Protein Family IF02364
Metagenome
Metatranscriptome
Isolate
141
Members
56
Samples
131
Scaffolds
245.11
Avg Length
Representative Sequence
- ID
- 3300009826|Ga0123355_10015438|Ga0123355_1001543815
- Length
- 246 aa
- Sequence
- MMLTNKKALVTGASRGIGKAIADLMIAEGAEVWGLDLREPEDLADRVAKAGGKLHWVAADLGSLAEVDAVVKGAIKAAEGFDILVNNAGITKDGLSFRMSLENWQKVIDVNLSAAFLISRTVGWDMVTRKRGGSIINMASVVGVHGNGGQANYSASKAGLVGITKSIAHEVADRSIRVNAIAPGFIESDMTAGLPQDVKDKMHGMIPFKRFGKPEDVANAALFLASDLSSYITGQVLPVDGGMFM*
Sample Types
Isolate
7.1%
Metagenome
92.2%
MAG
0.0%
Metatranscriptome
0.7%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
45.5%
Kalotermitidae
23.6%
Unclassified
20.0%
Termopsidae
5.5%
Rhinotermitidae
5.5%
Taxonomy
Archaea
0
Bacteria
132
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 2 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 3 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 4 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 5 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 6 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 7 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 8 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 9 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 10 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 11 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 12 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 13 | 2781125653 | Treponema sp. Emb289P1bin107 | Isolate | Unclassified |
| 14 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 15 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 16 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 17 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 18 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 19 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 20 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 21 | 3300021190 | Termite gut microbial communities from nest - French Guiana - 1_3 mRNA 1_3 mRNA SA | Metatranscriptome | Termitidae |
| 22 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 23 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 24 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 25 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 26 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 27 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 28 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 29 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 30 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 31 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 32 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 33 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 34 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 35 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 36 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 37 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 38 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 39 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 40 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 41 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 42 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 43 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 44 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 45 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 46 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 47 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 48 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 49 | 2781125639 | Treponema sp. Co191P1bin44 | Isolate | Unclassified |
| 50 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 51 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 52 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 53 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 54 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 55 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 56 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466727_351662 | 3300042655 | Bacteria | 1796 |
| 2 | JGI24698J34947_10081816 | 3300002449 | Unclassified | 1512 |
| 3 | Ga0072941_1003986 | 3300005201 | Bacteria | 11344 |
| 4 | Ga0123353_10064352 | 3300010167 | Bacteria | 5885 |
| 5 | Ga0466694_248422 | 3300042594 | Bacteria | 2283 |
| 6 | Ga0466712_149496 | 3300042614 | Bacteria | 1091 |
| 7 | Ga0466723_148232 | 3300042618 | Bacteria | 7514 |
| 8 | Ga0466728_134017 | 3300042620 | Bacteria | 5815 |
| 9 | Ga0466720_165176 | 3300042607 | Bacteria | 5153 |
| 10 | Ga0466705_096894 | 3300042612 | Bacteria | 5532 |
| 11 | AustNasuHG_c1003116 | 3300000089 | Bacteria | 5978 |
| 12 | JGI24695J34938_10001178 | 3300002450 | Bacteria | 23250 |
| 13 | JGI24695J34938_10011378 | 3300002450 | Unclassified | 4796 |
| 14 | JGI24695J34938_10016499 | 3300002450 | Bacteria | 3752 |
| 15 | JGI24695J34938_10038329 | 3300002450 | Unclassified | 2172 |
| 16 | Ga0072941_1001096 | 3300005201 | Bacteria | 35810 |
| 17 | Ga0466690_282429 | 3300042590 | Bacteria | 1972 |
| 18 | Ga0466692_015943 | 3300042591 | Bacteria | 3039 |
| 19 | Ga0466692_162986 | 3300042591 | Bacteria | 17124 |
| 20 | Ga0466696_187055 | 3300042596 | Bacteria | 5915 |
| 21 | Ga0466699_408802 | 3300042597 | Bacteria | 1737 |
| 22 | Ga0466704_449099 | 3300042643 | Bacteria | 67975 |
| 23 | Ga0466726_238307 | 3300042619 | Bacteria | 3631 |
| 24 | Ga0466729_126629 | 3300042621 | Bacteria | 1526 |
| 25 | Ga0466700_177832 | 3300042600 | Bacteria | 12822 |
| 26 | Ga0466698_151283 | 3300042610 | Bacteria | 1572 |
| 27 | Ga0466705_306326 | 3300042612 | Bacteria | 7918 |
| 28 | Ga0466733_113468 | 3300042659 | Bacteria | 3266 |
| 29 | AustNasuHG_c1000622 | 3300000089 | Bacteria | 12543 |
| 30 | JGI24698J34947_10045284 | 3300002449 | Unclassified | 2247 |
| 31 | JGI24699J35502_11126442 | 3300002509 | Bacteria | 3965 |
| 32 | Ga0072940_1050518 | 3300005200 | Bacteria | 4106 |
| 33 | Ga0123355_10028033 | 3300009826 | Bacteria | 9103 |
| 34 | Ga0123356_11244060 | 3300010049 | Bacteria | 909 |
| 35 | Ga0123353_10130445 | 3300010167 | Bacteria | 4034 |
| 36 | Ga0222431_1069803 | 3300021190 | Bacteria | 790 |
| 37 | Ga0466693_072518 | 3300042592 | Bacteria | 23712 |
| 38 | Ga0466693_154668 | 3300042592 | Bacteria | 13103 |
| 39 | Ga0466693_362068 | 3300042592 | Bacteria | 1749 |
| 40 | Ga0466727_129071 | 3300042655 | Bacteria | 5069 |
| 41 | Ga0466723_367506 | 3300042618 | Bacteria | 4967 |
| 42 | Ga0466726_330998 | 3300042619 | Bacteria | 2646 |
| 43 | Ga0466700_164356 | 3300042600 | Bacteria | 1630 |
| 44 | Ga0466707_165533 | 3300042601 | Bacteria | 1278 |
| 45 | Ga0466716_020630 | 3300042605 | Bacteria | 6725 |
| 46 | Ga0466720_067148 | 3300042607 | Bacteria | 1592 |
| 47 | Ga0466698_157763 | 3300042610 | Bacteria | 1121 |
| 48 | JGI24695J34938_10001456 | 3300002450 | Bacteria | 20021 |
| 49 | JGI24695J34938_10017438 | 3300002450 | Bacteria | 3617 |
| 50 | Ga0072941_1001094 | 3300005201 | Bacteria | 56271 |
| 51 | Ga0072941_1001417 | 3300005201 | Bacteria | 15868 |
| 52 | Ga0123355_10015438 | 3300009826 | Bacteria | 11999 |
| 53 | Ga0123353_10863522 | 3300010167 | Bacteria | 1238 |
| 54 | Ga0466699_046645 | 3300042597 | Bacteria | 8703 |
| 55 | Ga0466702_170133 | 3300042635 | Bacteria | 2854 |
| 56 | Ga0466702_356574 | 3300042635 | Bacteria | 1507 |
| 57 | Ga0466712_004217 | 3300042614 | Bacteria | 1629 |
| 58 | Ga0466718_008918 | 3300042617 | Bacteria | 1232 |
| 59 | Ga0466718_023965 | 3300042617 | Bacteria | 4949 |
| 60 | Ga0466723_132968 | 3300042618 | Bacteria | 3976 |
| 61 | Ga0466717_078892 | 3300042604 | Bacteria | 1680 |
| 62 | Ga0466733_023989 | 3300042659 | Bacteria | 3809 |
| 63 | JGI24698J34947_10067694 | 3300002449 | Bacteria | 1731 |
| 64 | JGI24698J34947_10081205 | 3300002449 | Bacteria | 1521 |
| 65 | Ga0072941_1020114 | 3300005201 | Bacteria | 2609 |
| 66 | Ga0123356_10878921 | 3300010049 | Bacteria | 1067 |
| 67 | Ga0123353_10266410 | 3300010167 | Bacteria | 2643 |
| 68 | Ga0123354_10097530 | 3300010882 | Bacteria | 4004 |
| 69 | Ga0466692_014314 | 3300042591 | Bacteria | 1265 |
| 70 | Ga0466692_081052 | 3300042591 | Bacteria | 4466 |
| 71 | Ga0466692_082537 | 3300042591 | Bacteria | 1338 |
| 72 | Ga0466691_032607 | 3300042593 | Bacteria | 2590 |
| 73 | Ga0466695_233981 | 3300042595 | Bacteria | 1084 |
| 74 | Ga0466695_234145 | 3300042595 | Bacteria | 1153 |
| 75 | Ga0466699_300060 | 3300042597 | Bacteria | 1470 |
| 76 | Ga0466699_350385 | 3300042597 | Bacteria | 1777 |
| 77 | Ga0466702_098000 | 3300042635 | Bacteria | 1054 |
| 78 | Ga0466708_136546 | 3300042652 | Bacteria | 7124 |
| 79 | Ga0466718_125806 | 3300042617 | Bacteria | 5322 |
| 80 | Ga0466723_251020 | 3300042618 | Bacteria | 1651 |
| 81 | Ga0466719_231157 | 3300042606 | Bacteria | 9568 |
| 82 | Ga0466698_476823 | 3300042610 | Bacteria | 1235 |
| 83 | Ga0466733_129461 | 3300042659 | Bacteria | 1482 |
| 84 | JGI24695J34938_10008614 | 3300002450 | Bacteria | 5797 |
| 85 | Ga0123355_10325663 | 3300009826 | Bacteria | 2065 |
| 86 | Ga0123356_10597256 | 3300010049 | Bacteria | 1268 |
| 87 | Ga0123356_11044447 | 3300010049 | Bacteria | 986 |
| 88 | Ga0466693_165273 | 3300042592 | Bacteria | 2158 |
| 89 | Ga0466691_002246 | 3300042593 | Bacteria | 7226 |
| 90 | Ga0466691_013193 | 3300042593 | Bacteria | 17542 |
| 91 | Ga0466694_356973 | 3300042594 | Bacteria | 2317 |
| 92 | Ga0466695_159245 | 3300042595 | Bacteria | 2797 |
| 93 | Ga0466699_139472 | 3300042597 | Bacteria | 7819 |
| 94 | Ga0466699_376859 | 3300042597 | Bacteria | 6271 |
| 95 | Ga0466702_402524 | 3300042635 | Bacteria | 6408 |
| 96 | Ga0466702_449443 | 3300042635 | Bacteria | 3920 |
| 97 | Ga0466709_288573 | 3300042648 | Bacteria | 6357 |
| 98 | Ga0466727_069892 | 3300042655 | Bacteria | 1739 |
| 99 | Ga0466711_241704 | 3300042615 | Bacteria | 15416 |
| 100 | Ga0466707_202753 | 3300042601 | Bacteria | 2649 |
| 101 | Ga0466717_021418 | 3300042604 | Bacteria | 1247 |
| 102 | JGI24698J34947_10183299 | 3300002449 | Unclassified | 835 |
| 103 | JGI24695J34938_10000721 | 3300002450 | Bacteria | 31222 |
| 104 | Ga0123354_10421741 | 3300010882 | Unclassified | 1108 |
| 105 | Ga0466693_330319 | 3300042592 | Bacteria | 2358 |
| 106 | Ga0466691_080571 | 3300042593 | Bacteria | 6481 |
| 107 | Ga0466699_079511 | 3300042597 | Bacteria | 5640 |
| 108 | Ga0466699_372967 | 3300042597 | Unclassified | 1111 |
| 109 | Ga0466735_090780 | 3300042624 | Bacteria | 1669 |
| 110 | Ga0466702_088021 | 3300042635 | Bacteria | 1772 |
| 111 | Ga0466702_241968 | 3300042635 | Bacteria | 34411 |
| 112 | Ga0466703_376983 | 3300042636 | Bacteria | 4632 |
| 113 | Ga0466708_267194 | 3300042652 | Bacteria | 2839 |
| 114 | Ga0466727_343278 | 3300042655 | Bacteria | 1152 |
| 115 | Ga0466711_271612 | 3300042615 | Bacteria | 10976 |
| 116 | Ga0466718_075007 | 3300042617 | Bacteria | 6551 |
| 117 | Ga0466707_102617 | 3300042601 | Bacteria | 1733 |
| 118 | Ga0466722_265261 | 3300042609 | Bacteria | 13661 |
| 119 | Ga0466705_184121 | 3300042612 | Bacteria | 2392 |
| 120 | JGI24698J34947_10073628 | 3300002449 | Unclassified | 1629 |
| 121 | JGI24702J35022_10184974 | 3300002462 | Bacteria | 1186 |
| 122 | Ga0072941_1040142 | 3300005201 | Bacteria | 5805 |
| 123 | Ga0123357_10027154 | 3300009784 | Bacteria | 7734 |
| 124 | Ga0415639_107201 | 3300038395 | Unclassified | 2053 |
| 125 | Ga0466696_436012 | 3300042596 | Bacteria | 28892 |
| 126 | Ga0466702_344967 | 3300042635 | Bacteria | 2587 |
| 127 | Ga0466704_231307 | 3300042643 | Bacteria | 3238 |
| 128 | Ga0466718_063670 | 3300042617 | Bacteria | 6259 |
| 129 | Ga0466718_084132 | 3300042617 | Bacteria | 1351 |
| 130 | Ga0466719_010868 | 3300042606 | Bacteria | 19922 |
| 131 | Ga0466698_413693 | 3300042610 | Bacteria | 1718 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300021190 | Ga0222431_1069803 | Ga0222431_10698031 | 228 |
| 2 | 3300042612 | Ga0466705_184121 | Ga0466705_184121_887_1636 | 240 |
| 3 | 3300042591 | Ga0466692_014314 | Ga0466692_014314_29_757 | 242 |
| 4 | 3300042601 | Ga0466707_102617 | Ga0466707_102617_208_936 | 242 |
| 5 | 3300042615 | Ga0466711_241704 | Ga0466711_241704_11559_12287 | 242 |
| 6 | 3300010167 | Ga0123353_10064352 | Ga0123353_100643528 | 243 |
| 7 | 3300010167 | Ga0123353_10863522 | Ga0123353_108635222 | 243 |
| 8 | 3300042619 | Ga0466726_330998 | Ga0466726_330998_1688_2419 | 243 |
| 9 | 3300042655 | Ga0466727_343278 | Ga0466727_343278_168_899 | 243 |
| 10 | 3300038395 | Ga0415639_107201 | Ga0415639_107201_365_1099 | 244 |
| 11 | 3300042590 | Ga0466690_282429 | Ga0466690_282429_871_1605 | 244 |
| 12 | 3300042591 | Ga0466692_015943 | Ga0466692_015943_1270_2004 | 244 |
| 13 | 3300042591 | Ga0466692_081052 | Ga0466692_081052_649_1383 | 244 |
| 14 | 3300042591 | Ga0466692_082537 | Ga0466692_082537_275_1009 | 244 |
| 15 | 3300042591 | Ga0466692_162986 | Ga0466692_162986_12239_12973 | 244 |
| 16 | 3300042592 | Ga0466693_072518 | Ga0466693_072518_19746_20480 | 244 |
| 17 | 3300042592 | Ga0466693_154668 | Ga0466693_154668_5905_6639 | 244 |
| 18 | 3300042592 | Ga0466693_165273 | Ga0466693_165273_1301_2035 | 244 |
| 19 | 3300042593 | Ga0466691_013193 | Ga0466691_013193_3824_4558 | 244 |
| 20 | 3300042593 | Ga0466691_032607 | Ga0466691_032607_1833_2567 | 244 |
| 21 | 3300042593 | Ga0466691_080571 | Ga0466691_080571_3673_4407 | 244 |
| 22 | 3300042594 | Ga0466694_248422 | Ga0466694_248422_1462_2196 | 244 |
| 23 | 3300042594 | Ga0466694_356973 | Ga0466694_356973_701_1435 | 244 |
| 24 | 3300042595 | Ga0466695_159245 | Ga0466695_159245_457_1191 | 244 |
| 25 | 3300042595 | Ga0466695_233981 | Ga0466695_233981_333_1067 | 244 |
| 26 | 3300042595 | Ga0466695_234145 | Ga0466695_234145_275_1009 | 244 |
| 27 | 3300042596 | Ga0466696_187055 | Ga0466696_187055_2510_3244 | 244 |
| 28 | 3300042596 | Ga0466696_436012 | Ga0466696_436012_25861_26595 | 244 |
| 29 | 3300042597 | Ga0466699_046645 | Ga0466699_046645_5017_5751 | 244 |
| 30 | 3300042597 | Ga0466699_079511 | Ga0466699_079511_4695_5429 | 244 |
| 31 | 3300042597 | Ga0466699_139472 | Ga0466699_139472_1812_2546 | 244 |
| 32 | 3300042597 | Ga0466699_300060 | Ga0466699_300060_429_1163 | 244 |
| 33 | 3300042597 | Ga0466699_350385 | Ga0466699_350385_257_991 | 244 |
| 34 | 3300042597 | Ga0466699_372967 | Ga0466699_372967_163_897 | 244 |
| 35 | 3300042597 | Ga0466699_376859 | Ga0466699_376859_4289_5023 | 244 |
| 36 | 3300042597 | Ga0466699_408802 | Ga0466699_408802_34_768 | 244 |
| 37 | 3300042600 | Ga0466700_164356 | Ga0466700_164356_383_1117 | 244 |
| 38 | 3300042600 | Ga0466700_177832 | Ga0466700_177832_1260_1994 | 244 |
| 39 | 3300042601 | Ga0466707_165533 | Ga0466707_165533_430_1164 | 244 |
| 40 | 3300042601 | Ga0466707_202753 | Ga0466707_202753_328_1062 | 244 |
| 41 | 3300042604 | Ga0466717_021418 | Ga0466717_021418_472_1206 | 244 |
| 42 | 3300042604 | Ga0466717_078892 | Ga0466717_078892_400_1134 | 244 |
| 43 | 3300042606 | Ga0466719_010868 | Ga0466719_010868_15359_16093 | 244 |
| 44 | 3300042606 | Ga0466719_231157 | Ga0466719_231157_7603_8337 | 244 |
| 45 | 3300042607 | Ga0466720_067148 | Ga0466720_067148_304_1038 | 244 |
| 46 | 3300042607 | Ga0466720_165176 | Ga0466720_165176_2687_3421 | 244 |
| 47 | 3300042609 | Ga0466722_265261 | Ga0466722_265261_12809_13543 | 244 |
| 48 | 3300042610 | Ga0466698_151283 | Ga0466698_151283_335_1069 | 244 |
| 49 | 3300042610 | Ga0466698_157763 | Ga0466698_157763_67_801 | 244 |
| 50 | 3300042610 | Ga0466698_413693 | Ga0466698_413693_273_1007 | 244 |
| 51 | 3300042610 | Ga0466698_476823 | Ga0466698_476823_57_791 | 244 |
| 52 | 3300042612 | Ga0466705_306326 | Ga0466705_306326_408_1142 | 244 |
| 53 | 3300042614 | Ga0466712_004217 | Ga0466712_004217_209_943 | 244 |
| 54 | 3300042614 | Ga0466712_149496 | Ga0466712_149496_141_875 | 244 |
| 55 | 3300042615 | Ga0466711_271612 | Ga0466711_271612_7792_8526 | 244 |
| 56 | 3300042617 | Ga0466718_008918 | Ga0466718_008918_436_1170 | 244 |
| 57 | 3300042617 | Ga0466718_023965 | Ga0466718_023965_381_1115 | 244 |
| 58 | 3300042617 | Ga0466718_063670 | Ga0466718_063670_2813_3547 | 244 |
| 59 | 3300042617 | Ga0466718_075007 | Ga0466718_075007_1540_2274 | 244 |
| 60 | 3300042617 | Ga0466718_084132 | Ga0466718_084132_104_838 | 244 |
| 61 | 3300042617 | Ga0466718_125806 | Ga0466718_125806_193_927 | 244 |
| 62 | 3300042618 | Ga0466723_132968 | Ga0466723_132968_112_846 | 244 |
| 63 | 3300042618 | Ga0466723_148232 | Ga0466723_148232_2305_3039 | 244 |
| 64 | 3300042618 | Ga0466723_251020 | Ga0466723_251020_122_856 | 244 |
| 65 | 3300042618 | Ga0466723_367506 | Ga0466723_367506_1167_1901 | 244 |
| 66 | 3300042619 | Ga0466726_238307 | Ga0466726_238307_2880_3614 | 244 |
| 67 | 3300042620 | Ga0466728_134017 | Ga0466728_134017_3083_3817 | 244 |
| 68 | 3300042621 | Ga0466729_126629 | Ga0466729_126629_52_786 | 244 |
| 69 | 3300042624 | Ga0466735_090780 | Ga0466735_090780_613_1347 | 244 |
| 70 | 3300042635 | Ga0466702_088021 | Ga0466702_088021_418_1152 | 244 |
| 71 | 3300042635 | Ga0466702_098000 | Ga0466702_098000_143_877 | 244 |
| 72 | 3300042635 | Ga0466702_170133 | Ga0466702_170133_1083_1817 | 244 |
| 73 | 3300042635 | Ga0466702_241968 | Ga0466702_241968_20269_21003 | 244 |
| 74 | 3300042635 | Ga0466702_356574 | Ga0466702_356574_357_1091 | 244 |
| 75 | 3300042635 | Ga0466702_402524 | Ga0466702_402524_3013_3747 | 244 |
| 76 | 3300042636 | Ga0466703_376983 | Ga0466703_376983_2392_3126 | 244 |
| 77 | 3300042648 | Ga0466709_288573 | Ga0466709_288573_3529_4263 | 244 |
| 78 | 3300042652 | Ga0466708_136546 | Ga0466708_136546_2781_3515 | 244 |
| 79 | 3300042655 | Ga0466727_351662 | Ga0466727_351662_197_931 | 244 |
| 80 | 3300042659 | Ga0466733_129461 | Ga0466733_129461_180_914 | 244 |
| 81 | iso_pr_bacteria | 2772190978 | 2773731032 | 244 |
| 82 | iso_pr_bacteria | 2781125631 | 2781268925 | 244 |
| 83 | iso_pr_bacteria | 2781125636 | 2781280636 | 244 |
| 84 | iso_pr_bacteria | 2781125639 | 2781285382 | 244 |
| 85 | iso_pr_bacteria | 2781125653 | 2781313252 | 244 |
| 86 | iso_pr_bacteria | 2781125681 | 2781406618 | 244 |
| 87 | iso_pr_bacteria | 2781125687 | 2781421245 | 244 |
| 88 | iso_pr_bacteria | 2781125689 | 2781425508 | 244 |
| 89 | iso_pr_bacteria | 2781125692 | 2781432175 | 244 |
| 90 | iso_pr_bacteria | 2781125693 | 2781434695 | 244 |
| 91 | 3300000089 | AustNasuHG_c1000622 | AustNasuHG_10006227 | 245 |
| 92 | 3300000089 | AustNasuHG_c1003116 | AustNasuHG_10031165 | 245 |
| 93 | 3300002449 | JGI24698J34947_10045284 | JGI24698J34947_100452842 | 245 |
| 94 | 3300002449 | JGI24698J34947_10067694 | JGI24698J34947_100676942 | 245 |
| 95 | 3300002449 | JGI24698J34947_10073628 | JGI24698J34947_100736282 | 245 |
| 96 | 3300002449 | JGI24698J34947_10081205 | JGI24698J34947_100812052 | 245 |
| 97 | 3300002449 | JGI24698J34947_10081816 | JGI24698J34947_100818162 | 245 |
| 98 | 3300002449 | JGI24698J34947_10183299 | JGI24698J34947_101832991 | 245 |
| 99 | 3300002450 | JGI24695J34938_10000721 | JGI24695J34938_1000072118 | 245 |
| 100 | 3300002450 | JGI24695J34938_10001178 | JGI24695J34938_1000117815 | 245 |
| 101 | 3300002450 | JGI24695J34938_10008614 | JGI24695J34938_100086142 | 245 |
| 102 | 3300002450 | JGI24695J34938_10011378 | JGI24695J34938_100113784 | 245 |
| 103 | 3300002450 | JGI24695J34938_10016499 | JGI24695J34938_100164993 | 245 |
| 104 | 3300002450 | JGI24695J34938_10017438 | JGI24695J34938_100174384 | 245 |
| 105 | 3300002450 | JGI24695J34938_10038329 | JGI24695J34938_100383292 | 245 |
| 106 | 3300002462 | JGI24702J35022_10184974 | JGI24702J35022_101849742 | 245 |
| 107 | 3300002509 | JGI24699J35502_11126442 | JGI24699J35502_111264423 | 245 |
| 108 | 3300005200 | Ga0072940_1050518 | Ga0072940_10505181 | 245 |
| 109 | 3300005201 | Ga0072941_1001094 | Ga0072941_100109450 | 245 |
| 110 | 3300005201 | Ga0072941_1001096 | Ga0072941_10010968 | 245 |
| 111 | 3300005201 | Ga0072941_1001417 | Ga0072941_100141710 | 245 |
| 112 | 3300005201 | Ga0072941_1003986 | Ga0072941_10039865 | 245 |
| 113 | 3300005201 | Ga0072941_1020114 | Ga0072941_10201143 | 245 |
| 114 | 3300005201 | Ga0072941_1040142 | Ga0072941_10401425 | 245 |
| 115 | 3300009826 | Ga0123355_10028033 | Ga0123355_100280335 | 245 |
| 116 | 3300009826 | Ga0123355_10325663 | Ga0123355_103256632 | 245 |
| 117 | 3300010049 | Ga0123356_10597256 | Ga0123356_105972562 | 245 |
| 118 | 3300010049 | Ga0123356_10878921 | Ga0123356_108789211 | 245 |
| 119 | 3300010049 | Ga0123356_11044447 | Ga0123356_110444472 | 245 |
| 120 | 3300010049 | Ga0123356_11244060 | Ga0123356_112440602 | 245 |
| 121 | 3300010167 | Ga0123353_10130445 | Ga0123353_101304452 | 245 |
| 122 | 3300010882 | Ga0123354_10097530 | Ga0123354_100975302 | 245 |
| 123 | 3300010882 | Ga0123354_10421741 | Ga0123354_104217412 | 245 |
| 124 | 3300042592 | Ga0466693_330319 | Ga0466693_330319_1312_2049 | 245 |
| 125 | 3300002450 | JGI24695J34938_10001456 | JGI24695J34938_1000145610 | 246 |
| 126 | 3300009826 | Ga0123355_10015438 | Ga0123355_1001543815 | 246 |
| 127 | 3300010167 | Ga0123353_10266410 | Ga0123353_102664102 | 246 |
| 128 | 3300042635 | Ga0466702_449443 | Ga0466702_449443_3017_3757 | 246 |
| 129 | 3300042655 | Ga0466727_069892 | Ga0466727_069892_489_1229 | 246 |
| 130 | 3300042655 | Ga0466727_129071 | Ga0466727_129071_262_1002 | 246 |
| 131 | 3300042612 | Ga0466705_096894 | Ga0466705_096894_3150_3893 | 247 |
| 132 | 3300042643 | Ga0466704_231307 | Ga0466704_231307_918_1661 | 247 |
| 133 | 3300042643 | Ga0466704_449099 | Ga0466704_449099_53504_54247 | 247 |
| 134 | 3300042593 | Ga0466691_002246 | Ga0466691_002246_3255_4004 | 249 |
| 135 | 3300042652 | Ga0466708_267194 | Ga0466708_267194_1725_2474 | 249 |
| 136 | 3300009784 | Ga0123357_10027154 | Ga0123357_100271548 | 250 |
| 137 | 3300042659 | Ga0466733_113468 | Ga0466733_113468_721_1476 | 251 |
| 138 | 3300042605 | Ga0466716_020630 | Ga0466716_020630_5210_5968 | 252 |
| 139 | 3300042635 | Ga0466702_344967 | Ga0466702_344967_1611_2372 | 253 |
| 140 | 3300042659 | Ga0466733_023989 | Ga0466733_023989_1588_2442 | 284 |
| 141 | 3300042592 | Ga0466693_362068 | Ga0466693_362068_67_957 | 296 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.95 | 0.95 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.