Protein Family IF02435

Metagenome Isolate
121 Members
54 Samples
104 Scaffolds
355.64 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10090890|Ga0123355_100908902
Length
375 aa
Sequence
MITSLPLSILNFAKNVKFLLPKYKNYGRILWINKQGSMMNNLGFGQYFSDHMFTMDYIDGKWQNAQIVPYQNISMDPATMALHYGQLIFEGMKAYKTDDGSIYLFRPRKNFERVNVSNERLAMPPIDEDFCLEALCELIKVDADWIPDKLGTSLYIRPFMFATDPFLGVRPSQTYKFMIILSPVGAYYSEGLNPVKIYAEDEFVRAIRGGVGFTKTAGNYAASLKAQNEAHDKGYSQVLWLDGIERKYIEEVGSMNVFFKIGDEVITPELSGSILSGITRMSVIELLQKWGIKVTERKLSIDEVMASAENGTLKEAWGTGTAAVISPIGELNFKGNAQVINNNQIGELTAKLYDTITGIQTCRIPDDLGWTYKV*

📊 Sample Types

Isolate 14.1%
Metagenome 86.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 25.0%
Termitidae 25.0%
Kalotermitidae 25.0%
Blattidae 9.6%
Passalidae 3.8%
Rhinotermitidae 3.8%
Termopsidae 3.8%
Culicidae 1.9%
Hodotermitidae 1.9%

🌳 Taxonomy

Archaea 0
Bacteria 113
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940339133 Breznakia sp. PF5-3 Isolate Blattidae
2 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
3 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
4 2820344559 Unclassified Firmicutes Nt197P3bin63 Isolate Unclassified
5 2820464928 Unclassified Firmicutes Lab288P3bin121 Isolate Unclassified
6 2820483401 Unclassified Firmicutes Lab288P1bin74 Isolate Unclassified
7 2820219087 Unclassified Ignavibacteria Th196P3bin14 Isolate Unclassified
8 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
9 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
10 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
11 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
12 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
13 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
14 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
15 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
16 2940343849 Breznakia sp. PH5-24 Isolate Blattidae
17 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
18 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
19 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
20 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
21 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
22 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
23 2940228231 Anaerovoracaceae bacterium PM5-7 Isolate Blattidae
24 2820007728 Unclassified Synergistetes Lab288P3bin114 Isolate Unclassified
25 2820265624 Unclassified Firmicutes Th196P3bin36 Isolate Unclassified
26 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
27 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
28 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
29 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
30 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
31 2820444930 Unclassified Firmicutes Lab288P3bin199 Isolate Unclassified
32 2820525019 Unclassified Firmicutes Lab288P1bin2 Isolate Unclassified
33 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
34 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
35 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
36 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
37 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
38 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
39 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
40 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
41 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
42 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
43 2940236825 Breznakia sp. PM6-1 Isolate Blattidae
44 2940341480 Breznakia sp. PFB2-8 Isolate Blattidae
45 2209111004 Macrotermes natalensis queen gut microbiome Metagenome Termitidae
46 2820495292 Unclassified Firmicutes Lab288P1bin59 Isolate Unclassified
47 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
48 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
49 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
50 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
51 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
52 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
53 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
54 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466694_007328 3300042594 Bacteria 2665
2 Ga0123355_10027202 3300009826 Bacteria 9234
3 Ga0123355_10081286 3300009826 Bacteria 5171
4 Ga0123355_10250112 3300009826 Bacteria 2497
5 Ga0123355_10316649 3300009826 Bacteria 2107
6 Ga0466723_239682 3300042618 Bacteria 1441
7 Ga0466714_065408 3300042603 Bacteria 1473
8 Ga0466716_524850 3300042605 Bacteria 1571
9 Ga0466696_141768 3300042596 Bacteria 6151
10 Ga0466696_264724 3300042596 Bacteria 5028
11 Ga0123355_10004344 3300009826 Bacteria 20618
12 Ga0123356_10094029 3300010049 Bacteria 2862
13 Ga0123353_10001192 3300010167 Unclassified 31797
14 Ga0123353_10174035 3300010167 Unclassified 3414
15 Ga0466711_486470 3300042615 Bacteria 3006
16 Ga0466723_243636 3300042618 Bacteria 2956
17 Ga0466706_196732 3300042599 Bacteria 1310
18 JGI24695J34938_10001446 3300002450 Bacteria 20110
19 Ga0068305_10003905 3300005083 Bacteria 42618
20 Ga0466708_108728 3300042652 Bacteria 9167
21 Ga0466725_459911 3300042654 Bacteria 2234
22 Ga0466705_049467 3300042612 Bacteria 6699
23 Ga0160452_100168 3300012834 Bacteria 73350
24 Ga0466691_126092 3300042593 Bacteria 31796
25 Ga0123355_10112461 3300009826 Bacteria 4250
26 Ga0466726_033523 3300042619 Bacteria 3584
27 Ga0466700_435623 3300042600 Bacteria 1270
28 Ga0466708_209396 3300042652 Bacteria 4516
29 Ga0466708_362576 3300042652 Bacteria 26812
30 Ga0466705_308152 3300042612 Bacteria 62248
31 Ga0123355_10001873 3300009826 Bacteria 29511
32 Ga0466705_467491 3300042612 Bacteria 2414
33 Ga0466711_276026 3300042615 Bacteria 24760
34 Ga0466715_077073 3300042616 Bacteria 10632
35 Ga0466715_576135 3300042616 Bacteria 16833
36 Ga0466723_054396 3300042618 Bacteria 5263
37 Ga0466706_287210 3300042599 Bacteria 4004
38 Ga0466719_010778 3300042606 Bacteria 1396
39 Ga0466719_330354 3300042606 Bacteria 1404
40 Ga0466704_540024 3300042643 Unclassified 29901
41 Ga0466725_441143 3300042654 Bacteria 1423
42 Ga0466727_073731 3300042655 Bacteria 5333
43 Ga0160448_102102 3300012854 Bacteria 6249
44 Ga0466696_028801 3300042596 Bacteria 2166
45 Ga0123355_10144815 3300009826 Bacteria 3626
46 Ga0123356_10029443 3300010049 Bacteria 5142
47 Ga0123353_10134585 3300010167 Bacteria 3965
48 Ga0123353_10234870 3300010167 Bacteria 2855
49 Ga0466723_047768 3300042618 Bacteria 15595
50 Ga0466726_047528 3300042619 Bacteria 1841
51 Ga0466707_122484 3300042601 Bacteria 16436
52 Ga0466714_115055 3300042603 Unclassified 2449
53 Ga0466719_172759 3300042606 Bacteria 1907
54 IMNBL1DRAFT_c0017421 3300000062 Bacteria 3023
55 Ga0466734_155309 3300042623 Bacteria 2942
56 Ga0466703_101356 3300042636 Bacteria 73703
57 Ga0466708_311315 3300042652 Bacteria 83719
58 Ga0466733_077952 3300042659 Bacteria 10251
59 Ga0466733_209417 3300042659 Bacteria 14496
60 Ga0466690_022625 3300042590 Bacteria 52356
61 Ga0466691_144986 3300042593 Bacteria 8202
62 Ga0466696_239007 3300042596 Bacteria 1988
63 Ga0123355_10002777 3300009826 Bacteria 24842
64 Ga0123355_10072453 3300009826 Bacteria 5525
65 Ga0466711_221570 3300042615 Bacteria 1734
66 Ga0466711_228752 3300042615 Unclassified 2556
67 Ga0466715_060288 3300042616 Bacteria 19424
68 Ga0466715_395521 3300042616 Bacteria 16361
69 Ga0466726_143482 3300042619 Bacteria 9669
70 Ga0466707_022263 3300042601 Bacteria 27738
71 Ga0466719_395530 3300042606 Bacteria 3913
72 Ga0466703_396510 3300042636 Bacteria 240496
73 Ga0160441_100316 3300012825 Bacteria 43612
74 Ga0415639_066642 3300038395 Bacteria 4140
75 Ga0123353_10023028 3300010167 Bacteria 9417
76 Ga0123353_10160232 3300010167 Bacteria 3583
77 Ga0466715_027363 3300042616 Bacteria 16461
78 Ga0466723_335841 3300042618 Bacteria 9015
79 Ga0466728_199917 3300042620 Unclassified 9615
80 Ga0466728_256944 3300042620 Bacteria 1313
81 Ga0466707_065070 3300042601 Bacteria 2402
82 Ga0466707_316918 3300042601 Bacteria 4555
83 Ga0466713_128660 3300042602 Bacteria 6800
84 Ga0466714_028782 3300042603 Bacteria 1740
85 Ga0466716_091423 3300042605 Bacteria 6820
86 Ga0466729_262130 3300042621 Bacteria 2848
87 Ga0466697_233040 3300042611 Unclassified 1115
88 Ga0466691_195943 3300042593 Bacteria 10337
89 Ga0466696_161624 3300042596 Bacteria 1536
90 Ga0123355_10000365 3300009826 Bacteria 58534
91 Ga0123355_10090890 3300009826 Bacteria 4841
92 Ga0123356_10000019 3300010049 Bacteria 179881
93 Ga0123353_10272288 3300010167 Bacteria 2607
94 Ga0466711_481073 3300042615 Bacteria 3426
95 Ga0466723_337230 3300042618 Bacteria 12282
96 Ga0466728_027766 3300042620 Bacteria 13383
97 Ga0466706_093641 3300042599 Bacteria 6560
98 Ga0466707_270883 3300042601 Unclassified 7362
99 Ga0466707_291654 3300042601 Bacteria 6344
100 Ga0466713_035394 3300042602 Bacteria 62034
101 Ga0466722_071489 3300042609 Bacteria 30292
102 2212936165 2209111004 Bacteria 40493
103 2227500464 2225789004 Bacteria 3817
104 IMNBL1DRAFT_c0000879 3300000062 Bacteria 23426

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042611 Ga0466697_233040 Ga0466697_233040_170_1105 311
2 3300042596 Ga0466696_028801 Ga0466696_028801_799_1776 325
3 3300042602 Ga0466713_035394 Ga0466713_035394_60835_61812 325
4 3300042606 Ga0466719_010778 Ga0466719_010778_18_995 325
5 3300010049 Ga0123356_10094029 Ga0123356_100940292 328
6 3300010167 Ga0123353_10001192 Ga0123353_1000119212 338
7 3300042596 Ga0466696_141768 Ga0466696_141768_553_1623 341
8 3300009826 Ga0123355_10001873 Ga0123355_100018739 342
9 3300010167 Ga0123353_10023028 Ga0123353_100230287 342
10 3300010049 Ga0123356_10000019 Ga0123356_1000001967 345
11 3300009826 Ga0123355_10081286 Ga0123355_100812862 346
12 3300042606 Ga0466719_395530 Ga0466719_395530_222_1268 348
13 3300042601 Ga0466707_316918 Ga0466707_316918_929_1978 349
14 3300002450 JGI24695J34938_10001446 JGI24695J34938_1000144610 350
15 3300042594 Ga0466694_007328 Ga0466694_007328_1250_2326 350
16 3300042601 Ga0466707_022263 Ga0466707_022263_22489_23541 350
17 3300042601 Ga0466707_122484 Ga0466707_122484_2695_3747 350
18 3300042601 Ga0466707_291654 Ga0466707_291654_559_1611 350
19 3300042615 Ga0466711_228752 Ga0466711_228752_337_1389 350
20 3300042599 Ga0466706_093641 Ga0466706_093641_3636_4691 351
21 3300042606 Ga0466719_330354 Ga0466719_330354_226_1284 352
22 3300042618 Ga0466723_337230 Ga0466723_337230_3729_4787 352
23 3300042659 Ga0466733_077952 Ga0466733_077952_7443_8501 352
24 iso_pr_bacteria 2820464928 2820465148 352
25 iso_pr_bacteria 2820525019 2820525984 352
26 3300009826 Ga0123355_10316649 Ga0123355_103166492 353
27 3300038395 Ga0415639_066642 Ga0415639_066642_2080_3141 353
28 iso_pr_bacteria 2940236825 2940238661 353
29 iso_pr_bacteria 2940339133 2940341053 353
30 iso_pr_bacteria 2940341480 2940343357 353
31 iso_pr_bacteria 2940343849 2940345734 353
32 3300009826 Ga0123355_10144815 Ga0123355_101448153 354
33 3300009826 Ga0123355_10250112 Ga0123355_102501124 354
34 3300042600 Ga0466700_435623 Ga0466700_435623_38_1102 354
35 3300042623 Ga0466734_155309 Ga0466734_155309_889_1953 354
36 2225789004 2227500464 2227982626 355
37 3300042636 Ga0466703_396510 Ga0466703_396510_113557_114624 355
38 iso_pr_bacteria 2820265624 2820267177 355
39 iso_pr_bacteria 2820272499 2820273951 355
40 iso_pr_bacteria 2820344559 2820345998 355
41 iso_pr_bacteria 2820444930 2820445823 355
42 3300009826 Ga0123355_10004344 Ga0123355_100043442 356
43 3300009826 Ga0123355_10072453 Ga0123355_100724532 356
44 3300010167 Ga0123353_10174035 Ga0123353_101740353 356
45 3300042599 Ga0466706_196732 Ga0466706_196732_25_1095 356
46 3300042599 Ga0466706_287210 Ga0466706_287210_2399_3469 356
47 3300042603 Ga0466714_028782 Ga0466714_028782_657_1727 356
48 3300042603 Ga0466714_065408 Ga0466714_065408_93_1163 356
49 iso_pr_bacteria 2820265624 2820267214 356
50 iso_pr_bacteria 2820483401 2820485849 356
51 iso_pr_bacteria 2940228231 2940228974 356
52 3300000062 IMNBL1DRAFT_c0017421 IMNBL1DRAFT_00174212 357
53 3300009826 Ga0123355_10002777 Ga0123355_1000277714 357
54 3300009826 Ga0123355_10112461 Ga0123355_101124613 357
55 3300012825 Ga0160441_100316 Ga0160441_10031629 357
56 3300012834 Ga0160452_100168 Ga0160452_10016827 357
57 3300012854 Ga0160448_102102 Ga0160448_1021028 357
58 3300042590 Ga0466690_022625 Ga0466690_022625_41315_42388 357
59 3300042593 Ga0466691_126092 Ga0466691_126092_12843_13916 357
60 3300042593 Ga0466691_195943 Ga0466691_195943_8964_10037 357
61 3300042596 Ga0466696_239007 Ga0466696_239007_425_1498 357
62 3300042596 Ga0466696_264724 Ga0466696_264724_3570_4643 357
63 3300042602 Ga0466713_128660 Ga0466713_128660_4917_5990 357
64 3300042605 Ga0466716_091423 Ga0466716_091423_10_1083 357
65 3300042605 Ga0466716_524850 Ga0466716_524850_444_1517 357
66 3300042609 Ga0466722_071489 Ga0466722_071489_25200_26273 357
67 3300042612 Ga0466705_049467 Ga0466705_049467_2323_3396 357
68 3300042612 Ga0466705_467491 Ga0466705_467491_144_1217 357
69 3300042615 Ga0466711_221570 Ga0466711_221570_601_1674 357
70 3300042615 Ga0466711_481073 Ga0466711_481073_2214_3287 357
71 3300042615 Ga0466711_486470 Ga0466711_486470_536_1609 357
72 3300042616 Ga0466715_027363 Ga0466715_027363_3906_4979 357
73 3300042616 Ga0466715_060288 Ga0466715_060288_1120_2193 357
74 3300042616 Ga0466715_576135 Ga0466715_576135_3777_4850 357
75 3300042618 Ga0466723_047768 Ga0466723_047768_8877_9950 357
76 3300042618 Ga0466723_054396 Ga0466723_054396_2483_3556 357
77 3300042618 Ga0466723_239682 Ga0466723_239682_85_1158 357
78 3300042618 Ga0466723_243636 Ga0466723_243636_1514_2587 357
79 3300042618 Ga0466723_335841 Ga0466723_335841_6209_7282 357
80 3300042619 Ga0466726_033523 Ga0466726_033523_41_1114 357
81 3300042619 Ga0466726_143482 Ga0466726_143482_1798_2871 357
82 3300042620 Ga0466728_027766 Ga0466728_027766_11622_12695 357
83 3300042620 Ga0466728_256944 Ga0466728_256944_81_1154 357
84 3300042621 Ga0466729_262130 Ga0466729_262130_232_1305 357
85 3300042636 Ga0466703_101356 Ga0466703_101356_50906_51979 357
86 3300042652 Ga0466708_108728 Ga0466708_108728_2955_4028 357
87 3300042652 Ga0466708_311315 Ga0466708_311315_10288_11361 357
88 3300042652 Ga0466708_362576 Ga0466708_362576_1962_3035 357
89 3300042655 Ga0466727_073731 Ga0466727_073731_2817_3890 357
90 3300042659 Ga0466733_209417 Ga0466733_209417_12608_13702 357
91 iso_pr_bacteria 2820007728 2820008311 357
92 iso_pr_bacteria 2820007728 2820008809 357
93 iso_pr_bacteria 2820495292 2820495583 357
94 3300010049 Ga0123356_10029443 Ga0123356_100294435 358
95 3300010167 Ga0123353_10134585 Ga0123353_101345852 358
96 3300010167 Ga0123353_10234870 Ga0123353_102348702 358
97 3300010167 Ga0123353_10272288 Ga0123353_102722883 358
98 3300042593 Ga0466691_144986 Ga0466691_144986_5086_6165 359
99 3300042596 Ga0466696_161624 Ga0466696_161624_352_1431 359
100 3300042643 Ga0466704_540024 Ga0466704_540024_7165_8244 359
101 3300009826 Ga0123355_10000365 Ga0123355_100003656 360
102 3300042619 Ga0466726_047528 Ga0466726_047528_257_1339 360
103 3300042603 Ga0466714_115055 Ga0466714_115055_1202_2287 361
104 3300042601 Ga0466707_270883 Ga0466707_270883_5547_6635 362
105 3300042616 Ga0466715_395521 Ga0466715_395521_13841_14929 362
106 iso_pr_bacteria 2820219087 2820219155 362
107 2209111004 2212936165 2212714823 363
108 3300000062 IMNBL1DRAFT_c0000879 IMNBL1DRAFT_000087910 363
109 3300010167 Ga0123353_10160232 Ga0123353_101602322 363
110 3300005083 Ga0068305_10003905 Ga0068305_1000390524 367
111 3300042654 Ga0466725_441143 Ga0466725_441143_85_1212 367
112 3300042606 Ga0466719_172759 Ga0466719_172759_726_1838 370
113 3300042616 Ga0466715_077073 Ga0466715_077073_9234_10349 371
114 3300042612 Ga0466705_308152 Ga0466705_308152_15664_16782 372
115 3300042615 Ga0466711_276026 Ga0466711_276026_21051_22169 372
116 3300042620 Ga0466728_199917 Ga0466728_199917_1957_3075 372
117 3300042654 Ga0466725_459911 Ga0466725_459911_318_1439 373
118 3300009826 Ga0123355_10090890 Ga0123355_100908902 375
119 3300042652 Ga0466708_209396 Ga0466708_209396_3135_4265 376
120 3300042601 Ga0466707_065070 Ga0466707_065070_619_1758 379
121 3300009826 Ga0123355_10027202 Ga0123355_100272025 380

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01063 Aminotran_4 Amino-transferase class IV 88 330 0.92

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01063 GO:0003824 catalytic activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.87 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.