123353_100673053 | 463 |
| 178 | 3300010882 | Ga0123354_10145191 | Ga0123354_101451912 | 463 |
| 179 | 3300042606 | Ga0466719_077282 | Ga0466719_077282_37045_38436 | 463 |
| 180 | 3300042621 | Ga0466729_214468 | Ga0466729_214468_916_2307 | 463 |
| 181 | 3300010882 | Ga0123354_10003309 | Ga0123354_1000330922 | 464 |
| 182 | 3300042592 | Ga0466693_031959 | Ga0466693_031959_856_2250 | 464 |
| 183 | 3300042596 | Ga0466696_292037 | Ga0466696_292037_241_1635 | 464 |
| 184 | iso_pr_bacteria | 2820799971 | 2820800573 | 464 |
| 185 | iso_pr_bacteria | 2820800812 | 2820801089 | 464 |
| 186 | iso_pr_bacteria | 2820916033 | 2820916734 | 464 |
| 187 | 3300002462 | JGI24702J35022_10025554 | JGI24702J35022_100255541 | 465 |
| 188 | 3300002834 | JGI24696J40584_12961316 | JGI24696J40584_129613163 | 465 |
| 189 | 3300005200 | Ga0072940_1323512 | Ga0072940_13235122 | 465 |
| 190 | 3300010049 | Ga0123356_10008097 | Ga0123356_100080973 | 465 |
| 191 | 3300010167 | Ga0123353_10002221 | Ga0123353_1000222125 | 465 |
| 192 | 3300042603 | Ga0466714_093173 | Ga0466714_093173_10_1407 | 465 |
| 193 | 3300042603 | Ga0466714_097571 | Ga0466714_097571_297_1694 | 465 |
| 194 | 3300010049 | Ga0123356_10000573 | Ga0123356_100005737 | 466 |
| 195 | 3300010049 | Ga0123356_10151414 | Ga0123356_101514142 | 466 |
| 196 | 3300010167 | Ga0123353_10002746 | Ga0123353_1000274621 | 466 |
| 197 | 3300042593 | Ga0466691_228432 | Ga0466691_228432_1330_2730 | 466 |
| 198 | 3300042636 | Ga0466703_026485 | Ga0466703_026485_670_2070 | 466 |
| 199 | 3300042594 | Ga0466694_330344 | Ga0466694_330344_2772_4175 | 467 |
| 200 | 3300042609 | Ga0466722_183422 | Ga0466722_183422_15886_17289 | 467 |
| 201 | 3300042643 | Ga0466704_179314 | Ga0466704_179314_691_2094 | 467 |
| 202 | 3300042655 | Ga0466727_089758 | Ga0466727_089758_3120_4523 | 467 |
| 203 | iso_pr_bacteria | 2820823448 | 2820825005 | 467 |
| 204 | iso_pr_bacteria | 2820831444 | 2820832422 | 467 |
| 205 | 3300042593 | Ga0466691_187865 | Ga0466691_187865_165_1571 | 468 |
| 206 | 3300042596 | Ga0466696_053516 | Ga0466696_053516_1733_3142 | 469 |
| 207 | 3300010167 | Ga0123353_10440191 | Ga0123353_104401911 | 470 |
| 208 | 3300042621 | Ga0466729_229878 | Ga0466729_229878_172_1584 | 470 |
| 209 | 3300042620 | Ga0466728_019771 | Ga0466728_019771_11425_12840 | 471 |
| 210 | 3300042602 | Ga0466713_115343 | Ga0466713_115343_30608_32026 | 472 |
| 211 | 3300009826 | Ga0123355_10000939 | Ga0123355_1000093918 | 478 |
| 212 | 3300042616 | Ga0466715_126788 | Ga0466715_126788_16065_17501 | 478 |
| 213 | 3300010167 | Ga0123353_10290832 | Ga0123353_102908322 | 486 |
| 214 | 3300010167 | Ga0123353_10027269 | Ga0123353_100272692 | 489 |
| 215 | 3300010049 | Ga0123356_10087400 | Ga0123356_100874003 | 500 |
| 216 | 3300010167 | Ga0123353_10214068 | Ga0123353_102140683 | 500 |
| 217 | 3300010167 | Ga0123353_10395382 | Ga0123353_103953822 | 503 |
| 218 | 3300010882 | Ga0123354_10040843 | Ga0123354_100408433 | 551 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00291 | PALP | Pyridoxal-phosphate dependent enzyme | 80 | 407 | 0.89 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.92 | 0.92 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.