Protein Family IF02364

Metagenome Metatranscriptome Isolate
141 Members
56 Samples
131 Scaffolds
245.11 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10015438|Ga0123355_1001543815
Length
246 aa
Sequence
MMLTNKKALVTGASRGIGKAIADLMIAEGAEVWGLDLREPEDLADRVAKAGGKLHWVAADLGSLAEVDAVVKGAIKAAEGFDILVNNAGITKDGLSFRMSLENWQKVIDVNLSAAFLISRTVGWDMVTRKRGGSIINMASVVGVHGNGGQANYSASKAGLVGITKSIAHEVADRSIRVNAIAPGFIESDMTAGLPQDVKDKMHGMIPFKRFGKPEDVANAALFLASDLSSYITGQVLPVDGGMFM*

πŸ“Š Sample Types

Isolate 7.1%
Metagenome 92.2%
MAG 0.0%
Metatranscriptome 0.7%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 45.5%
Kalotermitidae 23.6%
Unclassified 20.0%
Termopsidae 5.5%
Rhinotermitidae 5.5%

🌳 Taxonomy

Archaea 0
Bacteria 132
Eukaryota 0
Viruses 0
Unclassified 9

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
2 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
3 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
4 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
5 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
6 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
7 2781125681 Treponema sp. Lab288P1bin11 Isolate Unclassified
8 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
9 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
10 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
11 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
12 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
13 2781125653 Treponema sp. Emb289P1bin107 Isolate Unclassified
14 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
15 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
16 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
17 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
18 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
19 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
20 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
21 3300021190 Termite gut microbial communities from nest - French Guiana - 1_3 mRNA 1_3 mRNA SA Metatranscriptome Termitidae
22 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
23 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
24 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
25 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
26 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
27 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
28 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
29 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
30 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
31 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
32 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
33 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
34 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
35 2772190978 Treponema sp. Nt197P3bin57 Isolate Unclassified
36 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
37 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
38 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
39 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
40 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
41 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
42 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
43 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
44 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
45 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
46 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
47 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
48 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
49 2781125639 Treponema sp. Co191P1bin44 Isolate Unclassified
50 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
51 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
52 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
53 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
54 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
55 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
56 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466727_351662 3300042655 Bacteria 1796
2 JGI24698J34947_10081816 3300002449 Unclassified 1512
3 Ga0072941_1003986 3300005201 Bacteria 11344
4 Ga0123353_10064352 3300010167 Bacteria 5885
5 Ga0466694_248422 3300042594 Bacteria 2283
6 Ga0466712_149496 3300042614 Bacteria 1091
7 Ga0466723_148232 3300042618 Bacteria 7514
8 Ga0466728_134017 3300042620 Bacteria 5815
9 Ga0466720_165176 3300042607 Bacteria 5153
10 Ga0466705_096894 3300042612 Bacteria 5532
11 AustNasuHG_c1003116 3300000089 Bacteria 5978
12 JGI24695J34938_10001178 3300002450 Bacteria 23250
13 JGI24695J34938_10011378 3300002450 Unclassified 4796
14 JGI24695J34938_10016499 3300002450 Bacteria 3752
15 JGI24695J34938_10038329 3300002450 Unclassified 2172
16 Ga0072941_1001096 3300005201 Bacteria 35810
17 Ga0466690_282429 3300042590 Bacteria 1972
18 Ga0466692_015943 3300042591 Bacteria 3039
19 Ga0466692_162986 3300042591 Bacteria 17124
20 Ga0466696_187055 3300042596 Bacteria 5915
21 Ga0466699_408802 3300042597 Bacteria 1737
22 Ga0466704_449099 3300042643 Bacteria 67975
23 Ga0466726_238307 3300042619 Bacteria 3631
24 Ga0466729_126629 3300042621 Bacteria 1526
25 Ga0466700_177832 3300042600 Bacteria 12822
26 Ga0466698_151283 3300042610 Bacteria 1572
27 Ga0466705_306326 3300042612 Bacteria 7918
28 Ga0466733_113468 3300042659 Bacteria 3266
29 AustNasuHG_c1000622 3300000089 Bacteria 12543
30 JGI24698J34947_10045284 3300002449 Unclassified 2247
31 JGI24699J35502_11126442 3300002509 Bacteria 3965
32 Ga0072940_1050518 3300005200 Bacteria 4106
33 Ga0123355_10028033 3300009826 Bacteria 9103
34 Ga0123356_11244060 3300010049 Bacteria 909
35 Ga0123353_10130445 3300010167 Bacteria 4034
36 Ga0222431_1069803 3300021190 Bacteria 790
37 Ga0466693_072518 3300042592 Bacteria 23712
38 Ga0466693_154668 3300042592 Bacteria 13103
39 Ga0466693_362068 3300042592 Bacteria 1749
40 Ga0466727_129071 3300042655 Bacteria 5069
41 Ga0466723_367506 3300042618 Bacteria 4967
42 Ga0466726_330998 3300042619 Bacteria 2646
43 Ga0466700_164356 3300042600 Bacteria 1630
44 Ga0466707_165533 3300042601 Bacteria 1278
45 Ga0466716_020630 3300042605 Bacteria 6725
46 Ga0466720_067148 3300042607 Bacteria 1592
47 Ga0466698_157763 3300042610 Bacteria 1121
48 JGI24695J34938_10001456 3300002450 Bacteria 20021
49 JGI24695J34938_10017438 3300002450 Bacteria 3617
50 Ga0072941_1001094 3300005201 Bacteria 56271
51 Ga0072941_1001417 3300005201 Bacteria 15868
52 Ga0123355_10015438 3300009826 Bacteria 11999
53 Ga0123353_10863522 3300010167 Bacteria 1238
54 Ga0466699_046645 3300042597 Bacteria 8703
55 Ga0466702_170133 3300042635 Bacteria 2854
56 Ga0466702_356574 3300042635 Bacteria 1507
57 Ga0466712_004217 3300042614 Bacteria 1629
58 Ga0466718_008918 3300042617 Bacteria 1232
59 Ga0466718_023965 3300042617 Bacteria 4949
60 Ga0466723_132968 3300042618 Bacteria 3976
61 Ga0466717_078892 3300042604 Bacteria 1680
62 Ga0466733_023989 3300042659 Bacteria 3809
63 JGI24698J34947_10067694 3300002449 Bacteria 1731
64 JGI24698J34947_10081205 3300002449 Bacteria 1521
65 Ga0072941_1020114 3300005201 Bacteria 2609
66 Ga0123356_10878921 3300010049 Bacteria 1067
67 Ga0123353_10266410 3300010167 Bacteria 2643
68 Ga0123354_10097530 3300010882 Bacteria 4004
69 Ga0466692_014314 3300042591 Bacteria 1265
70 Ga0466692_081052 3300042591 Bacteria 4466
71 Ga0466692_082537 3300042591 Bacteria 1338
72 Ga0466691_032607 3300042593 Bacteria 2590
73 Ga0466695_233981 3300042595 Bacteria 1084
74 Ga0466695_234145 3300042595 Bacteria 1153
75 Ga0466699_300060 3300042597 Bacteria 1470
76 Ga0466699_350385 3300042597 Bacteria 1777
77 Ga0466702_098000 3300042635 Bacteria 1054
78 Ga0466708_136546 3300042652 Bacteria 7124
79 Ga0466718_125806 3300042617 Bacteria 5322
80 Ga0466723_251020 3300042618 Bacteria 1651
81 Ga0466719_231157 3300042606 Bacteria 9568
82 Ga0466698_476823 3300042610 Bacteria 1235
83 Ga0466733_129461 3300042659 Bacteria 1482
84 JGI24695J34938_10008614 3300002450 Bacteria 5797
85 Ga0123355_10325663 3300009826 Bacteria 2065
86 Ga0123356_10597256 3300010049 Bacteria 1268
87 Ga0123356_11044447 3300010049 Bacteria 986
88 Ga0466693_165273 3300042592 Bacteria 2158
89 Ga0466691_002246 3300042593 Bacteria 7226
90 Ga0466691_013193 3300042593 Bacteria 17542
91 Ga0466694_356973 3300042594 Bacteria 2317
92 Ga0466695_159245 3300042595 Bacteria 2797
93 Ga0466699_139472 3300042597 Bacteria 7819
94 Ga0466699_376859 3300042597 Bacteria 6271
95 Ga0466702_402524 3300042635 Bacteria 6408
96 Ga0466702_449443 3300042635 Bacteria 3920
97 Ga0466709_288573 3300042648 Bacteria 6357
98 Ga0466727_069892 3300042655 Bacteria 1739
99 Ga0466711_241704 3300042615 Bacteria 15416
100 Ga0466707_202753 3300042601 Bacteria 2649
101 Ga0466717_021418 3300042604 Bacteria 1247
102 JGI24698J34947_10183299 3300002449 Unclassified 835
103 JGI24695J34938_10000721 3300002450 Bacteria 31222
104 Ga0123354_10421741 3300010882 Unclassified 1108
105 Ga0466693_330319 3300042592 Bacteria 2358
106 Ga0466691_080571 3300042593 Bacteria 6481
107 Ga0466699_079511 3300042597 Bacteria 5640
108 Ga0466699_372967 3300042597 Unclassified 1111
109 Ga0466735_090780 3300042624 Bacteria 1669
110 Ga0466702_088021 3300042635 Bacteria 1772
111 Ga0466702_241968 3300042635 Bacteria 34411
112 Ga0466703_376983 3300042636 Bacteria 4632
113 Ga0466708_267194 3300042652 Bacteria 2839
114 Ga0466727_343278 3300042655 Bacteria 1152
115 Ga0466711_271612 3300042615 Bacteria 10976
116 Ga0466718_075007 3300042617 Bacteria 6551
117 Ga0466707_102617 3300042601 Bacteria 1733
118 Ga0466722_265261 3300042609 Bacteria 13661
119 Ga0466705_184121 3300042612 Bacteria 2392
120 JGI24698J34947_10073628 3300002449 Unclassified 1629
121 JGI24702J35022_10184974 3300002462 Bacteria 1186
122 Ga0072941_1040142 3300005201 Bacteria 5805
123 Ga0123357_10027154 3300009784 Bacteria 7734
124 Ga0415639_107201 3300038395 Unclassified 2053
125 Ga0466696_436012 3300042596 Bacteria 28892
126 Ga0466702_344967 3300042635 Bacteria 2587
127 Ga0466704_231307 3300042643 Bacteria 3238
128 Ga0466718_063670 3300042617 Bacteria 6259
129 Ga0466718_084132 3300042617 Bacteria 1351
130 Ga0466719_010868 3300042606 Bacteria 19922
131 Ga0466698_413693 3300042610 Bacteria 1718

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300021190 Ga0222431_1069803 Ga0222431_10698031 228
2 3300042612 Ga0466705_184121 Ga0466705_184121_887_1636 240
3 3300042591 Ga0466692_014314 Ga0466692_014314_29_757 242
4 3300042601 Ga0466707_102617 Ga0466707_102617_208_936 242
5 3300042615 Ga0466711_241704 Ga0466711_241704_11559_12287 242
6 3300010167 Ga0123353_10064352 Ga0123353_100643528 243
7 3300010167 Ga0123353_10863522 Ga0123353_108635222 243
8 3300042619 Ga0466726_330998 Ga0466726_330998_1688_2419 243
9 3300042655 Ga0466727_343278 Ga0466727_343278_168_899 243
10 3300038395 Ga0415639_107201 Ga0415639_107201_365_1099 244
11 3300042590 Ga0466690_282429 Ga0466690_282429_871_1605 244
12 3300042591 Ga0466692_015943 Ga0466692_015943_1270_2004 244
13 3300042591 Ga0466692_081052 Ga0466692_081052_649_1383 244
14 3300042591 Ga0466692_082537 Ga0466692_082537_275_1009 244
15 3300042591 Ga0466692_162986 Ga0466692_162986_12239_12973 244
16 3300042592 Ga0466693_072518 Ga0466693_072518_19746_20480 244
17 3300042592 Ga0466693_154668 Ga0466693_154668_5905_6639 244
18 3300042592 Ga0466693_165273 Ga0466693_165273_1301_2035 244
19 3300042593 Ga0466691_013193 Ga0466691_013193_3824_4558 244
20 3300042593 Ga0466691_032607 Ga0466691_032607_1833_2567 244
21 3300042593 Ga0466691_080571 Ga0466691_080571_3673_4407 244
22 3300042594 Ga0466694_248422 Ga0466694_248422_1462_2196 244
23 3300042594 Ga0466694_356973 Ga0466694_356973_701_1435 244
24 3300042595 Ga0466695_159245 Ga0466695_159245_457_1191 244
25 3300042595 Ga0466695_233981 Ga0466695_233981_333_1067 244
26 3300042595 Ga0466695_234145 Ga0466695_234145_275_1009 244
27 3300042596 Ga0466696_187055 Ga0466696_187055_2510_3244 244
28 3300042596 Ga0466696_436012 Ga0466696_436012_25861_26595 244
29 3300042597 Ga0466699_046645 Ga0466699_046645_5017_5751 244
30 3300042597 Ga0466699_079511 Ga0466699_079511_4695_5429 244
31 3300042597 Ga0466699_139472 Ga0466699_139472_1812_2546 244
32 3300042597 Ga0466699_300060 Ga0466699_300060_429_1163 244
33 3300042597 Ga0466699_350385 Ga0466699_350385_257_991 244
34 3300042597 Ga0466699_372967 Ga0466699_372967_163_897 244
35 3300042597 Ga0466699_376859 Ga0466699_376859_4289_5023 244
36 3300042597 Ga0466699_408802 Ga0466699_408802_34_768 244
37 3300042600 Ga0466700_164356 Ga0466700_164356_383_1117 244
38 3300042600 Ga0466700_177832 Ga0466700_177832_1260_1994 244
39 3300042601 Ga0466707_165533 Ga0466707_165533_430_1164 244
40 3300042601 Ga0466707_202753 Ga0466707_202753_328_1062 244
41 3300042604 Ga0466717_021418 Ga0466717_021418_472_1206 244
42 3300042604 Ga0466717_078892 Ga0466717_078892_400_1134 244
43 3300042606 Ga0466719_010868 Ga0466719_010868_15359_16093 244
44 3300042606 Ga0466719_231157 Ga0466719_231157_7603_8337 244
45 3300042607 Ga0466720_067148 Ga0466720_067148_304_1038 244
46 3300042607 Ga0466720_165176 Ga0466720_165176_2687_3421 244
47 3300042609 Ga0466722_265261 Ga0466722_265261_12809_13543 244
48 3300042610 Ga0466698_151283 Ga0466698_151283_335_1069 244
49 3300042610 Ga0466698_157763 Ga0466698_157763_67_801 244
50 3300042610 Ga0466698_413693 Ga0466698_413693_273_1007 244
51 3300042610 Ga0466698_476823 Ga0466698_476823_57_791 244
52 3300042612 Ga0466705_306326 Ga0466705_306326_408_1142 244
53 3300042614 Ga0466712_004217 Ga0466712_004217_209_943 244
54 3300042614 Ga0466712_149496 Ga0466712_149496_141_875 244
55 3300042615 Ga0466711_271612 Ga0466711_271612_7792_8526 244
56 3300042617 Ga0466718_008918 Ga0466718_008918_436_1170 244
57 3300042617 Ga0466718_023965 Ga0466718_023965_381_1115 244
58 3300042617 Ga0466718_063670 Ga0466718_063670_2813_3547 244
59 3300042617 Ga0466718_075007 Ga0466718_075007_1540_2274 244
60 3300042617 Ga0466718_084132 Ga0466718_084132_104_838 244
61 3300042617 Ga0466718_125806 Ga0466718_125806_193_927 244
62 3300042618 Ga0466723_132968 Ga0466723_132968_112_846 244
63 3300042618 Ga0466723_148232 Ga0466723_148232_2305_3039 244
64 3300042618 Ga0466723_251020 Ga0466723_251020_122_856 244
65 3300042618 Ga0466723_367506 Ga0466723_367506_1167_1901 244
66 3300042619 Ga0466726_238307 Ga0466726_238307_2880_3614 244
67 3300042620 Ga0466728_134017 Ga0466728_134017_3083_3817 244
68 3300042621 Ga0466729_126629 Ga0466729_126629_52_786 244
69 3300042624 Ga0466735_090780 Ga0466735_090780_613_1347 244
70 3300042635 Ga0466702_088021 Ga0466702_088021_418_1152 244
71 3300042635 Ga0466702_098000 Ga0466702_098000_143_877 244
72 3300042635 Ga0466702_170133 Ga0466702_170133_1083_1817 244
73 3300042635 Ga0466702_241968 Ga0466702_241968_20269_21003 244
74 3300042635 Ga0466702_356574 Ga0466702_356574_357_1091 244
75 3300042635 Ga0466702_402524 Ga0466702_402524_3013_3747 244
76 3300042636 Ga0466703_376983 Ga0466703_376983_2392_3126 244
77 3300042648 Ga0466709_288573 Ga0466709_288573_3529_4263 244
78 3300042652 Ga0466708_136546 Ga0466708_136546_2781_3515 244
79 3300042655 Ga0466727_351662 Ga0466727_351662_197_931 244
80 3300042659 Ga0466733_129461 Ga0466733_129461_180_914 244
81 iso_pr_bacteria 2772190978 2773731032 244
82 iso_pr_bacteria 2781125631 2781268925 244
83 iso_pr_bacteria 2781125636 2781280636 244
84 iso_pr_bacteria 2781125639 2781285382 244
85 iso_pr_bacteria 2781125653 2781313252 244
86 iso_pr_bacteria 2781125681 2781406618 244
87 iso_pr_bacteria 2781125687 2781421245 244
88 iso_pr_bacteria 2781125689 2781425508 244
89 iso_pr_bacteria 2781125692 2781432175 244
90 iso_pr_bacteria 2781125693 2781434695 244
91 3300000089 AustNasuHG_c1000622 AustNasuHG_10006227 245
92 3300000089 AustNasuHG_c1003116 AustNasuHG_10031165 245
93 3300002449 JGI24698J34947_10045284 JGI24698J34947_100452842 245
94 3300002449 JGI24698J34947_10067694 JGI24698J34947_100676942 245
95 3300002449 JGI24698J34947_10073628 JGI24698J34947_100736282 245
96 3300002449 JGI24698J34947_10081205 JGI24698J34947_100812052 245
97 3300002449 JGI24698J34947_10081816 JGI24698J34947_100818162 245
98 3300002449 JGI24698J34947_10183299 JGI24698J34947_101832991 245
99 3300002450 JGI24695J34938_10000721 JGI24695J34938_1000072118 245
100 3300002450 JGI24695J34938_10001178 JGI24695J34938_1000117815 245
101 3300002450 JGI24695J34938_10008614 JGI24695J34938_100086142 245
102 3300002450 JGI24695J34938_10011378 JGI24695J34938_100113784 245
103 3300002450 JGI24695J34938_10016499 JGI24695J34938_100164993 245
104 3300002450 JGI24695J34938_10017438 JGI24695J34938_100174384 245
105 3300002450 JGI24695J34938_10038329 JGI24695J34938_100383292 245
106 3300002462 JGI24702J35022_10184974 JGI24702J35022_101849742 245
107 3300002509 JGI24699J35502_11126442 JGI24699J35502_111264423 245
108 3300005200 Ga0072940_1050518 Ga0072940_10505181 245
109 3300005201 Ga0072941_1001094 Ga0072941_100109450 245
110 3300005201 Ga0072941_1001096 Ga0072941_10010968 245
111 3300005201 Ga0072941_1001417 Ga0072941_100141710 245
112 3300005201 Ga0072941_1003986 Ga0072941_10039865 245
113 3300005201 Ga0072941_1020114 Ga0072941_10201143 245
114 3300005201 Ga0072941_1040142 Ga0072941_10401425 245
115 3300009826 Ga0123355_10028033 Ga0123355_100280335 245
116 3300009826 Ga0123355_10325663 Ga0123355_103256632 245
117 3300010049 Ga0123356_10597256 Ga0123356_105972562 245
118 3300010049 Ga0123356_10878921 Ga0123356_108789211 245
119 3300010049 Ga0123356_11044447 Ga0123356_110444472 245
120 3300010049 Ga0123356_11244060 Ga0123356_112440602 245
121 3300010167 Ga0123353_10130445 Ga0123353_101304452 245
122 3300010882 Ga0123354_10097530 Ga0123354_100975302 245
123 3300010882 Ga0123354_10421741 Ga0123354_104217412 245
124 3300042592 Ga0466693_330319 Ga0466693_330319_1312_2049 245
125 3300002450 JGI24695J34938_10001456 JGI24695J34938_1000145610 246
126 3300009826 Ga0123355_10015438 Ga0123355_1001543815 246
127 3300010167 Ga0123353_10266410 Ga0123353_102664102 246
128 3300042635 Ga0466702_449443 Ga0466702_449443_3017_3757 246
129 3300042655 Ga0466727_069892 Ga0466727_069892_489_1229 246
130 3300042655 Ga0466727_129071 Ga0466727_129071_262_1002 246
131 3300042612 Ga0466705_096894 Ga0466705_096894_3150_3893 247
132 3300042643 Ga0466704_231307 Ga0466704_231307_918_1661 247
133 3300042643 Ga0466704_449099 Ga0466704_449099_53504_54247 247
134 3300042593 Ga0466691_002246 Ga0466691_002246_3255_4004 249
135 3300042652 Ga0466708_267194 Ga0466708_267194_1725_2474 249
136 3300009784 Ga0123357_10027154 Ga0123357_100271548 250
137 3300042659 Ga0466733_113468 Ga0466733_113468_721_1476 251
138 3300042605 Ga0466716_020630 Ga0466716_020630_5210_5968 252
139 3300042635 Ga0466702_344967 Ga0466702_344967_1611_2372 253
140 3300042659 Ga0466733_023989 Ga0466733_023989_1588_2442 284
141 3300042592 Ga0466693_362068 Ga0466693_362068_67_957 296

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00106 adh_short short chain dehydrogenase 6 197 0.96
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 12 243 0.96
PF08659 KR KR domain 9 160 0.88

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.95 0.95 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.