Protein Family IF02446
Metagenome
Isolate
140
Members
49
Samples
121
Scaffolds
241.54
Avg Length
Representative Sequence
- ID
- 3300009826|Ga0123355_10102611|Ga0123355_101026115
- Length
- 280 aa
- Sequence
- MREIPLKRNCPVKNRKIPQIDKSIFYSLRFFTSRGGTIMKKALIFQGGWDGHEPQLVSKRFAGMLEGEGFEVAIHDNLDCLADVDHLLAQDLLVACWTMGSIDNAYTQNIAKAVGEGVGLAGCHGGMCDAFRNDVLWQFITGANWVSHPGGDGIDYTVNISSSSNPITAGLTDFPVCSEHYYLHVDPAIEVLATTRFPVVPYYHSANKPVDMPVAWTKMWGLGRVFYNSLGHHDDVFDHAPNAAVLMKRGMLWAAGGKEAAKAQGLTSERFLVSDAKMF*
Sample Types
Isolate
13.6%
Metagenome
86.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
40.8%
Termitidae
32.7%
Kalotermitidae
12.2%
Rhinotermitidae
6.1%
Termopsidae
4.1%
Hodotermitidae
2.0%
Passalidae
2.0%
Taxonomy
Archaea
0
Bacteria
134
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 2 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 3 | 2820298281 | Unclassified Firmicutes Th196P1bin9 | Isolate | Unclassified |
| 4 | 2820696217 | Unclassified Firmicutes Co191P1bin66 | Isolate | Unclassified |
| 5 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 6 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 7 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 2820306284 | Unclassified Firmicutes Th196P1bin11 | Isolate | Unclassified |
| 11 | 2820435670 | Unclassified Firmicutes Lab288P3bin217 | Isolate | Unclassified |
| 12 | 2820698910 | Unclassified Firmicutes Co191P1bin64 | Isolate | Unclassified |
| 13 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 14 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 15 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 16 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 17 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 18 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 19 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 20 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 21 | 2820566695 | Unclassified Firmicutes Emb289P3bin50 | Isolate | Unclassified |
| 22 | 2820657860 | Unclassified Firmicutes Co191P4bin15 | Isolate | Unclassified |
| 23 | 2820663833 | Unclassified Firmicutes Co191P3bin41 | Isolate | Unclassified |
| 24 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 25 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 26 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 27 | 2820391468 | Unclassified Firmicutes Nc150P3bin1 | Isolate | Unclassified |
| 28 | 2820429680 | Unclassified Firmicutes Lab288P3bin30 | Isolate | Unclassified |
| 29 | 2820541116 | Unclassified Firmicutes Lab288P1bin109 | Isolate | Unclassified |
| 30 | 2820590132 | Unclassified Firmicutes Emb289P1bin84 | Isolate | Unclassified |
| 31 | 2820596822 | Unclassified Firmicutes Emb289P1bin58 | Isolate | Unclassified |
| 32 | 2820644600 | Unclassified Firmicutes Cu122P5bin39 | Isolate | Unclassified |
| 33 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 34 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 35 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 36 | 2820676843 | Unclassified Firmicutes Co191P3bin17 | Isolate | Unclassified |
| 37 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 38 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 39 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 40 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 41 | 2820573558 | Unclassified Firmicutes Emb289P3bin140 | Isolate | Unclassified |
| 42 | 2820627938 | Unclassified Firmicutes Emb289P1bin122 | Isolate | Unclassified |
| 43 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 44 | 2820240463 | Unclassified Firmicutes Th196P3bin85 | Isolate | Unclassified |
| 45 | 2820444930 | Unclassified Firmicutes Lab288P3bin199 | Isolate | Unclassified |
| 46 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 47 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 48 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 49 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_346622 | 3300042612 | Bacteria | 1910 |
| 2 | Ga0123357_10076177 | 3300009784 | Bacteria | 4431 |
| 3 | Ga0123355_10000522 | 3300009826 | Bacteria | 51287 |
| 4 | Ga0123355_10001327 | 3300009826 | Bacteria | 34425 |
| 5 | Ga0123355_10007563 | 3300009826 | Bacteria | 16305 |
| 6 | Ga0123355_10027022 | 3300009826 | Bacteria | 9267 |
| 7 | Ga0123356_10023545 | 3300010049 | Bacteria | 5794 |
| 8 | Ga0123356_10039337 | 3300010049 | Bacteria | 4406 |
| 9 | Ga0123356_10641011 | 3300010049 | Bacteria | 1229 |
| 10 | Ga0123353_10000933 | 3300010167 | Bacteria | 35737 |
| 11 | Ga0123353_10003986 | 3300010167 | Bacteria | 18905 |
| 12 | Ga0123353_10005639 | 3300010167 | Bacteria | 16483 |
| 13 | Ga0466712_195085 | 3300042614 | Bacteria | 20386 |
| 14 | Ga0466703_346937 | 3300042636 | Bacteria | 9964 |
| 15 | Ga0415639_006688 | 3300038395 | Bacteria | 21406 |
| 16 | Ga0415639_015999 | 3300038395 | Bacteria | 17332 |
| 17 | Ga0415639_024411 | 3300038395 | Bacteria | 3912 |
| 18 | Ga0466692_202197 | 3300042591 | Bacteria | 80474 |
| 19 | IMNBL1DRAFT_c0021105 | 3300000062 | Bacteria | 2615 |
| 20 | Ga0466705_249949 | 3300042612 | Bacteria | 8740 |
| 21 | Ga0123355_10000799 | 3300009826 | Bacteria | 43098 |
| 22 | Ga0123355_10010003 | 3300009826 | Bacteria | 14485 |
| 23 | Ga0123355_10134861 | 3300009826 | Bacteria | 3793 |
| 24 | Ga0123355_10604163 | 3300009826 | Bacteria | 1300 |
| 25 | Ga0123355_10745709 | 3300009826 | Bacteria | 1109 |
| 26 | Ga0123356_10002401 | 3300010049 | Bacteria | 20035 |
| 27 | Ga0123356_10027169 | 3300010049 | Bacteria | 5366 |
| 28 | Ga0123356_10309400 | 3300010049 | Unclassified | 1688 |
| 29 | Ga0123356_10315234 | 3300010049 | Bacteria | 1675 |
| 30 | Ga0123353_10040814 | 3300010167 | Bacteria | 7325 |
| 31 | Ga0123353_10103274 | 3300010167 | Bacteria | 4595 |
| 32 | Ga0123353_10731637 | 3300010167 | Bacteria | 1381 |
| 33 | Ga0466715_488348 | 3300042616 | Bacteria | 3328 |
| 34 | Ga0466718_077176 | 3300042617 | Bacteria | 21293 |
| 35 | Ga0466729_077532 | 3300042621 | Bacteria | 20549 |
| 36 | Ga0466722_162514 | 3300042609 | Bacteria | 41923 |
| 37 | JGI24700J35501_10929249 | 3300002508 | Bacteria | 8880 |
| 38 | Ga0123355_10003311 | 3300009826 | Bacteria | 23046 |
| 39 | Ga0123355_10039895 | 3300009826 | Bacteria | 7643 |
| 40 | Ga0123355_10246079 | 3300009826 | Bacteria | 2525 |
| 41 | Ga0123355_10330403 | 3300009826 | Bacteria | 2043 |
| 42 | Ga0123355_10441985 | 3300009826 | Bacteria | 1646 |
| 43 | Ga0123356_10664985 | 3300010049 | Bacteria | 1209 |
| 44 | Ga0123353_10004087 | 3300010167 | Bacteria | 18694 |
| 45 | Ga0466712_002740 | 3300042614 | Bacteria | 11418 |
| 46 | Ga0466714_071099 | 3300042603 | Bacteria | 1173 |
| 47 | Ga0466714_122066 | 3300042603 | Bacteria | 1987 |
| 48 | Ga0466714_134542 | 3300042603 | Bacteria | 3988 |
| 49 | Ga0466721_183042 | 3300042608 | Bacteria | 1654 |
| 50 | Ga0466721_296570 | 3300042608 | Unclassified | 3852 |
| 51 | Ga0415639_129124 | 3300038395 | Bacteria | 2808 |
| 52 | JGI24695J34938_10040108 | 3300002450 | Bacteria | 2111 |
| 53 | JGI24696J40584_12852416 | 3300002834 | Bacteria | 985 |
| 54 | Ga0123355_10003293 | 3300009826 | Bacteria | 23098 |
| 55 | Ga0123355_10070910 | 3300009826 | Bacteria | 5595 |
| 56 | Ga0123353_10002647 | 3300010167 | Bacteria | 22290 |
| 57 | Ga0466712_248633 | 3300042614 | Bacteria | 4298 |
| 58 | Ga0466735_050467 | 3300042624 | Bacteria | 8589 |
| 59 | Ga0466702_357019 | 3300042635 | Bacteria | 1541 |
| 60 | Ga0466706_253455 | 3300042599 | Bacteria | 2175 |
| 61 | Ga0466707_087354 | 3300042601 | Bacteria | 1455 |
| 62 | Ga0466719_041932 | 3300042606 | Bacteria | 43007 |
| 63 | IMNBL1DRAFT_c0002381 | 3300000062 | Bacteria | 13122 |
| 64 | JGI24695J34938_10000039 | 3300002450 | Bacteria | 98010 |
| 65 | JGI24696J40584_12960194 | 3300002834 | Bacteria | 6565 |
| 66 | Ga0466705_146538 | 3300042612 | Bacteria | 158344 |
| 67 | Ga0466733_026158 | 3300042659 | Bacteria | 4450 |
| 68 | Ga0123355_10000517 | 3300009826 | Bacteria | 51455 |
| 69 | Ga0123355_10102611 | 3300009826 | Bacteria | 4498 |
| 70 | Ga0123353_10429668 | 3300010167 | Bacteria | 1954 |
| 71 | Ga0123353_10898871 | 3300010167 | Bacteria | 1206 |
| 72 | Ga0466714_054907 | 3300042603 | Unclassified | 1000 |
| 73 | Ga0415639_007020 | 3300038395 | Bacteria | 25604 |
| 74 | JGI24698J34947_10001411 | 3300002449 | Bacteria | 12658 |
| 75 | JGI24698J34947_10004851 | 3300002449 | Bacteria | 7363 |
| 76 | JGI24695J34938_10000144 | 3300002450 | Bacteria | 64935 |
| 77 | JGI24695J34938_10032386 | 3300002450 | Bacteria | 2415 |
| 78 | Ga0123355_10388661 | 3300009826 | Bacteria | 1811 |
| 79 | Ga0123355_10523884 | 3300009826 | Bacteria | 1448 |
| 80 | Ga0123355_10814066 | 3300009826 | Bacteria | 1038 |
| 81 | Ga0123356_10005660 | 3300010049 | Bacteria | 12690 |
| 82 | Ga0123356_10044558 | 3300010049 | Bacteria | 4130 |
| 83 | Ga0123353_10000434 | 3300010167 | Bacteria | 51822 |
| 84 | Ga0123353_10836470 | 3300010167 | Bacteria | 1264 |
| 85 | Ga0123354_10280747 | 3300010882 | Bacteria | 1618 |
| 86 | Ga0466726_375636 | 3300042619 | Bacteria | 21985 |
| 87 | Ga0466735_223595 | 3300042624 | Bacteria | 1338 |
| 88 | Ga0415639_077032 | 3300038395 | Unclassified | 1983 |
| 89 | JGI24698J34947_10001668 | 3300002449 | Bacteria | 11852 |
| 90 | JGI24698J34947_10075358 | 3300002449 | Bacteria | 1604 |
| 91 | Ga0466705_129678 | 3300042612 | Bacteria | 34903 |
| 92 | Ga0123355_10001652 | 3300009826 | Bacteria | 31043 |
| 93 | Ga0123355_10007457 | 3300009826 | Bacteria | 16394 |
| 94 | Ga0123355_10138193 | 3300009826 | Bacteria | 3738 |
| 95 | Ga0123355_10255775 | 3300009826 | Bacteria | 2458 |
| 96 | Ga0123355_10266034 | 3300009826 | Bacteria | 2391 |
| 97 | Ga0123353_10090830 | 3300010167 | Bacteria | 4918 |
| 98 | Ga0123353_10113161 | 3300010167 | Bacteria | 4369 |
| 99 | Ga0123353_10287665 | 3300010167 | Bacteria | 2519 |
| 100 | Ga0123353_10631912 | 3300010167 | Bacteria | 1521 |
| 101 | Ga0466712_075474 | 3300042614 | Bacteria | 15530 |
| 102 | Ga0466711_042108 | 3300042615 | Unclassified | 1653 |
| 103 | Ga0466719_243384 | 3300042606 | Bacteria | 24606 |
| 104 | Ga0415639_191051 | 3300038395 | Bacteria | 1123 |
| 105 | JGI24698J34947_10003212 | 3300002449 | Bacteria | 8858 |
| 106 | Ga0123357_10346088 | 3300009784 | Bacteria | 1429 |
| 107 | Ga0123355_10025346 | 3300009826 | Bacteria | 9546 |
| 108 | Ga0123355_10070308 | 3300009826 | Bacteria | 5623 |
| 109 | Ga0123355_10070741 | 3300009826 | Bacteria | 5603 |
| 110 | Ga0123355_10179925 | 3300009826 | Bacteria | 3140 |
| 111 | Ga0123356_10162738 | 3300010049 | Unclassified | 2231 |
| 112 | Ga0123353_10005090 | 3300010167 | Bacteria | 17164 |
| 113 | Ga0123353_10022374 | 3300010167 | Bacteria | 9529 |
| 114 | Ga0123353_10109995 | 3300010167 | Bacteria | 4439 |
| 115 | Ga0123353_10601163 | 3300010167 | Bacteria | 1572 |
| 116 | Ga0466712_109437 | 3300042614 | Bacteria | 45252 |
| 117 | Ga0466712_260939 | 3300042614 | Bacteria | 11973 |
| 118 | Ga0466704_194134 | 3300042643 | Bacteria | 5232 |
| 119 | Ga0466722_259415 | 3300042609 | Bacteria | 2102 |
| 120 | Ga0415639_051129 | 3300038395 | Bacteria | 5947 |
| 121 | JGI24698J34947_10000035 | 3300002449 | Bacteria | 37551 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | iso_pr_bacteria | 2820240463 | 2820241260 | 226 |
| 2 | 3300010049 | Ga0123356_10005660 | Ga0123356_100056608 | 227 |
| 3 | 3300010049 | Ga0123356_10039337 | Ga0123356_100393375 | 228 |
| 4 | 3300042635 | Ga0466702_357019 | Ga0466702_357019_285_1007 | 230 |
| 5 | 3300010049 | Ga0123356_10309400 | Ga0123356_103094002 | 231 |
| 6 | 3300009826 | Ga0123355_10070741 | Ga0123355_100707412 | 232 |
| 7 | 3300009826 | Ga0123355_10070910 | Ga0123355_100709102 | 232 |
| 8 | 3300009826 | Ga0123355_10255775 | Ga0123355_102557752 | 232 |
| 9 | 3300009826 | Ga0123355_10814066 | Ga0123355_108140661 | 232 |
| 10 | 3300009826 | Ga0123355_10001327 | Ga0123355_100013276 | 233 |
| 11 | 3300009826 | Ga0123355_10134861 | Ga0123355_101348613 | 233 |
| 12 | 3300042606 | Ga0466719_041932 | Ga0466719_041932_17413_18117 | 234 |
| 13 | 3300042619 | Ga0466726_375636 | Ga0466726_375636_9304_10065 | 237 |
| 14 | 3300042591 | Ga0466692_202197 | Ga0466692_202197_35968_36684 | 238 |
| 15 | 3300038395 | Ga0415639_191051 | Ga0415639_191051_97_816 | 239 |
| 16 | 3300042603 | Ga0466714_134542 | Ga0466714_134542_74_793 | 239 |
| 17 | 3300042608 | Ga0466721_296570 | Ga0466721_296570_1156_1875 | 239 |
| 18 | 3300042609 | Ga0466722_259415 | Ga0466722_259415_204_923 | 239 |
| 19 | 3300042612 | Ga0466705_346622 | Ga0466705_346622_104_823 | 239 |
| 20 | 3300042615 | Ga0466711_042108 | Ga0466711_042108_105_824 | 239 |
| 21 | iso_pr_bacteria | 2820566695 | 2820568563 | 239 |
| 22 | 3300010049 | Ga0123356_10027169 | Ga0123356_100271693 | 240 |
| 23 | 3300010049 | Ga0123356_10315234 | Ga0123356_103152343 | 240 |
| 24 | 3300010049 | Ga0123356_10641011 | Ga0123356_106410111 | 240 |
| 25 | 3300010049 | Ga0123356_10664985 | Ga0123356_106649852 | 240 |
| 26 | 3300010167 | Ga0123353_10113161 | Ga0123353_101131612 | 240 |
| 27 | 3300042599 | Ga0466706_253455 | Ga0466706_253455_1126_1848 | 240 |
| 28 | 3300042603 | Ga0466714_122066 | Ga0466714_122066_30_752 | 240 |
| 29 | 3300042608 | Ga0466721_183042 | Ga0466721_183042_22_744 | 240 |
| 30 | 3300042612 | Ga0466705_146538 | Ga0466705_146538_67039_67761 | 240 |
| 31 | 3300042614 | Ga0466712_002740 | Ga0466712_002740_10567_11289 | 240 |
| 32 | 3300042614 | Ga0466712_075474 | Ga0466712_075474_8485_9207 | 240 |
| 33 | 3300042614 | Ga0466712_109437 | Ga0466712_109437_26609_27331 | 240 |
| 34 | 3300042614 | Ga0466712_195085 | Ga0466712_195085_17743_18465 | 240 |
| 35 | 3300042614 | Ga0466712_248633 | Ga0466712_248633_182_904 | 240 |
| 36 | 3300042614 | Ga0466712_260939 | Ga0466712_260939_3052_3774 | 240 |
| 37 | 3300042621 | Ga0466729_077532 | Ga0466729_077532_6339_7061 | 240 |
| 38 | 3300042636 | Ga0466703_346937 | Ga0466703_346937_5027_5749 | 240 |
| 39 | iso_pr_bacteria | 2820298281 | 2820299441 | 240 |
| 40 | iso_pr_bacteria | 2820306284 | 2820307328 | 240 |
| 41 | iso_pr_bacteria | 2820444930 | 2820445209 | 240 |
| 42 | iso_pr_bacteria | 2820573558 | 2820576156 | 240 |
| 43 | iso_pr_bacteria | 2820590132 | 2820590477 | 240 |
| 44 | iso_pr_bacteria | 2820596822 | 2820597247 | 240 |
| 45 | iso_pr_bacteria | 2820644600 | 2820645699 | 240 |
| 46 | 3300002449 | JGI24698J34947_10000035 | JGI24698J34947_100000356 | 241 |
| 47 | 3300002449 | JGI24698J34947_10001411 | JGI24698J34947_100014118 | 241 |
| 48 | 3300002449 | JGI24698J34947_10001668 | JGI24698J34947_100016688 | 241 |
| 49 | 3300002449 | JGI24698J34947_10003212 | JGI24698J34947_100032126 | 241 |
| 50 | 3300002449 | JGI24698J34947_10004851 | JGI24698J34947_100048514 | 241 |
| 51 | 3300002449 | JGI24698J34947_10075358 | JGI24698J34947_100753582 | 241 |
| 52 | 3300002450 | JGI24695J34938_10032386 | JGI24695J34938_100323862 | 241 |
| 53 | 3300002508 | JGI24700J35501_10929249 | JGI24700J35501_109292498 | 241 |
| 54 | 3300009826 | Ga0123355_10000517 | Ga0123355_1000051759 | 241 |
| 55 | 3300009826 | Ga0123355_10000799 | Ga0123355_1000079913 | 241 |
| 56 | 3300009826 | Ga0123355_10025346 | Ga0123355_100253469 | 241 |
| 57 | 3300009826 | Ga0123355_10070308 | Ga0123355_100703082 | 241 |
| 58 | 3300009826 | Ga0123355_10179925 | Ga0123355_101799254 | 241 |
| 59 | 3300009826 | Ga0123355_10246079 | Ga0123355_102460792 | 241 |
| 60 | 3300009826 | Ga0123355_10266034 | Ga0123355_102660343 | 241 |
| 61 | 3300009826 | Ga0123355_10523884 | Ga0123355_105238841 | 241 |
| 62 | 3300009826 | Ga0123355_10604163 | Ga0123355_106041632 | 241 |
| 63 | 3300010167 | Ga0123353_10000933 | Ga0123353_1000093313 | 241 |
| 64 | 3300010167 | Ga0123353_10002647 | Ga0123353_1000264719 | 241 |
| 65 | 3300010167 | Ga0123353_10005090 | Ga0123353_1000509011 | 241 |
| 66 | 3300010167 | Ga0123353_10005639 | Ga0123353_1000563914 | 241 |
| 67 | 3300010167 | Ga0123353_10103274 | Ga0123353_101032742 | 241 |
| 68 | 3300010167 | Ga0123353_10287665 | Ga0123353_102876652 | 241 |
| 69 | 3300010167 | Ga0123353_10898871 | Ga0123353_108988712 | 241 |
| 70 | 3300038395 | Ga0415639_006688 | Ga0415639_006688_2696_3421 | 241 |
| 71 | 3300038395 | Ga0415639_024411 | Ga0415639_024411_1641_2366 | 241 |
| 72 | 3300038395 | Ga0415639_051129 | Ga0415639_051129_906_1631 | 241 |
| 73 | 3300042612 | Ga0466705_129678 | Ga0466705_129678_2753_3478 | 241 |
| 74 | 3300042612 | Ga0466705_249949 | Ga0466705_249949_7361_8086 | 241 |
| 75 | 3300042617 | Ga0466718_077176 | Ga0466718_077176_17930_18655 | 241 |
| 76 | iso_pr_bacteria | 2820391468 | 2820391795 | 241 |
| 77 | iso_pr_bacteria | 2820429680 | 2820429887 | 241 |
| 78 | iso_pr_bacteria | 2820435670 | 2820438186 | 241 |
| 79 | iso_pr_bacteria | 2820541116 | 2820543214 | 241 |
| 80 | iso_pr_bacteria | 2820627938 | 2820629645 | 241 |
| 81 | iso_pr_bacteria | 2820657860 | 2820659637 | 241 |
| 82 | iso_pr_bacteria | 2820663833 | 2820665541 | 241 |
| 83 | iso_pr_bacteria | 2820676843 | 2820676989 | 241 |
| 84 | iso_pr_bacteria | 2820696217 | 2820696848 | 241 |
| 85 | iso_pr_bacteria | 2820698910 | 2820700800 | 241 |
| 86 | 3300000062 | IMNBL1DRAFT_c0002381 | IMNBL1DRAFT_00023817 | 242 |
| 87 | 3300000062 | IMNBL1DRAFT_c0021105 | IMNBL1DRAFT_00211053 | 242 |
| 88 | 3300002450 | JGI24695J34938_10000039 | JGI24695J34938_1000003927 | 242 |
| 89 | 3300002450 | JGI24695J34938_10000144 | JGI24695J34938_1000014421 | 242 |
| 90 | 3300002834 | JGI24696J40584_12852416 | JGI24696J40584_128524161 | 242 |
| 91 | 3300002834 | JGI24696J40584_12960194 | JGI24696J40584_129601946 | 242 |
| 92 | 3300009826 | Ga0123355_10000522 | Ga0123355_1000052230 | 242 |
| 93 | 3300009826 | Ga0123355_10003311 | Ga0123355_1000331120 | 242 |
| 94 | 3300009826 | Ga0123355_10010003 | Ga0123355_100100036 | 242 |
| 95 | 3300009826 | Ga0123355_10138193 | Ga0123355_101381932 | 242 |
| 96 | 3300010049 | Ga0123356_10162738 | Ga0123356_101627383 | 242 |
| 97 | 3300010167 | Ga0123353_10000434 | Ga0123353_1000043442 | 242 |
| 98 | 3300010167 | Ga0123353_10003986 | Ga0123353_100039869 | 242 |
| 99 | 3300010167 | Ga0123353_10004087 | Ga0123353_1000408710 | 242 |
| 100 | 3300010167 | Ga0123353_10022374 | Ga0123353_1002237416 | 242 |
| 101 | 3300010167 | Ga0123353_10429668 | Ga0123353_104296682 | 242 |
| 102 | 3300010167 | Ga0123353_10601163 | Ga0123353_106011632 | 242 |
| 103 | 3300010167 | Ga0123353_10731637 | Ga0123353_107316372 | 242 |
| 104 | 3300010167 | Ga0123353_10836470 | Ga0123353_108364701 | 242 |
| 105 | 3300010882 | Ga0123354_10280747 | Ga0123354_102807472 | 242 |
| 106 | 3300042603 | Ga0466714_071099 | Ga0466714_071099_325_1053 | 242 |
| 107 | 3300042606 | Ga0466719_243384 | Ga0466719_243384_13380_14108 | 242 |
| 108 | 3300002450 | JGI24695J34938_10040108 | JGI24695J34938_100401082 | 243 |
| 109 | 3300009784 | Ga0123357_10346088 | Ga0123357_103460882 | 243 |
| 110 | 3300009826 | Ga0123355_10007457 | Ga0123355_1000745712 | 243 |
| 111 | 3300009826 | Ga0123355_10027022 | Ga0123355_100270224 | 243 |
| 112 | 3300009826 | Ga0123355_10039895 | Ga0123355_100398951 | 243 |
| 113 | 3300009826 | Ga0123355_10388661 | Ga0123355_103886612 | 243 |
| 114 | 3300010167 | Ga0123353_10631912 | Ga0123353_106319122 | 243 |
| 115 | 3300042601 | Ga0466707_087354 | Ga0466707_087354_161_892 | 243 |
| 116 | 3300042624 | Ga0466735_223595 | Ga0466735_223595_403_1134 | 243 |
| 117 | 3300042643 | Ga0466704_194134 | Ga0466704_194134_1576_2307 | 243 |
| 118 | 3300009826 | Ga0123355_10330403 | Ga0123355_103304033 | 244 |
| 119 | 3300009826 | Ga0123355_10441985 | Ga0123355_104419852 | 244 |
| 120 | 3300010167 | Ga0123353_10109995 | Ga0123353_101099956 | 244 |
| 121 | 3300010049 | Ga0123356_10002401 | Ga0123356_100024014 | 245 |
| 122 | 3300038395 | Ga0415639_015999 | Ga0415639_015999_8853_9590 | 245 |
| 123 | 3300038395 | Ga0415639_129124 | Ga0415639_129124_1628_2365 | 245 |
| 124 | 3300042603 | Ga0466714_054907 | Ga0466714_054907_101_838 | 245 |
| 125 | 3300042616 | Ga0466715_488348 | Ga0466715_488348_755_1492 | 245 |
| 126 | 3300042659 | Ga0466733_026158 | Ga0466733_026158_3651_4388 | 245 |
| 127 | 3300009784 | Ga0123357_10076177 | Ga0123357_100761774 | 246 |
| 128 | 3300038395 | Ga0415639_007020 | Ga0415639_007020_20920_21660 | 246 |
| 129 | 3300038395 | Ga0415639_077032 | Ga0415639_077032_704_1444 | 246 |
| 130 | 3300010167 | Ga0123353_10040814 | Ga0123353_100408145 | 247 |
| 131 | 3300010049 | Ga0123356_10023545 | Ga0123356_100235454 | 248 |
| 132 | 3300010167 | Ga0123353_10090830 | Ga0123353_100908304 | 248 |
| 133 | 3300009826 | Ga0123355_10001652 | Ga0123355_1000165214 | 249 |
| 134 | 3300042609 | Ga0466722_162514 | Ga0466722_162514_14410_15159 | 249 |
| 135 | 3300009826 | Ga0123355_10745709 | Ga0123355_107457092 | 250 |
| 136 | 3300009826 | Ga0123355_10007563 | Ga0123355_100075637 | 254 |
| 137 | 3300009826 | Ga0123355_10003293 | Ga0123355_1000329315 | 255 |
| 138 | 3300042624 | Ga0466735_050467 | Ga0466735_050467_4928_5698 | 256 |
| 139 | 3300010049 | Ga0123356_10044558 | Ga0123356_100445584 | 267 |
| 140 | 3300009826 | Ga0123355_10102611 | Ga0123355_101026115 | 280 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF06283 | ThuA | Trehalose utilisation | 41 | 254 | 0.88 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.85 | 0.93 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.