Protein Family IF02443

Metagenome Isolate
213 Members
90 Samples
170 Scaffolds
332.08 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10097170|Ga0123355_100971704
Length
336 aa
Sequence
MEFPGKIAIMGGGSWATAIAKMVLANESNTDINWYMRRQDRIDDFKRLKHNPAYLTNVNFDIDKIKFSSKINQVVRESDTLIFATPSPFLKQHLKKLRTNLENKNIVSAIKGIVPDENMIISEYFHEKFNVPNENILALGGPCHAEEVALDRLSYLTIGCLDREKAKVFAKHLKGYSVKTSLNDDIIGVEYASVLKNVYSIAAGICHGLKYGDNFQAVLISNALQEMNRFLNAVQPEQARNLNDSVYLGDLLVTGYSRFSRNRMFGTMIGKGYSVKTAQMEMEMIAEGYYGAKCIKEINDERYKINMPILDAVYNVLYERIAPVIEVKLLTENLR*

πŸ“Š Sample Types

Isolate 20.2%
Metagenome 79.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Blattidae 32.6%
Termitidae 22.5%
Kalotermitidae 14.6%
Unclassified 12.4%
Rhinotermitidae 6.7%
Passalidae 3.4%
Termopsidae 3.4%
Hydrophilidae 2.2%
Tenebrionidae 1.1%
Hodotermitidae 1.1%

🌳 Taxonomy

Archaea 0
Bacteria 210
Eukaryota 0
Viruses 0
Unclassified 3

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
2 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
3 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
4 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
5 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
6 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
7 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
8 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
9 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
10 3004672520 Bacteroides sp. 51 Isolate Blattidae
11 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
12 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
13 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
14 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
15 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
16 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
17 2820751898 Unclassified Bacteroidetes Nc150P4bin22 Isolate Unclassified
18 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
19 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
20 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
21 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
22 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
23 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
24 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
25 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
26 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
27 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
28 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
29 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
30 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
31 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
32 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
33 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
34 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
35 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
36 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
37 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
38 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
39 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
40 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
41 2922326829 Bacteroides sp. 224 Isolate Blattidae
42 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
43 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
44 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
45 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
46 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
47 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
48 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
49 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
50 2923982719 Parabacteroides sp. 52 Isolate Blattidae
51 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
52 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
53 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
54 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
55 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
56 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
57 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
58 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
59 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
60 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
61 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
62 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
63 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
64 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
65 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
66 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
67 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
68 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
69 3004667792 Bacteroides sp. 519 Isolate Blattidae
70 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
71 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
72 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
73 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
74 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
75 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
76 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
77 2820741847 Unclassified Bacteroidetes Th196P3bin71 Isolate Unclassified
78 2820776227 Unclassified Bacteroidetes Emb289P4bin3 Isolate Unclassified
79 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
80 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
81 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
82 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
83 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
84 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
85 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
86 2920168565 Paludibacter sp. 221 Isolate Blattidae
87 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
88 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
89 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
90 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_192786 3300042612 Bacteria 4136
2 Ga0466733_002688 3300042659 Bacteria 5505
3 Ga0123357_10003901 3300009784 Bacteria 17309
4 IMNBL1DRAFT_c0001457 3300000062 Bacteria 17693
5 JGI24705J35276_12218122 3300002504 Bacteria 2128
6 JGI24699J35502_11133987 3300002509 Bacteria 22805
7 Ga0466706_217492 3300042599 Bacteria 2090
8 Ga0466707_181678 3300042601 Bacteria 6198
9 Ga0466713_105016 3300042602 Bacteria 90403
10 Ga0466722_099081 3300042609 Bacteria 6775
11 Ga0466726_135599 3300042619 Bacteria 11181
12 Ga0466690_116612 3300042590 Bacteria 3415
13 Ga0466690_406163 3300042590 Bacteria 6459
14 Ga0466691_053101 3300042593 Bacteria 25087
15 Ga0466696_129838 3300042596 Bacteria 68162
16 Ga0466696_370918 3300042596 Bacteria 1814
17 Ga0466735_151637 3300042624 Bacteria 1380
18 Ga0466704_119788 3300042643 Bacteria 13258
19 Ga0466733_103214 3300042659 Bacteria 2475
20 Ga0123357_10206801 3300009784 Bacteria 2217
21 2227441935 2225789004 Bacteria 5474
22 JGI24696J40584_12960899 3300002834 Bacteria 9170
23 Ga0072941_1020210 3300005201 Bacteria 1321
24 Ga0123357_10001158 3300009784 Bacteria 27473
25 Ga0466706_004171 3300042599 Bacteria 10782
26 Ga0466714_096666 3300042603 Bacteria 172614
27 Ga0466726_169828 3300042619 Bacteria 5608
28 Ga0466728_095171 3300042620 Bacteria 11826
29 Ga0466657_263929 3300042582 Bacteria 3475
30 Ga0466692_088376 3300042591 Bacteria 4814
31 Ga0466696_376785 3300042596 Bacteria 25998
32 Ga0466731_270277 3300042622 Bacteria 2304
33 Ga0466735_039663 3300042624 Bacteria 16485
34 Ga0466730_052015 3300042625 Bacteria 3412
35 Ga0466727_119437 3300042655 Bacteria 3624
36 Ga0466727_164678 3300042655 Bacteria 3051
37 Ga0466705_325772 3300042612 Bacteria 8226
38 Ga0466733_043921 3300042659 Bacteria 8407
39 Ga0466733_153801 3300042659 Bacteria 58972
40 Ga0123357_10006057 3300009784 Bacteria 14636
41 Ga0123357_10233802 3300009784 Bacteria 2007
42 Ga0123355_10097170 3300009826 Bacteria 4648
43 IMNBL1DRAFT_c0022182 3300000062 Bacteria 2519
44 Ga0466706_142882 3300042599 Bacteria 78904
45 Ga0466707_135985 3300042601 Bacteria 9923
46 Ga0466713_087636 3300042602 Bacteria 22335
47 Ga0466713_091459 3300042602 Bacteria 16014
48 Ga0466714_139645 3300042603 Bacteria 3511
49 Ga0466716_362829 3300042605 Bacteria 4561
50 Ga0466719_095502 3300042606 Bacteria 4988
51 Ga0466719_290745 3300042606 Bacteria 2111
52 Ga0466722_022637 3300042609 Bacteria 17886
53 Ga0466722_062639 3300042609 Bacteria 2456
54 Ga0466712_015870 3300042614 Bacteria 1744
55 Ga0466715_274705 3300042616 Bacteria 6072
56 Ga0466690_102734 3300042590 Bacteria 7924
57 Ga0466692_085530 3300042591 Bacteria 25445
58 Ga0466696_207472 3300042596 Bacteria 13849
59 Ga0466696_490214 3300042596 Bacteria 1832
60 Ga0466703_073365 3300042636 Bacteria 4727
61 Ga0466704_279435 3300042643 Bacteria 16313
62 Ga0466709_400357 3300042648 Bacteria 4999
63 Ga0466708_083142 3300042652 Bacteria 8065
64 Ga0466727_130038 3300042655 Unclassified 1970
65 Ga0466705_081863 3300042612 Bacteria 2032
66 Ga0466732_331536 3300042656 Bacteria 6574
67 Ga0562377_0004 3300056842 Bacteria 3525959
68 Ga0123353_10781090 3300010167 Bacteria 1323
69 JGI24702J35022_10001411 3300002462 Bacteria 14980
70 JGI24702J35022_10028873 3300002462 Bacteria 2979
71 JGI24705J35276_12236490 3300002504 Bacteria 8183
72 Ga0466706_015749 3300042599 Bacteria 23160
73 Ga0466706_049801 3300042599 Bacteria 15358
74 Ga0466700_248051 3300042600 Bacteria 7229
75 Ga0466707_263071 3300042601 Bacteria 1739
76 Ga0466722_196462 3300042609 Bacteria 4281
77 Ga0466711_275090 3300042615 Bacteria 26757
78 Ga0466715_135030 3300042616 Bacteria 4778
79 Ga0466715_154623 3300042616 Bacteria 15566
80 Ga0466726_146641 3300042619 Bacteria 10357
81 Ga0466691_005650 3300042593 Bacteria 8377
82 Ga0466735_052620 3300042624 Bacteria 2630
83 Ga0466735_233308 3300042624 Unclassified 4031
84 Ga0466703_075593 3300042636 Bacteria 5222
85 Ga0466709_347035 3300042648 Bacteria 39954
86 Ga0466727_109300 3300042655 Bacteria 1668
87 Ga0466733_162618 3300042659 Bacteria 1414
88 Ga0123357_10006419 3300009784 Bacteria 14343
89 Ga0123354_10284677 3300010882 Bacteria 1597
90 Ga0123354_10450478 3300010882 Bacteria 1043
91 Ga0123357_10000419 3300009784 Bacteria 40548
92 Ga0466700_486479 3300042600 Bacteria 1322
93 Ga0466707_320477 3300042601 Bacteria 18661
94 Ga0466715_269937 3300042616 Bacteria 22829
95 Ga0466726_135980 3300042619 Bacteria 2786
96 Ga0466728_023725 3300042620 Bacteria 54030
97 Ga0466696_323034 3300042596 Bacteria 3448
98 Ga0466735_050202 3300042624 Bacteria 2428
99 Ga0466735_224682 3300042624 Bacteria 5438
100 Ga0466704_244518 3300042643 Bacteria 6185
101 Ga0466727_259105 3300042655 Bacteria 2246
102 Ga0123355_10001208 3300009826 Bacteria 35998
103 JGI24699J35502_11134225 3300002509 Bacteria 74107
104 Ga0466706_054670 3300042599 Bacteria 52813
105 Ga0466706_145766 3300042599 Bacteria 24432
106 Ga0466719_049976 3300042606 Bacteria 6101
107 Ga0466711_214135 3300042615 Bacteria 6089
108 Ga0466715_194550 3300042616 Bacteria 9741
109 Ga0466715_219042 3300042616 Bacteria 1784
110 Ga0466692_130817 3300042591 Bacteria 17236
111 Ga0466734_001537 3300042623 Bacteria 2849
112 Ga0466704_122628 3300042643 Bacteria 14887
113 Ga0466708_104212 3300042652 Bacteria 5898
114 Ga0466705_233113 3300042612 Bacteria 5999
115 Ga0123353_10782884 3300010167 Bacteria 1321
116 2227076901 2225789003 Bacteria 2202
117 2227341921 2225789004 Unclassified 1155
118 IMNBL1DRAFT_c0000303 3300000062 Bacteria 41914
119 JGI24705J35276_12230885 3300002504 Bacteria 3765
120 JGI24699J35502_11134073 3300002509 Bacteria 28326
121 Ga0123357_10001146 3300009784 Bacteria 27559
122 Ga0466706_242325 3300042599 Bacteria 5121
123 Ga0466706_269516 3300042599 Bacteria 14281
124 Ga0466700_238454 3300042600 Bacteria 22788
125 Ga0466700_257615 3300042600 Bacteria 7856
126 Ga0466707_238733 3300042601 Bacteria 13537
127 Ga0466714_034139 3300042603 Bacteria 66059
128 Ga0466714_090515 3300042603 Bacteria 55724
129 Ga0466722_210263 3300042609 Bacteria 13667
130 Ga0466715_026465 3300042616 Bacteria 99999
131 Ga0466726_099783 3300042619 Bacteria 2853
132 Ga0466690_043330 3300042590 Bacteria 21806
133 Ga0466692_077327 3300042591 Bacteria 1600
134 Ga0466735_023729 3300042624 Bacteria 7648
135 Ga0466735_128175 3300042624 Bacteria 2607
136 Ga0466735_133247 3300042624 Bacteria 1861
137 Ga0466703_133171 3300042636 Bacteria 46543
138 Ga0466703_150578 3300042636 Bacteria 11848
139 Ga0466725_309479 3300042654 Bacteria 1255
140 Ga0466727_098929 3300042655 Bacteria 2855
141 Ga0466697_269985 3300042611 Bacteria 1585
142 Ga0466705_223226 3300042612 Bacteria 4215
143 Ga0123357_10019192 3300009784 Bacteria 9106
144 Ga0123353_10391977 3300010167 Bacteria 2071
145 Ga0123354_10326043 3300010882 Bacteria 1408
146 2227153330 2225789004 Bacteria 1579
147 IMNBL1DRAFT_c0030218 3300000062 Bacteria 1990
148 Ga0466701_079535 3300042598 Bacteria 72629
149 Ga0466707_104249 3300042601 Bacteria 1907
150 Ga0466707_351658 3300042601 Bacteria 4668
151 Ga0466713_037511 3300042602 Bacteria 24497
152 Ga0466713_096596 3300042602 Bacteria 406546
153 Ga0466714_058710 3300042603 Bacteria 109931
154 Ga0466716_384998 3300042605 Bacteria 3126
155 Ga0466719_362755 3300042606 Bacteria 3402
156 Ga0466711_066406 3300042615 Bacteria 11232
157 Ga0466715_066549 3300042616 Bacteria 10914
158 Ga0466715_121550 3300042616 Bacteria 13380
159 Ga0466715_132207 3300042616 Bacteria 3081
160 Ga0466715_309209 3300042616 Bacteria 44379
161 Ga0466715_314614 3300042616 Bacteria 16526
162 Ga0466715_562326 3300042616 Bacteria 2543
163 Ga0466696_499310 3300042596 Bacteria 3666
164 Ga0466729_265332 3300042621 Bacteria 5556
165 Ga0466734_168132 3300042623 Bacteria 1690
166 Ga0466735_201604 3300042624 Bacteria 1520
167 Ga0466730_097021 3300042625 Bacteria 6399
168 Ga0466703_332863 3300042636 Bacteria 8182
169 Ga0466708_183987 3300042652 Bacteria 32791
170 Ga0466727_240697 3300042655 Bacteria 4898

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042596 Ga0466696_207472 Ga0466696_207472_1699_2586 295
2 3300042616 Ga0466715_274705 Ga0466715_274705_27_926 299
3 3300042590 Ga0466690_043330 Ga0466690_043330_18333_19301 322
4 3300042591 Ga0466692_130817 Ga0466692_130817_13902_14870 322
5 3300042596 Ga0466696_323034 Ga0466696_323034_21_989 322
6 3300042620 Ga0466728_023725 Ga0466728_023725_25452_26420 322
7 3300042624 Ga0466735_039663 Ga0466735_039663_8629_9597 322
8 3300042624 Ga0466735_052620 Ga0466735_052620_41_1009 322
9 3300042636 Ga0466703_075593 Ga0466703_075593_2839_3807 322
10 3300042643 Ga0466704_122628 Ga0466704_122628_4270_5238 322
11 3300042655 Ga0466727_119437 Ga0466727_119437_1824_2792 322
12 iso_pr_bacteria 2609459943 2610743782 322
13 3300042616 Ga0466715_194550 Ga0466715_194550_993_1976 327
14 2225789004 2227153330 2227560112 331
15 2225789004 2227341921 2227788740 331
16 3300042590 Ga0466690_102734 Ga0466690_102734_1259_2254 331
17 3300042590 Ga0466690_116612 Ga0466690_116612_624_1619 331
18 3300042590 Ga0466690_406163 Ga0466690_406163_5189_6184 331
19 3300042591 Ga0466692_077327 Ga0466692_077327_203_1198 331
20 3300042591 Ga0466692_085530 Ga0466692_085530_3548_4543 331
21 3300042593 Ga0466691_053101 Ga0466691_053101_14883_15878 331
22 3300042596 Ga0466696_129838 Ga0466696_129838_65159_66154 331
23 3300042596 Ga0466696_376785 Ga0466696_376785_15122_16117 331
24 3300042596 Ga0466696_499310 Ga0466696_499310_146_1141 331
25 3300042598 Ga0466701_079535 Ga0466701_079535_61668_62663 331
26 3300042599 Ga0466706_004171 Ga0466706_004171_3696_4691 331
27 3300042599 Ga0466706_015749 Ga0466706_015749_16464_17459 331
28 3300042599 Ga0466706_049801 Ga0466706_049801_9840_10835 331
29 3300042599 Ga0466706_142882 Ga0466706_142882_62154_63149 331
30 3300042599 Ga0466706_145766 Ga0466706_145766_17220_18215 331
31 3300042599 Ga0466706_217492 Ga0466706_217492_426_1421 331
32 3300042599 Ga0466706_242325 Ga0466706_242325_1786_2781 331
33 3300042599 Ga0466706_269516 Ga0466706_269516_2721_3716 331
34 3300042600 Ga0466700_238454 Ga0466700_238454_165_1160 331
35 3300042600 Ga0466700_248051 Ga0466700_248051_5244_6239 331
36 3300042600 Ga0466700_257615 Ga0466700_257615_2142_3137 331
37 3300042600 Ga0466700_486479 Ga0466700_486479_260_1255 331
38 3300042601 Ga0466707_104249 Ga0466707_104249_377_1372 331
39 3300042601 Ga0466707_135985 Ga0466707_135985_5140_6135 331
40 3300042601 Ga0466707_263071 Ga0466707_263071_692_1687 331
41 3300042601 Ga0466707_320477 Ga0466707_320477_11817_12812 331
42 3300042602 Ga0466713_037511 Ga0466713_037511_11951_12946 331
43 3300042602 Ga0466713_091459 Ga0466713_091459_14073_15068 331
44 3300042603 Ga0466714_034139 Ga0466714_034139_40112_41107 331
45 3300042605 Ga0466716_384998 Ga0466716_384998_2081_3076 331
46 3300042606 Ga0466719_049976 Ga0466719_049976_2392_3387 331
47 3300042606 Ga0466719_095502 Ga0466719_095502_1904_2899 331
48 3300042606 Ga0466719_362755 Ga0466719_362755_1617_2612 331
49 3300042609 Ga0466722_022637 Ga0466722_022637_3297_4292 331
50 3300042609 Ga0466722_099081 Ga0466722_099081_3706_4701 331
51 3300042609 Ga0466722_210263 Ga0466722_210263_10546_11541 331
52 3300042611 Ga0466697_269985 Ga0466697_269985_236_1231 331
53 3300042612 Ga0466705_192786 Ga0466705_192786_683_1678 331
54 3300042612 Ga0466705_223226 Ga0466705_223226_1805_2800 331
55 3300042612 Ga0466705_325772 Ga0466705_325772_5707_6702 331
56 3300042614 Ga0466712_015870 Ga0466712_015870_205_1200 331
57 3300042615 Ga0466711_275090 Ga0466711_275090_2328_3323 331
58 3300042616 Ga0466715_026465 Ga0466715_026465_17106_18101 331
59 3300042616 Ga0466715_121550 Ga0466715_121550_1198_2193 331
60 3300042616 Ga0466715_154623 Ga0466715_154623_1735_2730 331
61 3300042616 Ga0466715_219042 Ga0466715_219042_262_1257 331
62 3300042616 Ga0466715_269937 Ga0466715_269937_4946_5941 331
63 3300042616 Ga0466715_314614 Ga0466715_314614_5361_6356 331
64 3300042619 Ga0466726_146641 Ga0466726_146641_4118_5113 331
65 3300042620 Ga0466728_095171 Ga0466728_095171_2570_3565 331
66 3300042621 Ga0466729_265332 Ga0466729_265332_4331_5326 331
67 3300042623 Ga0466734_001537 Ga0466734_001537_777_1772 331
68 3300042623 Ga0466734_168132 Ga0466734_168132_59_1054 331
69 3300042624 Ga0466735_023729 Ga0466735_023729_1733_2728 331
70 3300042624 Ga0466735_050202 Ga0466735_050202_249_1244 331
71 3300042624 Ga0466735_133247 Ga0466735_133247_136_1131 331
72 3300042624 Ga0466735_151637 Ga0466735_151637_364_1359 331
73 3300042624 Ga0466735_201604 Ga0466735_201604_258_1253 331
74 3300042624 Ga0466735_224682 Ga0466735_224682_36_1031 331
75 3300042624 Ga0466735_233308 Ga0466735_233308_2919_3914 331
76 3300042636 Ga0466703_133171 Ga0466703_133171_11781_12776 331
77 3300042643 Ga0466704_244518 Ga0466704_244518_4925_5920 331
78 3300042643 Ga0466704_279435 Ga0466704_279435_4364_5359 331
79 3300042648 Ga0466709_400357 Ga0466709_400357_1503_2498 331
80 3300042652 Ga0466708_083142 Ga0466708_083142_5145_6140 331
81 3300042652 Ga0466708_104212 Ga0466708_104212_1326_2321 331
82 3300042655 Ga0466727_098929 Ga0466727_098929_1395_2390 331
83 3300042655 Ga0466727_109300 Ga0466727_109300_278_1273 331
84 3300042655 Ga0466727_240697 Ga0466727_240697_943_1938 331
85 3300042659 Ga0466733_043921 Ga0466733_043921_3592_4587 331
86 3300042659 Ga0466733_103214 Ga0466733_103214_346_1341 331
87 3300056842 Ga0562377_0004 Ga0562377_0004_2062142_2063137 331
88 iso_pr_bacteria 2820757377 2820758263 331
89 iso_pr_bacteria 2820759988 2820762590 331
90 iso_pr_bacteria 2830041218 2830041439 331
91 iso_pr_bacteria 2920168565 2920170256 331
92 iso_pr_bacteria 2922326829 2922326992 331
93 iso_pr_bacteria 2923982719 2923984838 331
94 iso_pr_bacteria 2940195863 2940195867 331
95 iso_pr_bacteria 2940199050 2940202137 331
96 iso_pr_bacteria 2940202316 2940203379 331
97 iso_pr_bacteria 2940205530 2940207841 331
98 iso_pr_bacteria 2940209341 2940210982 331
99 iso_pr_bacteria 2940212447 2940214756 331
100 iso_pr_bacteria 2940298504 2940300719 331
101 iso_pr_bacteria 2940302308 2940304522 331
102 iso_pr_bacteria 2940306115 2940308176 331
103 iso_pr_bacteria 2940309933 2940311925 331
104 iso_pr_bacteria 2940313741 2940315828 331
105 iso_pr_bacteria 2940317558 2940319553 331
106 iso_pr_bacteria 2940321370 2940323158 331
107 iso_pr_bacteria 2940325180 2940327393 331
108 iso_pr_bacteria 2940328985 2940331289 331
109 iso_pr_bacteria 2940332795 2940334880 331
110 iso_pr_bacteria 2940346213 2940349317 331
111 iso_pr_bacteria 2940371297 2940372597 331
112 iso_pr_bacteria 3004667792 3004668569 331
113 iso_pr_bacteria 3004672520 3004675995 331
114 2225789003 2227076901 2227442829 332
115 2225789004 2227441935 2227880486 332
116 3300000062 IMNBL1DRAFT_c0000303 IMNBL1DRAFT_000030310 332
117 3300000062 IMNBL1DRAFT_c0030218 IMNBL1DRAFT_00302182 332
118 3300002462 JGI24702J35022_10001411 JGI24702J35022_100014112 332
119 3300002462 JGI24702J35022_10028873 JGI24702J35022_100288732 332
120 3300002504 JGI24705J35276_12218122 JGI24705J35276_122181222 332
121 3300002504 JGI24705J35276_12236490 JGI24705J35276_122364904 332
122 3300002509 JGI24699J35502_11133987 JGI24699J35502_111339879 332
123 3300002509 JGI24699J35502_11134225 JGI24699J35502_1113422514 332
124 3300009784 Ga0123357_10000419 Ga0123357_1000041925 332
125 3300009784 Ga0123357_10001146 Ga0123357_100011468 332
126 3300009784 Ga0123357_10001158 Ga0123357_1000115823 332
127 3300009784 Ga0123357_10003901 Ga0123357_1000390114 332
128 3300009784 Ga0123357_10006057 Ga0123357_1000605710 332
129 3300009784 Ga0123357_10006419 Ga0123357_1000641912 332
130 3300009784 Ga0123357_10206801 Ga0123357_102068012 332
131 3300010167 Ga0123353_10781090 Ga0123353_107810902 332
132 3300010882 Ga0123354_10284677 Ga0123354_102846772 332
133 3300010882 Ga0123354_10450478 Ga0123354_104504781 332
134 3300042582 Ga0466657_263929 Ga0466657_263929_1877_2875 332
135 3300042591 Ga0466692_088376 Ga0466692_088376_3781_4779 332
136 3300042596 Ga0466696_490214 Ga0466696_490214_689_1687 332
137 3300042601 Ga0466707_238733 Ga0466707_238733_2398_3396 332
138 3300042601 Ga0466707_351658 Ga0466707_351658_3303_4301 332
139 3300042602 Ga0466713_087636 Ga0466713_087636_13353_14351 332
140 3300042602 Ga0466713_096596 Ga0466713_096596_267959_268957 332
141 3300042602 Ga0466713_105016 Ga0466713_105016_42971_43969 332
142 3300042603 Ga0466714_090515 Ga0466714_090515_32316_33314 332
143 3300042612 Ga0466705_081863 Ga0466705_081863_677_1675 332
144 3300042615 Ga0466711_066406 Ga0466711_066406_9017_10015 332
145 3300042615 Ga0466711_214135 Ga0466711_214135_3412_4410 332
146 3300042616 Ga0466715_135030 Ga0466715_135030_2869_3867 332
147 3300042619 Ga0466726_135980 Ga0466726_135980_1515_2513 332
148 3300042619 Ga0466726_169828 Ga0466726_169828_824_1822 332
149 3300042622 Ga0466731_270277 Ga0466731_270277_91_1089 332
150 3300042625 Ga0466730_052015 Ga0466730_052015_2161_3159 332
151 3300042625 Ga0466730_097021 Ga0466730_097021_377_1375 332
152 3300042636 Ga0466703_073365 Ga0466703_073365_772_1770 332
153 3300042636 Ga0466703_150578 Ga0466703_150578_9924_10922 332
154 3300042648 Ga0466709_347035 Ga0466709_347035_16426_17424 332
155 3300042654 Ga0466725_309479 Ga0466725_309479_180_1178 332
156 3300042655 Ga0466727_130038 Ga0466727_130038_738_1736 332
157 3300042659 Ga0466733_002688 Ga0466733_002688_3658_4656 332
158 3300042659 Ga0466733_153801 Ga0466733_153801_17006_18004 332
159 3300042659 Ga0466733_162618 Ga0466733_162618_219_1217 332
160 iso_pr_bacteria 2695420314 2695473114 332
161 iso_pr_bacteria 2695420317 2695484161 332
162 iso_pr_bacteria 2820741847 2820742239 332
163 iso_pr_bacteria 2820762746 2820763978 332
164 iso_pr_bacteria 2873600114 2873600714 332
165 iso_pr_bacteria 2873610414 2873611013 332
166 iso_pr_bacteria 2910942425 2910945655 332
167 iso_pr_bacteria 2910949487 2910949572 332
168 iso_pr_bacteria 2940244548 2940244967 332
169 iso_pr_bacteria 2940248789 2940249207 332
170 iso_pr_bacteria 2940253009 2940253067 332
171 iso_pr_bacteria 2940257232 2940257881 332
172 iso_pr_bacteria 8100157865 8100160936 332
173 iso_pr_bacteria 8100166142 8100166347 332
174 3300000062 IMNBL1DRAFT_c0022182 IMNBL1DRAFT_00221822 333
175 3300002509 JGI24699J35502_11134073 JGI24699J35502_1113407322 333
176 3300002834 JGI24696J40584_12960899 JGI24696J40584_129608994 333
177 3300009826 Ga0123355_10001208 Ga0123355_100012089 333
178 3300010882 Ga0123354_10326043 Ga0123354_103260433 333
179 3300042599 Ga0466706_054670 Ga0466706_054670_12405_13406 333
180 3300042603 Ga0466714_058710 Ga0466714_058710_35336_36337 333
181 3300042606 Ga0466719_290745 Ga0466719_290745_902_1903 333
182 3300042609 Ga0466722_196462 Ga0466722_196462_2886_3887 333
183 3300042616 Ga0466715_066549 Ga0466715_066549_4873_5874 333
184 3300042616 Ga0466715_309209 Ga0466715_309209_5384_6385 333
185 3300042655 Ga0466727_259105 Ga0466727_259105_224_1225 333
186 3300005201 Ga0072941_1020210 Ga0072941_10202101 334
187 3300010167 Ga0123353_10391977 Ga0123353_103919772 334
188 3300042593 Ga0466691_005650 Ga0466691_005650_1674_2678 334
189 3300042596 Ga0466696_370918 Ga0466696_370918_547_1551 334
190 3300042603 Ga0466714_096666 Ga0466714_096666_4492_5496 334
191 3300042612 Ga0466705_233113 Ga0466705_233113_1754_2758 334
192 3300042616 Ga0466715_562326 Ga0466715_562326_59_1063 334
193 3300042636 Ga0466703_332863 Ga0466703_332863_2948_3952 334
194 3300042643 Ga0466704_119788 Ga0466704_119788_1595_2599 334
195 3300042652 Ga0466708_183987 Ga0466708_183987_15424_16431 335
196 3300009826 Ga0123355_10097170 Ga0123355_100971704 336
197 3300010167 Ga0123353_10782884 Ga0123353_107828842 336
198 3300042601 Ga0466707_181678 Ga0466707_181678_1676_2704 342
199 3300042619 Ga0466726_135599 Ga0466726_135599_1712_2740 342
200 3300042655 Ga0466727_164678 Ga0466727_164678_1238_2266 342
201 3300042609 Ga0466722_062639 Ga0466722_062639_667_1701 344
202 3300042603 Ga0466714_139645 Ga0466714_139645_422_1459 345
203 3300000062 IMNBL1DRAFT_c0001457 IMNBL1DRAFT_00014574 347
204 3300042605 Ga0466716_362829 Ga0466716_362829_2546_3592 348
205 3300042656 Ga0466732_331536 Ga0466732_331536_1911_2957 348
206 iso_pr_bacteria 2820751898 2820752544 348
207 iso_pr_bacteria 2820776227 2820778133 348
208 3300009784 Ga0123357_10019192 Ga0123357_100191924 349
209 3300042616 Ga0466715_132207 Ga0466715_132207_1490_2539 349
210 3300002504 JGI24705J35276_12230885 JGI24705J35276_122308853 350
211 3300042619 Ga0466726_099783 Ga0466726_099783_265_1317 350
212 3300042624 Ga0466735_128175 Ga0466735_128175_690_1745 351
213 3300009784 Ga0123357_10233802 Ga0123357_102338022 361

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF07479 NAD_Gly3P_dh_C NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus 185 323 0.95
PF01210 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus 6 164 0.94
PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent 6 110 0.93
PF20618 GPD_NAD_C_bact Bacterial GPD, NAD-dependent C-terminal 247 313 0.92

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.93 0.93 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.