Protein Family IF02336

Metagenome Isolate
150 Members
63 Samples
135 Scaffolds
245.77 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10004058|Ga0123355_1000405815
Length
272 aa
Sequence
MKQAQKFGGDWTVEKLNILSKKGGAEMRNTKIEWTDQTWNPVTGCTKLSTGCTHCYAEIMAKRLNAMGVYKYANGFTPTIHNNVLDEPLKWRNSHTVFVCSMADLFHDSVPFDFIDKVMSTIQQTKHHRYQILTKRAERMAEYFSQAEIPTNVWLGVTVESSSEKFRIDSLRRLQAAIRFISCEPLINDLEILDLEGIDWIIVGGESGVKARPMKPEWVRTIQQQAREQGVAFFFKQWGTWGSDGVKRNKKANGKALDGKIIQMMPQLAMR*

📊 Sample Types

Isolate 10.0%
Metagenome 90.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 47.5%
Unclassified 23.0%
Kalotermitidae 18.0%
Termopsidae 3.3%
Passalidae 3.3%
Rhinotermitidae 1.6%
Hodotermitidae 1.6%
Blattidae 1.6%

🌳 Taxonomy

Archaea 5
Bacteria 129
Eukaryota 0
Viruses 0
Unclassified 16

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2772190994 Unclassified Bathyarchaeota Lab288P3bin169 Isolate Unclassified
2 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
3 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
4 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
5 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
6 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
7 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
8 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
9 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
10 2820795054 Unclassified Bacteroidetes Cu122P1bin21 Isolate Unclassified
11 2820303403 Unclassified Firmicutes Th196P1bin2 Isolate Unclassified
12 2820590132 Unclassified Firmicutes Emb289P1bin84 Isolate Unclassified
13 2820654856 Unclassified Firmicutes Cu122P1bin2 Isolate Unclassified
14 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
15 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
16 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
17 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
18 2820495292 Unclassified Firmicutes Lab288P1bin59 Isolate Unclassified
19 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
20 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
21 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
22 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
23 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
24 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
25 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
26 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
27 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
28 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
29 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
30 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
31 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
32 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
33 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
34 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
35 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
36 2820533259 Unclassified Firmicutes Lab288P1bin140 Isolate Unclassified
37 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
38 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
39 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
40 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
41 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
42 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
43 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
44 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
45 2772190996 Unclassified Bathyarchaeota Lab288P4bin61 Isolate Unclassified
46 2773857682 Unclassified Methanosarcinaceae Lab288P3bin112 Isolate Unclassified
47 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
48 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
49 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
50 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
51 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
52 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
53 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
54 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
55 2820587002 Unclassified Firmicutes Emb289P1bin94 Isolate Unclassified
56 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
57 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
58 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
59 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
60 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
61 2778260940 Unclassified Fibrobacteres Mp193P3bin36 Isolate Unclassified
62 2820282995 Unclassified Firmicutes Th196P3bin147 Isolate Unclassified
63 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466711_266291 3300042615 Bacteria 103689
2 Ga0466711_368532 3300042615 Bacteria 2159
3 Ga0466715_265664 3300042616 Bacteria 19225
4 Ga0466723_080847 3300042618 Bacteria 56626
5 Ga0466723_191113 3300042618 Bacteria 4309
6 Ga0466706_108683 3300042599 Bacteria 5018
7 Ga0466706_130687 3300042599 Bacteria 1233
8 Ga0466720_051386 3300042607 Bacteria 6410
9 Ga0264413_110012 3300024493 Unclassified 2632
10 Ga0415639_194236 3300038395 Bacteria 1566
11 Ga0466693_257289 3300042592 Bacteria 2035
12 Ga0466696_293299 3300042596 Bacteria 2615
13 Ga0466699_340101 3300042597 Bacteria 7036
14 Ga0123357_10506564 3300009784 Bacteria 998
15 Ga0123356_10529036 3300010049 Unclassified 1338
16 Ga0123353_10000387 3300010167 Bacteria 53967
17 Ga0123353_10051884 3300010167 Bacteria 6546
18 Ga0466725_448120 3300042654 Bacteria 2510
19 JGI24698J34947_10005074 3300002449 Bacteria 7211
20 JGI24702J35022_10033740 3300002462 Bacteria 2737
21 JGI24702J35022_10095140 3300002462 Unclassified 1625
22 Ga0072941_1003715 3300005201 Bacteria 18866
23 Ga0072941_1085876 3300005201 Archaea 7088
24 Ga0466697_195584 3300042611 Unclassified 2597
25 Ga0466712_029655 3300042614 Bacteria 1274
26 Ga0466715_319657 3300042616 Bacteria 1862
27 Ga0466718_047982 3300042617 Bacteria 1918
28 Ga0466723_009288 3300042618 Bacteria 5643
29 Ga0466717_220920 3300042604 Unclassified 1098
30 Ga0466716_042851 3300042605 Bacteria 3011
31 Ga0466692_080399 3300042591 Bacteria 16023
32 Ga0123355_10047879 3300009826 Bacteria 6949
33 Ga0123355_10336782 3300009826 Bacteria 2014
34 Ga0123356_10279743 3300010049 Bacteria 1763
35 Ga0123356_11287012 3300010049 Bacteria 895
36 Ga0123353_10525927 3300010167 Bacteria 1714
37 Ga0123354_10000343 3300010882 Unclassified 43571
38 Ga0123354_10102711 3300010882 Bacteria 3850
39 Ga0466731_030101 3300042622 Bacteria 4028
40 Ga0466703_193358 3300042636 Bacteria 35327
41 Ga0466709_301568 3300042648 Bacteria 11872
42 2227307760 2225789004 Bacteria 1210
43 JGI24698J34947_10021801 3300002449 Bacteria 3442
44 Ga0466706_117702 3300042599 Bacteria 16236
45 Ga0466720_133386 3300042607 Bacteria 3656
46 Ga0466694_316199 3300042594 Bacteria 10269
47 Ga0123355_10008412 3300009826 Bacteria 15591
48 Ga0123355_10151495 3300009826 Bacteria 3522
49 Ga0123356_10189026 3300010049 Bacteria 2088
50 Ga0123356_10387898 3300010049 Bacteria 1531
51 Ga0466703_086265 3300042636 Bacteria 1261
52 Ga0466709_259893 3300042648 Bacteria 1359
53 Ga0466725_235291 3300042654 Bacteria 2082
54 Ga0466727_148952 3300042655 Bacteria 1590
55 IMNBL1DRAFT_c0015283 3300000062 Bacteria 3336
56 JGI24695J34938_10074669 3300002450 Unclassified 1410
57 JGI24700J35501_10930872 3300002508 Bacteria 31025
58 Ga0466705_364679 3300042612 Bacteria 32665
59 Ga0466732_278978 3300042656 Bacteria 14663
60 Ga0466712_130239 3300042614 Bacteria 4976
61 Ga0466711_360176 3300042615 Bacteria 4563
62 Ga0466728_367639 3300042620 Bacteria 1166
63 Ga0466697_012780 3300042611 Bacteria 11238
64 Ga0123355_10277580 3300009826 Bacteria 2318
65 Ga0123353_10000190 3300010167 Archaea 77793
66 Ga0123353_10382477 3300010167 Bacteria 2104
67 Ga0466735_129185 3300042624 Bacteria 2508
68 Ga0466703_035552 3300042636 Bacteria 5632
69 Ga0466703_111712 3300042636 Unclassified 3240
70 Ga0466703_279988 3300042636 Bacteria 4074
71 Ga0466703_410786 3300042636 Unclassified 2593
72 JGI24702J35022_10100855 3300002462 Bacteria 1580
73 JGI24702J35022_10118477 3300002462 Bacteria 1461
74 JGI24703J35330_11676238 3300002501 Unclassified 1769
75 Ga0072941_1213963 3300005201 Bacteria 4026
76 Ga0466715_557542 3300042616 Bacteria 2741
77 Ga0466723_314786 3300042618 Bacteria 14217
78 Ga0466720_184659 3300042607 Bacteria 1984
79 Ga0466696_253705 3300042596 Bacteria 2365
80 Ga0123357_10289217 3300009784 Bacteria 1677
81 Ga0123356_10478488 3300010049 Unclassified 1398
82 Ga0123356_10692056 3300010049 Bacteria 1188
83 Ga0123353_10043835 3300010167 Bacteria 7089
84 Ga0466704_365887 3300042643 Bacteria 1146
85 Ga0466727_045262 3300042655 Bacteria 17200
86 JGI24700J35501_10927361 3300002508 Bacteria 6769
87 JGI24696J40584_12842428 3300002834 Unclassified 958
88 Ga0466712_053205 3300042614 Bacteria 2876
89 Ga0466718_023251 3300042617 Bacteria 9935
90 Ga0466718_089300 3300042617 Bacteria 1469
91 Ga0466728_198399 3300042620 Bacteria 23860
92 Ga0466707_133640 3300042601 Bacteria 2193
93 Ga0466714_018500 3300042603 Bacteria 2565
94 Ga0466721_126958 3300042608 Bacteria 9090
95 Ga0466690_010902 3300042590 Bacteria 1217
96 Ga0123355_10073506 3300009826 Bacteria 5479
97 Ga0123355_10149603 3300009826 Bacteria 3550
98 Ga0466702_056448 3300042635 Bacteria 4854
99 AustNasuHG_c1002188 3300000089 Bacteria 7063
100 JGI24696J40584_12960309 3300002834 Bacteria 6878
101 Ga0466732_408115 3300042656 Unclassified 1189
102 Ga0466711_312037 3300042615 Bacteria 19125
103 Ga0466711_400267 3300042615 Bacteria 4656
104 Ga0466728_093313 3300042620 Bacteria 2732
105 Ga0264413_142239 3300024493 Bacteria 2052
106 Ga0466690_160604 3300042590 Bacteria 4774
107 Ga0466694_184018 3300042594 Bacteria 2415
108 Ga0466694_227114 3300042594 Bacteria 2225
109 Ga0466696_254441 3300042596 Bacteria 3940
110 Ga0123355_10004058 3300009826 Bacteria 21226
111 Ga0123353_10417439 3300010167 Bacteria 1990
112 Ga0466704_425760 3300042643 Unclassified 1813
113 JGI24698J34947_10012908 3300002449 Bacteria 4565
114 JGI24699J35502_11062413 3300002509 Unclassified 1754
115 Ga0072941_1063167 3300005201 Bacteria 11204
116 Ga0466697_141790 3300042611 Bacteria 2197
117 Ga0466705_103579 3300042612 Bacteria 1956
118 Ga0466718_002819 3300042617 Bacteria 3255
119 Ga0466700_259716 3300042600 Bacteria 3277
120 Ga0466714_033447 3300042603 Bacteria 1684
121 Ga0466717_014555 3300042604 Bacteria 26810
122 Ga0415639_025067 3300038395 Bacteria 2193
123 Ga0123355_10122283 3300009826 Bacteria 4034
124 Ga0123356_10081340 3300010049 Bacteria 3064
125 Ga0123356_10271845 3300010049 Bacteria 1785
126 Ga0123354_10602295 3300010882 Unclassified 804
127 Ga0466703_112455 3300042636 Bacteria 9603
128 Ga0466727_090492 3300042655 Bacteria 3587
129 IMNBL1DRAFT_c0007118 3300000062 Bacteria 5950
130 JGI24695J34938_10036069 3300002450 Bacteria 2257
131 JGI24702J35022_10012770 3300002462 Bacteria 4662
132 JGI24703J35330_11737844 3300002501 Bacteria 3146
133 JGI24700J35501_10930749 3300002508 Bacteria 21637
134 Ga0072941_1004402 3300005201 Bacteria 8458
135 Ga0072941_1048181 3300005201 Bacteria 7251

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010882 Ga0123354_10000343 Ga0123354_1000034332 213
2 3300042616 Ga0466715_319657 Ga0466715_319657_540_1199 219
3 3300042603 Ga0466714_033447 Ga0466714_033447_874_1605 236
4 3300042615 Ga0466711_266291 Ga0466711_266291_41871_42599 236
5 3300042611 Ga0466697_141790 Ga0466697_141790_228_962 237
6 3300010049 Ga0123356_10478488 Ga0123356_104784882 238
7 3300042648 Ga0466709_301568 Ga0466709_301568_606_1352 238
8 3300002834 JGI24696J40584_12842428 JGI24696J40584_128424282 241
9 3300024493 Ga0264413_110012 Ga0264413_1100122 241
10 3300042590 Ga0466690_160604 Ga0466690_160604_3406_4131 241
11 3300042592 Ga0466693_257289 Ga0466693_257289_1256_1981 241
12 3300042596 Ga0466696_254441 Ga0466696_254441_750_1475 241
13 3300042599 Ga0466706_108683 Ga0466706_108683_2488_3213 241
14 3300042599 Ga0466706_117702 Ga0466706_117702_14111_14836 241
15 3300042599 Ga0466706_130687 Ga0466706_130687_444_1169 241
16 3300042601 Ga0466707_133640 Ga0466707_133640_1284_2009 241
17 3300042607 Ga0466720_051386 Ga0466720_051386_186_911 241
18 3300042607 Ga0466720_184659 Ga0466720_184659_702_1427 241
19 3300042611 Ga0466697_012780 Ga0466697_012780_3307_4032 241
20 3300042614 Ga0466712_130239 Ga0466712_130239_2538_3263 241
21 3300042615 Ga0466711_360176 Ga0466711_360176_2918_3643 241
22 3300042615 Ga0466711_400267 Ga0466711_400267_483_1208 241
23 3300042617 Ga0466718_002819 Ga0466718_002819_837_1562 241
24 3300042617 Ga0466718_089300 Ga0466718_089300_460_1185 241
25 3300042618 Ga0466723_314786 Ga0466723_314786_809_1534 241
26 3300042620 Ga0466728_093313 Ga0466728_093313_548_1273 241
27 3300042636 Ga0466703_111712 Ga0466703_111712_183_908 241
28 3300042643 Ga0466704_365887 Ga0466704_365887_131_856 241
29 3300042655 Ga0466727_148952 Ga0466727_148952_501_1226 241
30 3300042656 Ga0466732_278978 Ga0466732_278978_1863_2588 241
31 3300000062 IMNBL1DRAFT_c0015283 IMNBL1DRAFT_00152832 242
32 3300000089 AustNasuHG_c1002188 AustNasuHG_10021886 242
33 3300002508 JGI24700J35501_10930749 JGI24700J35501_1093074931 242
34 3300002509 JGI24699J35502_11062413 JGI24699J35502_110624132 242
35 3300009784 Ga0123357_10506564 Ga0123357_105065642 242
36 3300009826 Ga0123355_10149603 Ga0123355_101496032 242
37 3300010049 Ga0123356_10692056 Ga0123356_106920562 242
38 3300010167 Ga0123353_10417439 Ga0123353_104174393 242
39 3300042594 Ga0466694_316199 Ga0466694_316199_6717_7445 242
40 iso_pr_bacteria 2778260940 2778357701 242
41 3300002449 JGI24698J34947_10012908 JGI24698J34947_100129084 243
42 3300024493 Ga0264413_142239 Ga0264413_1422393 243
43 3300042596 Ga0466696_253705 Ga0466696_253705_1431_2162 243
44 3300042603 Ga0466714_018500 Ga0466714_018500_641_1372 243
45 3300042607 Ga0466720_133386 Ga0466720_133386_1554_2285 243
46 3300042617 Ga0466718_047982 Ga0466718_047982_133_864 243
47 3300042636 Ga0466703_035552 Ga0466703_035552_4691_5422 243
48 3300042636 Ga0466703_086265 Ga0466703_086265_122_853 243
49 3300042656 Ga0466732_408115 Ga0466732_408115_362_1093 243
50 iso_pr_bacteria 2820303403 2820304227 243
51 3300000062 IMNBL1DRAFT_c0007118 IMNBL1DRAFT_00071184 244
52 3300002508 JGI24700J35501_10927361 JGI24700J35501_109273619 244
53 3300042612 Ga0466705_364679 Ga0466705_364679_24753_25487 244
54 3300042636 Ga0466703_410786 Ga0466703_410786_23_757 244
55 2225789004 2227307760 2227757640 245
56 3300010167 Ga0123353_10043835 Ga0123353_100438353 245
57 3300038395 Ga0415639_025067 Ga0415639_025067_169_906 245
58 3300038395 Ga0415639_194236 Ga0415639_194236_302_1039 245
59 3300042600 Ga0466700_259716 Ga0466700_259716_688_1425 245
60 3300042608 Ga0466721_126958 Ga0466721_126958_2729_3466 245
61 3300042614 Ga0466712_029655 Ga0466712_029655_292_1029 245
62 3300042614 Ga0466712_053205 Ga0466712_053205_1307_2044 245
63 3300042617 Ga0466718_023251 Ga0466718_023251_5015_5752 245
64 3300042622 Ga0466731_030101 Ga0466731_030101_1180_1917 245
65 3300042635 Ga0466702_056448 Ga0466702_056448_3670_4407 245
66 3300042643 Ga0466704_425760 Ga0466704_425760_170_907 245
67 3300042654 Ga0466725_235291 Ga0466725_235291_255_992 245
68 3300042654 Ga0466725_448120 Ga0466725_448120_1323_2060 245
69 3300042655 Ga0466727_090492 Ga0466727_090492_264_1001 245
70 iso_pr_bacteria 2820495292 2820497373 245
71 iso_pr_bacteria 2820587002 2820589777 245
72 iso_pr_bacteria 2820590132 2820590535 245
73 iso_pr_bacteria 2940195863 2940197243 245
74 iso_pu_archaea 2772190994 2773788186 245
75 iso_pu_archaea 2772190996 2773791349 245
76 iso_pu_archaea 2773857682 2774154265 245
77 3300002449 JGI24698J34947_10005074 JGI24698J34947_100050744 246
78 3300002449 JGI24698J34947_10021801 JGI24698J34947_100218012 246
79 3300002450 JGI24695J34938_10036069 JGI24695J34938_100360692 246
80 3300002450 JGI24695J34938_10074669 JGI24695J34938_100746693 246
81 3300002462 JGI24702J35022_10012770 JGI24702J35022_100127706 246
82 3300002462 JGI24702J35022_10033740 JGI24702J35022_100337402 246
83 3300002462 JGI24702J35022_10100855 JGI24702J35022_101008552 246
84 3300002501 JGI24703J35330_11676238 JGI24703J35330_116762382 246
85 3300002501 JGI24703J35330_11737844 JGI24703J35330_117378443 246
86 3300005201 Ga0072941_1003715 Ga0072941_100371518 246
87 3300005201 Ga0072941_1063167 Ga0072941_10631676 246
88 3300005201 Ga0072941_1085876 Ga0072941_10858765 246
89 3300005201 Ga0072941_1213963 Ga0072941_12139633 246
90 3300009784 Ga0123357_10289217 Ga0123357_102892171 246
91 3300009826 Ga0123355_10008412 Ga0123355_1000841217 246
92 3300009826 Ga0123355_10047879 Ga0123355_100478796 246
93 3300009826 Ga0123355_10073506 Ga0123355_100735062 246
94 3300009826 Ga0123355_10122283 Ga0123355_101222834 246
95 3300009826 Ga0123355_10151495 Ga0123355_101514954 246
96 3300009826 Ga0123355_10277580 Ga0123355_102775802 246
97 3300009826 Ga0123355_10336782 Ga0123355_103367822 246
98 3300010049 Ga0123356_10271845 Ga0123356_102718451 246
99 3300010049 Ga0123356_10279743 Ga0123356_102797432 246
100 3300010049 Ga0123356_10387898 Ga0123356_103878981 246
101 3300010167 Ga0123353_10000190 Ga0123353_1000019034 246
102 3300010167 Ga0123353_10382477 Ga0123353_103824771 246
103 3300010167 Ga0123353_10525927 Ga0123353_105259272 246
104 3300010882 Ga0123354_10602295 Ga0123354_106022951 246
105 3300042618 Ga0466723_009288 Ga0466723_009288_1694_2434 246
106 iso_pr_bacteria 2820533259 2820533314 246
107 3300002834 JGI24696J40584_12960309 JGI24696J40584_129603093 247
108 3300042594 Ga0466694_184018 Ga0466694_184018_416_1159 247
109 3300042594 Ga0466694_227114 Ga0466694_227114_215_958 247
110 3300042604 Ga0466717_014555 Ga0466717_014555_9113_9856 247
111 3300042612 Ga0466705_103579 Ga0466705_103579_1017_1760 247
112 3300042618 Ga0466723_191113 Ga0466723_191113_1047_1790 247
113 3300042648 Ga0466709_259893 Ga0466709_259893_411_1154 247
114 iso_pr_bacteria 2820282995 2820284247 247
115 3300002462 JGI24702J35022_10095140 JGI24702J35022_100951402 248
116 3300005201 Ga0072941_1048181 Ga0072941_10481813 248
117 3300010167 Ga0123353_10000387 Ga0123353_1000038724 248
118 3300042597 Ga0466699_340101 Ga0466699_340101_4018_4764 248
119 3300042636 Ga0466703_279988 Ga0466703_279988_1584_2330 248
120 iso_pr_bacteria 2820654856 2820657083 248
121 3300010049 Ga0123356_10081340 Ga0123356_100813402 249
122 3300010049 Ga0123356_10189026 Ga0123356_101890263 249
123 3300010882 Ga0123354_10102711 Ga0123354_101027113 249
124 3300042596 Ga0466696_293299 Ga0466696_293299_1754_2503 249
125 3300042604 Ga0466717_220920 Ga0466717_220920_35_784 249
126 3300042620 Ga0466728_367639 Ga0466728_367639_328_1077 249
127 iso_pr_bacteria 2820795054 2820795198 249
128 3300010167 Ga0123353_10051884 Ga0123353_100518843 250
129 3300042611 Ga0466697_195584 Ga0466697_195584_1547_2299 250
130 3300010049 Ga0123356_10529036 Ga0123356_105290362 251
131 3300010049 Ga0123356_11287012 Ga0123356_112870122 251
132 3300042591 Ga0466692_080399 Ga0466692_080399_10272_11027 251
133 3300042605 Ga0466716_042851 Ga0466716_042851_1879_2634 251
134 3300042624 Ga0466735_129185 Ga0466735_129185_1577_2332 251
135 3300042636 Ga0466703_112455 Ga0466703_112455_8219_8974 251
136 3300042636 Ga0466703_193358 Ga0466703_193358_1668_2426 252
137 3300042590 Ga0466690_010902 Ga0466690_010902_188_949 253
138 3300042616 Ga0466715_265664 Ga0466715_265664_17205_17966 253
139 3300042618 Ga0466723_080847 Ga0466723_080847_30788_31549 253
140 3300042655 Ga0466727_045262 Ga0466727_045262_15050_15811 253
141 3300042616 Ga0466715_557542 Ga0466715_557542_1483_2247 254
142 3300002462 JGI24702J35022_10118477 JGI24702J35022_101184772 255
143 3300005201 Ga0072941_1004402 Ga0072941_100440217 255
144 3300042615 Ga0466711_368532 Ga0466711_368532_701_1471 256
145 iso_pr_bacteria 2781125662 2781336666 257
146 3300042615 Ga0466711_312037 Ga0466711_312037_4873_5649 258
147 iso_pr_bacteria 2820303403 2820306129 265
148 3300002508 JGI24700J35501_10930872 JGI24700J35501_1093087228 266
149 3300009826 Ga0123355_10004058 Ga0123355_1000405815 272
150 3300042620 Ga0466728_198399 Ga0466728_198399_22660_23547 295

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF07505 DUF5131 Protein of unknown function (DUF5131) 29 266 0.99

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.84 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.