Protein Family IF02410
Metagenome
Isolate
117
Members
54
Samples
113
Scaffolds
244.05
Avg Length
Representative Sequence
- ID
- 3300009826|Ga0123355_10049442|Ga0123355_100494426
- Length
- 285 aa
- Sequence
- MPFFSRVVFYRLQIAYGVGAEPHLENMVLEHADNGAVYNSPVGFGRWIMVGIIPEHIAIIMDGNGRWAKRRFLNKAAGHRAGAQALRRLATAAEKLGVKYLTVYAFSTENWTRPKEEVDTLMNLIHDYIQQYIDDSKKNNMRISIIGDLSKLSDDLQRKIADLQQMTQEKSGLRVIIALNYGGRDDIVRAAHNLAADVKSGRTKLDEINESLFANYLDTVNLPDPDLLIRTSGEMRISNFLIWQTAYTEMYFCDKLWPDFTIKDLELAIGQYNRRDRRYGGRNE*
Sample Types
Isolate
3.4%
Metagenome
96.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
48.0%
Kalotermitidae
16.0%
Unclassified
12.0%
Termopsidae
6.0%
Armadillidiidae
4.0%
Culicidae
4.0%
Passalidae
4.0%
Hodotermitidae
2.0%
Rhinotermitidae
2.0%
Hydrophilidae
2.0%
Taxonomy
Archaea
0
Bacteria
111
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 2 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 7 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 10 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 11 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 12 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 13 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 14 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 15 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 16 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 17 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 18 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 19 | 2820499546 | Unclassified Firmicutes Lab288P1bin54 | Isolate | Unclassified |
| 20 | 2820176377 | Unclassified Planctomycetes Th196P3bin111 | Isolate | Unclassified |
| 21 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 22 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 23 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 24 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 25 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 26 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 27 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 28 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 29 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 30 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 31 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 32 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 33 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 34 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 35 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 36 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 37 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 38 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 39 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 40 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 41 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 42 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 43 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 44 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 45 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 46 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 47 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 48 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 49 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 50 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 51 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 52 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 53 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 54 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123357_10010391 | 3300009784 | Bacteria | 11836 |
| 2 | Ga0123356_10008869 | 3300010049 | Bacteria | 9954 |
| 3 | Ga0123354_10188498 | 3300010882 | Bacteria | 2321 |
| 4 | Ga0466715_172699 | 3300042616 | Bacteria | 4787 |
| 5 | Ga0466726_024523 | 3300042619 | Bacteria | 4994 |
| 6 | Ga0160446_100002 | 3300012835 | Bacteria | 540874 |
| 7 | Ga0415639_096959 | 3300038395 | Bacteria | 4294 |
| 8 | Ga0466656_287551 | 3300042550 | Bacteria | 2989 |
| 9 | Ga0466735_002450 | 3300042624 | Bacteria | 6642 |
| 10 | Ga0466735_012596 | 3300042624 | Bacteria | 7500 |
| 11 | Ga0466706_129685 | 3300042599 | Bacteria | 4505 |
| 12 | Ga0466700_058504 | 3300042600 | Bacteria | 32871 |
| 13 | Ga0466707_284263 | 3300042601 | Bacteria | 8451 |
| 14 | Ga0466717_205971 | 3300042604 | Bacteria | 8583 |
| 15 | Ga0123357_10361347 | 3300009784 | Bacteria | 1375 |
| 16 | Ga0123355_10049442 | 3300009826 | Bacteria | 6836 |
| 17 | Ga0123355_10232518 | 3300009826 | Unclassified | 2630 |
| 18 | Ga0160465_100034 | 3300012803 | Bacteria | 184769 |
| 19 | Ga0466706_143557 | 3300042599 | Bacteria | 11371 |
| 20 | IMNBL1DRAFT_c0014353 | 3300000062 | Bacteria | 3502 |
| 21 | Ga0072941_1097518 | 3300005201 | Bacteria | 7531 |
| 22 | Ga0466705_119280 | 3300042612 | Bacteria | 25556 |
| 23 | Ga0123354_10111492 | 3300010882 | Bacteria | 3608 |
| 24 | Ga0160469_100182 | 3300012824 | Bacteria | 59604 |
| 25 | Ga0160460_100165 | 3300012845 | Bacteria | 73034 |
| 26 | Ga0160430_101262 | 3300012852 | Bacteria | 9860 |
| 27 | Ga0466696_097926 | 3300042596 | Bacteria | 2508 |
| 28 | Ga0466699_266084 | 3300042597 | Bacteria | 2645 |
| 29 | Ga0466731_044975 | 3300042622 | Bacteria | 18111 |
| 30 | Ga0466703_250639 | 3300042636 | Bacteria | 20076 |
| 31 | Ga0466706_005779 | 3300042599 | Bacteria | 11077 |
| 32 | Ga0466706_039169 | 3300042599 | Bacteria | 86401 |
| 33 | Ga0466714_048867 | 3300042603 | Bacteria | 2230 |
| 34 | 2227183574 | 2225789004 | Bacteria | 8038 |
| 35 | JGI24699J35502_11134035 | 3300002509 | Bacteria | 25887 |
| 36 | Ga0123357_10000787 | 3300009784 | Bacteria | 32023 |
| 37 | Ga0466705_179010 | 3300042612 | Bacteria | 13746 |
| 38 | Ga0466705_303009 | 3300042612 | Bacteria | 13305 |
| 39 | Ga0466732_189386 | 3300042656 | Bacteria | 1728 |
| 40 | Ga0123357_10003925 | 3300009784 | Bacteria | 17272 |
| 41 | Ga0123356_10241230 | 3300010049 | Bacteria | 1879 |
| 42 | Ga0123356_11259456 | 3300010049 | Bacteria | 904 |
| 43 | Ga0123354_10025889 | 3300010882 | Bacteria | 9251 |
| 44 | Ga0466735_153385 | 3300042624 | Bacteria | 1333 |
| 45 | Ga0466730_068782 | 3300042625 | Bacteria | 1200 |
| 46 | Ga0466724_28706 | 3300042649 | Bacteria | 3020 |
| 47 | Ga0466701_050601 | 3300042598 | Bacteria | 2749 |
| 48 | Ga0466706_081323 | 3300042599 | Bacteria | 2555 |
| 49 | Ga0466707_096168 | 3300042601 | Bacteria | 11351 |
| 50 | Ga0466714_153181 | 3300042603 | Bacteria | 120481 |
| 51 | Ga0466716_421088 | 3300042605 | Bacteria | 2643 |
| 52 | Ga0123357_10001231 | 3300009784 | Bacteria | 26869 |
| 53 | Ga0123357_10042483 | 3300009784 | Bacteria | 6182 |
| 54 | Ga0123355_10189237 | 3300009826 | Bacteria | 3036 |
| 55 | Ga0123355_10500605 | 3300009826 | Bacteria | 1499 |
| 56 | Ga0123355_11119161 | 3300009826 | Bacteria | 816 |
| 57 | Ga0123356_10572187 | 3300010049 | Bacteria | 1292 |
| 58 | Ga0123353_10934871 | 3300010167 | Bacteria | 1175 |
| 59 | Ga0123354_10002122 | 3300010882 | Bacteria | 25659 |
| 60 | Ga0160457_1001391 | 3300012858 | Bacteria | 6784 |
| 61 | Ga0415639_090223 | 3300038395 | Bacteria | 1819 |
| 62 | Ga0466657_010693 | 3300042582 | Bacteria | 1762 |
| 63 | Ga0466735_217611 | 3300042624 | Bacteria | 5726 |
| 64 | Ga0466702_158226 | 3300042635 | Bacteria | 2443 |
| 65 | Ga0466709_194948 | 3300042648 | Bacteria | 107037 |
| 66 | Ga0466706_052202 | 3300042599 | Bacteria | 26638 |
| 67 | Ga0466713_018057 | 3300042602 | Bacteria | 13876 |
| 68 | Ga0466719_184204 | 3300042606 | Bacteria | 3193 |
| 69 | IMNBL1DRAFT_c0000757 | 3300000062 | Bacteria | 25499 |
| 70 | Ga0123357_10000572 | 3300009784 | Bacteria | 36340 |
| 71 | Ga0466697_133863 | 3300042611 | Bacteria | 5422 |
| 72 | Ga0123356_10591464 | 3300010049 | Bacteria | 1274 |
| 73 | Ga0123356_10616686 | 3300010049 | Bacteria | 1250 |
| 74 | Ga0123354_10010405 | 3300010882 | Bacteria | 14326 |
| 75 | Ga0466718_044366 | 3300042617 | Bacteria | 1384 |
| 76 | Ga0466706_024691 | 3300042599 | Bacteria | 129068 |
| 77 | Ga0466706_157003 | 3300042599 | Bacteria | 22315 |
| 78 | Ga0466707_220247 | 3300042601 | Bacteria | 7948 |
| 79 | Ga0466722_147683 | 3300042609 | Bacteria | 8636 |
| 80 | IMNBL1DRAFT_c0039681 | 3300000062 | Bacteria | 1603 |
| 81 | JGI24705J35276_12107157 | 3300002504 | Bacteria | 1033 |
| 82 | JGI24699J35502_11134138 | 3300002509 | Bacteria | 36202 |
| 83 | Ga0068305_10009364 | 3300005083 | Unclassified | 49869 |
| 84 | Ga0123357_10000375 | 3300009784 | Bacteria | 42298 |
| 85 | Ga0123357_10021213 | 3300009784 | Bacteria | 8696 |
| 86 | Ga0123355_10492770 | 3300009826 | Unclassified | 1517 |
| 87 | Ga0123353_10001854 | 3300010167 | Bacteria | 26052 |
| 88 | Ga0123353_10075984 | 3300010167 | Bacteria | 5398 |
| 89 | Ga0123353_10796687 | 3300010167 | Bacteria | 1305 |
| 90 | Ga0123354_10000458 | 3300010882 | Bacteria | 40359 |
| 91 | Ga0123354_10036002 | 3300010882 | Bacteria | 7724 |
| 92 | Ga0415639_090222 | 3300038395 | Unclassified | 1862 |
| 93 | Ga0466704_098030 | 3300042643 | Bacteria | 25866 |
| 94 | Ga0466727_235389 | 3300042655 | Bacteria | 27915 |
| 95 | Ga0466701_043606 | 3300042598 | Bacteria | 24638 |
| 96 | Ga0466701_055721 | 3300042598 | Bacteria | 17089 |
| 97 | Ga0466706_119952 | 3300042599 | Bacteria | 16253 |
| 98 | Ga0466706_256209 | 3300042599 | Bacteria | 6005 |
| 99 | 2227659898 | 2225789004 | Bacteria | 1954 |
| 100 | IMNBL1DRAFT_c0000735 | 3300000062 | Bacteria | 25981 |
| 101 | JGI24705J35276_12235304 | 3300002504 | Bacteria | 6389 |
| 102 | JGI24696J40584_12961175 | 3300002834 | Bacteria | 11626 |
| 103 | Ga0123355_10238286 | 3300009826 | Bacteria | 2583 |
| 104 | Ga0123354_10048319 | 3300010882 | Bacteria | 6472 |
| 105 | Ga0466715_045002 | 3300042616 | Unclassified | 86136 |
| 106 | Ga0466715_199726 | 3300042616 | Bacteria | 77370 |
| 107 | Ga0160441_100216 | 3300012825 | Bacteria | 57462 |
| 108 | Ga0466693_272555 | 3300042592 | Bacteria | 1186 |
| 109 | Ga0466703_190509 | 3300042636 | Bacteria | 2087 |
| 110 | Ga0466700_171688 | 3300042600 | Bacteria | 1529 |
| 111 | Ga0466707_008342 | 3300042601 | Bacteria | 15169 |
| 112 | Ga0466713_086439 | 3300042602 | Unclassified | 51900 |
| 113 | Ga0466722_109642 | 3300042609 | Bacteria | 9365 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042636 | Ga0466703_190509 | Ga0466703_190509_94_717 | 207 |
| 2 | 3300042592 | Ga0466693_272555 | Ga0466693_272555_411_1067 | 218 |
| 3 | 3300042599 | Ga0466706_119952 | Ga0466706_119952_11943_12611 | 222 |
| 4 | 3300042599 | Ga0466706_024691 | Ga0466706_024691_104998_105669 | 223 |
| 5 | 3300042599 | Ga0466706_081323 | Ga0466706_081323_1836_2507 | 223 |
| 6 | 3300042599 | Ga0466706_129685 | Ga0466706_129685_3600_4271 | 223 |
| 7 | 3300042599 | Ga0466706_157003 | Ga0466706_157003_2541_3212 | 223 |
| 8 | 3300042599 | Ga0466706_052202 | Ga0466706_052202_255_935 | 226 |
| 9 | 3300042598 | Ga0466701_055721 | Ga0466701_055721_7481_8164 | 227 |
| 10 | 3300038395 | Ga0415639_090222 | Ga0415639_090222_894_1589 | 231 |
| 11 | 3300038395 | Ga0415639_090223 | Ga0415639_090223_921_1616 | 231 |
| 12 | 3300042616 | Ga0466715_045002 | Ga0466715_045002_46677_47378 | 233 |
| 13 | 3300042649 | Ga0466724_28706 | Ga0466724_28706_992_1693 | 233 |
| 14 | 3300010167 | Ga0123353_10075984 | Ga0123353_100759843 | 234 |
| 15 | 3300038395 | Ga0415639_096959 | Ga0415639_096959_2590_3294 | 234 |
| 16 | 3300042603 | Ga0466714_048867 | Ga0466714_048867_1137_1841 | 234 |
| 17 | 3300042605 | Ga0466716_421088 | Ga0466716_421088_792_1496 | 234 |
| 18 | 3300009826 | Ga0123355_11119161 | Ga0123355_111191612 | 235 |
| 19 | 3300010049 | Ga0123356_10008869 | Ga0123356_100088699 | 235 |
| 20 | 3300042606 | Ga0466719_184204 | Ga0466719_184204_1119_1826 | 235 |
| 21 | 3300042602 | Ga0466713_018057 | Ga0466713_018057_4747_5457 | 236 |
| 22 | 3300042609 | Ga0466722_147683 | Ga0466722_147683_5900_6610 | 236 |
| 23 | 3300009826 | Ga0123355_10232518 | Ga0123355_102325183 | 237 |
| 24 | 3300009826 | Ga0123355_10238286 | Ga0123355_102382862 | 237 |
| 25 | 3300009826 | Ga0123355_10492770 | Ga0123355_104927701 | 237 |
| 26 | 3300010167 | Ga0123353_10796687 | Ga0123353_107966872 | 237 |
| 27 | 3300042598 | Ga0466701_043606 | Ga0466701_043606_20254_20967 | 237 |
| 28 | 3300042598 | Ga0466701_050601 | Ga0466701_050601_634_1347 | 237 |
| 29 | 3300042612 | Ga0466705_119280 | Ga0466705_119280_11292_12005 | 237 |
| 30 | 3300042616 | Ga0466715_199726 | Ga0466715_199726_54075_54788 | 237 |
| 31 | 3300042636 | Ga0466703_250639 | Ga0466703_250639_19130_19843 | 237 |
| 32 | iso_pr_bacteria | 2820499546 | 2820501236 | 237 |
| 33 | 3300009826 | Ga0123355_10500605 | Ga0123355_105006052 | 238 |
| 34 | 3300042616 | Ga0466715_172699 | Ga0466715_172699_3709_4425 | 238 |
| 35 | 3300042622 | Ga0466731_044975 | Ga0466731_044975_17116_17835 | 239 |
| 36 | 3300042597 | Ga0466699_266084 | Ga0466699_266084_306_1028 | 240 |
| 37 | 3300042601 | Ga0466707_284263 | Ga0466707_284263_1175_1897 | 240 |
| 38 | 3300042602 | Ga0466713_086439 | Ga0466713_086439_35373_36095 | 240 |
| 39 | 3300042625 | Ga0466730_068782 | Ga0466730_068782_361_1083 | 240 |
| 40 | 3300042648 | Ga0466709_194948 | Ga0466709_194948_18726_19448 | 240 |
| 41 | 3300000062 | IMNBL1DRAFT_c0014353 | IMNBL1DRAFT_00143533 | 241 |
| 42 | 3300000062 | IMNBL1DRAFT_c0039681 | IMNBL1DRAFT_00396811 | 241 |
| 43 | 3300005083 | Ga0068305_10009364 | Ga0068305_1000936455 | 241 |
| 44 | 3300010049 | Ga0123356_10241230 | Ga0123356_102412302 | 241 |
| 45 | 3300042604 | Ga0466717_205971 | Ga0466717_205971_921_1646 | 241 |
| 46 | 3300042612 | Ga0466705_303009 | Ga0466705_303009_6537_7283 | 241 |
| 47 | 3300042599 | Ga0466706_039169 | Ga0466706_039169_61963_62691 | 242 |
| 48 | 3300042599 | Ga0466706_256209 | Ga0466706_256209_648_1376 | 242 |
| 49 | 3300042617 | Ga0466718_044366 | Ga0466718_044366_620_1348 | 242 |
| 50 | 3300042656 | Ga0466732_189386 | Ga0466732_189386_55_783 | 242 |
| 51 | 3300002834 | JGI24696J40584_12961175 | JGI24696J40584_129611754 | 243 |
| 52 | iso_pr_bacteria | 2820176377 | 2820177615 | 243 |
| 53 | 3300042603 | Ga0466714_153181 | Ga0466714_153181_7045_7779 | 244 |
| 54 | 2225789004 | 2227183574 | 2227602218 | 245 |
| 55 | 3300010167 | Ga0123353_10934871 | Ga0123353_109348711 | 245 |
| 56 | 3300000062 | IMNBL1DRAFT_c0000735 | IMNBL1DRAFT_00007356 | 246 |
| 57 | 3300042582 | Ga0466657_010693 | Ga0466657_010693_375_1115 | 246 |
| 58 | 3300042619 | Ga0466726_024523 | Ga0466726_024523_1528_2268 | 246 |
| 59 | iso_pr_bacteria | 2873776654 | 2873777489 | 246 |
| 60 | 2225789004 | 2227659898 | 2228259870 | 247 |
| 61 | 3300002504 | JGI24705J35276_12107157 | JGI24705J35276_121071572 | 247 |
| 62 | 3300009784 | Ga0123357_10010391 | Ga0123357_100103913 | 247 |
| 63 | 3300009826 | Ga0123355_10189237 | Ga0123355_101892373 | 247 |
| 64 | 3300012803 | Ga0160465_100034 | Ga0160465_10003453 | 247 |
| 65 | 3300012824 | Ga0160469_100182 | Ga0160469_1001822 | 247 |
| 66 | 3300012825 | Ga0160441_100216 | Ga0160441_10021615 | 247 |
| 67 | 3300012835 | Ga0160446_100002 | Ga0160446_10000247 | 247 |
| 68 | 3300012845 | Ga0160460_100165 | Ga0160460_10016555 | 247 |
| 69 | 3300012852 | Ga0160430_101262 | Ga0160430_1012623 | 247 |
| 70 | 3300012858 | Ga0160457_1001391 | Ga0160457_10013914 | 247 |
| 71 | 3300009784 | Ga0123357_10000375 | Ga0123357_1000037534 | 248 |
| 72 | 3300009784 | Ga0123357_10003925 | Ga0123357_1000392511 | 248 |
| 73 | 3300042596 | Ga0466696_097926 | Ga0466696_097926_439_1185 | 248 |
| 74 | 3300042612 | Ga0466705_179010 | Ga0466705_179010_2805_3551 | 248 |
| 75 | 3300042624 | Ga0466735_012596 | Ga0466735_012596_5890_6636 | 248 |
| 76 | 3300042635 | Ga0466702_158226 | Ga0466702_158226_116_862 | 248 |
| 77 | 3300042643 | Ga0466704_098030 | Ga0466704_098030_17316_18062 | 248 |
| 78 | 3300042655 | Ga0466727_235389 | Ga0466727_235389_17564_18310 | 248 |
| 79 | 3300009784 | Ga0123357_10000787 | Ga0123357_1000078714 | 249 |
| 80 | 3300010167 | Ga0123353_10001854 | Ga0123353_100018545 | 249 |
| 81 | 3300042550 | Ga0466656_287551 | Ga0466656_287551_181_930 | 249 |
| 82 | iso_pr_bacteria | 2820759988 | 2820761523 | 249 |
| 83 | 3300002509 | JGI24699J35502_11134035 | JGI24699J35502_111340358 | 250 |
| 84 | 3300010049 | Ga0123356_10572187 | Ga0123356_105721871 | 250 |
| 85 | 3300010049 | Ga0123356_11259456 | Ga0123356_112594561 | 250 |
| 86 | 3300010882 | Ga0123354_10111492 | Ga0123354_101114922 | 250 |
| 87 | 3300042611 | Ga0466697_133863 | Ga0466697_133863_4144_4896 | 250 |
| 88 | 3300002504 | JGI24705J35276_12235304 | JGI24705J35276_122353044 | 251 |
| 89 | 3300009784 | Ga0123357_10001231 | Ga0123357_1000123120 | 251 |
| 90 | 3300009784 | Ga0123357_10021213 | Ga0123357_100212132 | 251 |
| 91 | 3300009784 | Ga0123357_10042483 | Ga0123357_100424832 | 251 |
| 92 | 3300009784 | Ga0123357_10361347 | Ga0123357_103613472 | 251 |
| 93 | 3300010049 | Ga0123356_10591464 | Ga0123356_105914642 | 251 |
| 94 | 3300010882 | Ga0123354_10002122 | Ga0123354_1000212210 | 251 |
| 95 | 3300010882 | Ga0123354_10025889 | Ga0123354_100258897 | 251 |
| 96 | 3300010882 | Ga0123354_10036002 | Ga0123354_100360027 | 251 |
| 97 | 3300042600 | Ga0466700_058504 | Ga0466700_058504_15052_15807 | 251 |
| 98 | 3300042624 | Ga0466735_217611 | Ga0466735_217611_3913_4668 | 251 |
| 99 | 3300042599 | Ga0466706_143557 | Ga0466706_143557_1480_2268 | 252 |
| 100 | 3300042624 | Ga0466735_153385 | Ga0466735_153385_530_1288 | 252 |
| 101 | 3300005201 | Ga0072941_1097518 | Ga0072941_10975186 | 253 |
| 102 | 3300009784 | Ga0123357_10000572 | Ga0123357_1000057211 | 253 |
| 103 | 3300010049 | Ga0123356_10616686 | Ga0123356_106166862 | 253 |
| 104 | 3300010882 | Ga0123354_10188498 | Ga0123354_101884983 | 253 |
| 105 | 3300042601 | Ga0466707_220247 | Ga0466707_220247_2218_2979 | 253 |
| 106 | 3300010882 | Ga0123354_10048319 | Ga0123354_100483193 | 254 |
| 107 | 3300000062 | IMNBL1DRAFT_c0000757 | IMNBL1DRAFT_00007574 | 255 |
| 108 | 3300042609 | Ga0466722_109642 | Ga0466722_109642_3313_4083 | 256 |
| 109 | 3300042601 | Ga0466707_096168 | Ga0466707_096168_6910_7683 | 257 |
| 110 | 3300002509 | JGI24699J35502_11134138 | JGI24699J35502_111341388 | 259 |
| 111 | 3300010882 | Ga0123354_10000458 | Ga0123354_1000045830 | 259 |
| 112 | 3300010882 | Ga0123354_10010405 | Ga0123354_100104058 | 259 |
| 113 | 3300042601 | Ga0466707_008342 | Ga0466707_008342_10308_11096 | 262 |
| 114 | 3300042600 | Ga0466700_171688 | Ga0466700_171688_116_907 | 263 |
| 115 | 3300042624 | Ga0466735_002450 | Ga0466735_002450_5734_6525 | 263 |
| 116 | 3300042599 | Ga0466706_005779 | Ga0466706_005779_2149_2958 | 269 |
| 117 | 3300009826 | Ga0123355_10049442 | Ga0123355_100494426 | 285 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01255 | Prenyltransf | Putative undecaprenyl diphosphate synthase | 60 | 280 | 0.96 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01255 | GO:0016765 | transferase activity, transferring alkyl or aryl (other than methyl) groups | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.8 | 0.89 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.