Protein Family IF02310

Metagenome Isolate
145 Members
70 Samples
122 Scaffolds
218.5 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10001570|Ga0123355_1000157021
Length
259 aa
Sequence
LGDIKKTSSAKIISAKADEQSCLSSDLSVQRTVMLEKRALHTESMVKEIIARRVAKELNDGDVVNLGIGLPTLVANYLPDGVKIILQSENGIMGMGPAPEKGKQNVDIVNAGAQYVTVNSGAMFFDSATSFGIIRGGHVDATILGALEIDEKGNLANWIVPGKMVPGMGGAMDLVVGAKKVIVAMQHTQKGEKKILKECTLPLTAVGVVDMIITEMGVMEVTDKGIVLTEKAKEITIDEIKAATGCELVISQNLKEME*

📊 Sample Types

Isolate 15.9%
Metagenome 84.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 36.2%
Unclassified 21.7%
Kalotermitidae 18.8%
Blattidae 5.8%
Termopsidae 4.3%
Rhinotermitidae 2.9%
Passalidae 2.9%
Hodotermitidae 1.4%
Alydidae 1.4%
Carabidae 1.4%
Scarabaeidae 1.4%
Tenebrionidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 140
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820776227 Unclassified Bacteroidetes Emb289P4bin3 Isolate Unclassified
2 2820593525 Unclassified Firmicutes Emb289P1bin7 Isolate Unclassified
3 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
4 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
5 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
6 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
7 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
8 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
9 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
10 2940218408 Enterococcus sp. PF1-24 Isolate Blattidae
11 2820746860 Unclassified Bacteroidetes Th196P3bin126 Isolate Unclassified
12 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
13 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
14 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
15 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
16 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
17 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
18 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
19 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
20 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
21 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
22 2531839005 Vibrio harveyi CAIM 1792 Isolate Unclassified
23 2593339125 Clostridium sp. 5 Isolate Termitidae
24 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
25 8024031916 Cupriavidus pauculus BHJ32i Isolate Alydidae
26 3004677695 Bacteroides sp. 214 Isolate Blattidae
27 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
28 2820768849 Unclassified Bacteroidetes Lab288P3bin194 Isolate Unclassified
29 2820774381 Unclassified Bacteroidetes Lab288P1bin37 Isolate Unclassified
30 2940228231 Anaerovoracaceae bacterium PM5-7 Isolate Blattidae
31 8004118532 Citrobacter amalonaticus ku-bf3 Isolate Carabidae
32 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
33 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
34 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
35 2820788205 Unclassified Bacteroidetes Emb289P1bin57 Isolate Unclassified
36 2908136803 Vibrio owensii 1700302 Isolate Unclassified
37 2590828840 Clostridium sp. 2 Isolate Termitidae
38 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
39 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
40 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
41 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
42 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
43 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
44 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
45 8001394582 Limnobaculum allomyrinae BWR-B9 Isolate Scarabaeidae
46 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
47 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
48 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
49 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
50 2518285522 Photorhabdus khanii NC19 Isolate Unclassified
51 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
52 3000861951 Budvicia diplopodorum D9 Isolate
53 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
54 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
55 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
56 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
57 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
58 2820786992 Unclassified Bacteroidetes Emb289P1bin66 Isolate Unclassified
59 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
60 2820282995 Unclassified Firmicutes Th196P3bin147 Isolate Unclassified
61 2820314258 Unclassified Firmicutes Nt197P4bin16 Isolate Unclassified
62 8042061949 Vibrio harveyi Hep-2a-10 Isolate Unclassified
63 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
64 2940261461 Enterococcus sp. PFB1-1 Isolate Blattidae
65 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
66 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
67 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
68 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
69 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
70 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_332135 3300042656 Bacteria 1341
2 Ga0466707_291876 3300042601 Bacteria 3725
3 Ga0466707_399987 3300042601 Bacteria 1764
4 Ga0466713_024227 3300042602 Bacteria 1708
5 Ga0466714_049478 3300042603 Bacteria 2458
6 Ga0466719_337163 3300042606 Bacteria 3703
7 Ga0466715_433640 3300042616 Bacteria 11950
8 Ga0466731_203332 3300042622 Bacteria 1113
9 Ga0466696_408175 3300042596 Bacteria 3354
10 Ga0466699_405756 3300042597 Bacteria 3148
11 Ga0466705_350878 3300042612 Bacteria 8060
12 Ga0466706_267989 3300042599 Bacteria 1044
13 Ga0466714_119698 3300042603 Bacteria 2416
14 Ga0466714_169727 3300042603 Bacteria 7046
15 Ga0466721_080342 3300042608 Bacteria 4392
16 Ga0466705_390569 3300042612 Bacteria 2181
17 Ga0466705_425951 3300042612 Bacteria 15257
18 Ga0466711_217679 3300042615 Bacteria 1086
19 Ga0466726_153365 3300042619 Bacteria 3047
20 Ga0123357_10273420 3300009784 Bacteria 1760
21 Ga0123355_10119877 3300009826 Bacteria 4085
22 Ga0123356_11340296 3300010049 Bacteria 878
23 Ga0123356_11565717 3300010049 Bacteria 815
24 Ga0466729_282327 3300042621 Bacteria 3728
25 Ga0466734_141441 3300042623 Bacteria 1358
26 Ga0466734_169842 3300042623 Bacteria 1060
27 Ga0466730_102285 3300042625 Bacteria 39481
28 Ga0466702_234745 3300042635 Bacteria 2454
29 Ga0466703_266802 3300042636 Bacteria 10136
30 Ga0415639_052275 3300038395 Bacteria 5257
31 Ga0466691_064539 3300042593 Bacteria 2603
32 Ga0466694_396391 3300042594 Bacteria 1080
33 JGI24702J35022_10004325 3300002462 Bacteria 8468
34 JGI24705J35276_12237959 3300002504 Bacteria 14516
35 Ga0068302_10037660 3300005071 Bacteria 10882
36 Ga0123357_10000360 3300009784 Bacteria 42873
37 Ga0466733_071235 3300042659 Bacteria 3308
38 Ga0466713_123108 3300042602 Bacteria 2390
39 Ga0466713_140012 3300042602 Bacteria 490520
40 Ga0466716_219287 3300042605 Bacteria 8607
41 Ga0466719_150934 3300042606 Bacteria 9151
42 Ga0466711_412975 3300042615 Bacteria 2877
43 Ga0466726_165594 3300042619 Bacteria 5884
44 Ga0123355_10001042 3300009826 Bacteria 38399
45 Ga0123355_10080736 3300009826 Bacteria 5191
46 Ga0123353_10190224 3300010167 Bacteria 3241
47 Ga0466708_046866 3300042652 Bacteria 9406
48 Ga0466691_062263 3300042593 Bacteria 2668
49 Ga0466705_199573 3300042612 Bacteria 3491
50 Ga0466733_056006 3300042659 Bacteria 19323
51 Ga0466710_080265 3300042613 Bacteria 2699
52 Ga0466711_096294 3300042615 Bacteria 4639
53 Ga0466726_358552 3300042619 Bacteria 5838
54 Ga0123355_10076251 3300009826 Bacteria 5363
55 Ga0123355_10138024 3300009826 Bacteria 3740
56 Ga0123353_10234044 3300010167 Bacteria 2861
57 Ga0466702_269421 3300042635 Unclassified 1269
58 Ga0415639_208455 3300038395 Bacteria 1417
59 Ga0466656_185926 3300042550 Bacteria 1060
60 2227458023 2225789004 Bacteria 1006
61 Ga0466705_272748 3300042612 Bacteria 3699
62 Ga0466707_026343 3300042601 Bacteria 15919
63 Ga0466713_020222 3300042602 Bacteria 24809
64 Ga0466713_026803 3300042602 Bacteria 64874
65 Ga0466705_521894 3300042612 Bacteria 138507
66 Ga0466710_246921 3300042613 Bacteria 13174
67 Ga0466728_447271 3300042620 Bacteria 1741
68 Ga0123356_10267156 3300010049 Bacteria 1798
69 Ga0466730_039143 3300042625 Bacteria 1680
70 Ga0466703_175891 3300042636 Bacteria 3167
71 IMNBL1DRAFT_c0002264 3300000062 Bacteria 13548
72 JGI24698J34947_10023958 3300002449 Unclassified 3262
73 JGI24705J35276_12231007 3300002504 Bacteria 3796
74 Ga0466732_062646 3300042656 Bacteria 2691
75 Ga0562379_0255 3300056790 Bacteria 140685
76 Ga0466716_162403 3300042605 Unclassified 2905
77 Ga0466719_395330 3300042606 Bacteria 8681
78 Ga0466719_398556 3300042606 Bacteria 2006
79 Ga0466715_367765 3300042616 Bacteria 5089
80 Ga0466726_186408 3300042619 Bacteria 3624
81 Ga0466728_088755 3300042620 Bacteria 2058
82 Ga0123355_10001570 3300009826 Bacteria 31898
83 Ga0123353_10649351 3300010167 Bacteria 1494
84 Ga0466727_208313 3300042655 Bacteria 1842
85 Ga0466691_028162 3300042593 Bacteria 2684
86 Ga0466707_306658 3300042601 Bacteria 1636
87 Ga0466711_122991 3300042615 Bacteria 1247
88 Ga0466715_134531 3300042616 Bacteria 1580
89 Ga0466715_378385 3300042616 Bacteria 9993
90 Ga0466726_478588 3300042619 Bacteria 1367
91 Ga0123355_10000009 3300009826 Bacteria 191038
92 Ga0123355_10000055 3300009826 Bacteria 117901
93 Ga0123355_10009158 3300009826 Bacteria 15018
94 Ga0123356_10213238 3300010049 Bacteria 1981
95 Ga0123353_10281907 3300010167 Bacteria 2551
96 Ga0466704_030462 3300042643 Bacteria 11144
97 Ga0466704_273038 3300042643 Bacteria 5025
98 Ga0466709_161179 3300042648 Bacteria 1853
99 Ga0466690_322279 3300042590 Bacteria 1161
100 Ga0466692_157688 3300042591 Bacteria 33019
101 Ga0466693_114810 3300042592 Bacteria 1453
102 Ga0466696_374762 3300042596 Bacteria 2274
103 Ga0072940_1295832 3300005200 Bacteria 1350
104 Ga0466705_197153 3300042612 Bacteria 5732
105 Ga0466732_006404 3300042656 Bacteria 5594
106 Ga0466732_275786 3300042656 Bacteria 18994
107 Ga0466706_136725 3300042599 Bacteria 9042
108 Ga0466714_015173 3300042603 Bacteria 4412
109 Ga0466716_275870 3300042605 Bacteria 1395
110 Ga0466712_320304 3300042614 Bacteria 3922
111 Ga0466711_152765 3300042615 Bacteria 20189
112 Ga0466711_213129 3300042615 Unclassified 3221
113 Ga0466715_179998 3300042616 Bacteria 6327
114 Ga0466728_368689 3300042620 Bacteria 30011
115 Ga0123356_10304444 3300010049 Unclassified 1700
116 Ga0123356_10562149 3300010049 Bacteria 1303
117 Ga0123353_10000005 3300010167 Bacteria 308504
118 Ga0123353_10211654 3300010167 Bacteria 3040
119 Ga0123353_10372428 3300010167 Bacteria 2140
120 Ga0123353_10899595 3300010167 Bacteria 1205
121 Ga0466708_296209 3300042652 Bacteria 7900
122 Ga0466690_211303 3300042590 Bacteria 10167

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042615 Ga0466711_213129 Ga0466711_213129_1743_2321 192
2 3300042648 Ga0466709_161179 Ga0466709_161179_31_639 202
3 3300042619 Ga0466726_153365 Ga0466726_153365_2237_2887 208
4 3300038395 Ga0415639_208455 Ga0415639_208455_544_1179 211
5 3300042612 Ga0466705_272748 Ga0466705_272748_2203_2853 211
6 3300042635 Ga0466702_269421 Ga0466702_269421_602_1237 211
7 iso_pr_bacteria 3004677695 3004679326 211
8 3300042590 Ga0466690_211303 Ga0466690_211303_3861_4499 212
9 3300042602 Ga0466713_026803 Ga0466713_026803_56402_57040 212
10 3300042602 Ga0466713_020222 Ga0466713_020222_7377_8018 213
11 3300042655 Ga0466727_208313 Ga0466727_208313_124_765 213
12 3300042643 Ga0466704_030462 Ga0466704_030462_9848_10492 214
13 3300042656 Ga0466732_062646 Ga0466732_062646_32_676 214
14 3300002449 JGI24698J34947_10023958 JGI24698J34947_100239582 215
15 3300005200 Ga0072940_1295832 Ga0072940_12958322 215
16 3300010167 Ga0123353_10372428 Ga0123353_103724282 215
17 3300042606 Ga0466719_337163 Ga0466719_337163_2805_3452 215
18 3300042613 Ga0466710_246921 Ga0466710_246921_5649_6296 215
19 3300042614 Ga0466712_320304 Ga0466712_320304_1409_2056 215
20 3300042616 Ga0466715_378385 Ga0466715_378385_6858_7505 215
21 3300042619 Ga0466726_165594 Ga0466726_165594_2677_3324 215
22 3300042622 Ga0466731_203332 Ga0466731_203332_100_747 215
23 3300038395 Ga0415639_052275 Ga0415639_052275_2220_2870 216
24 3300042590 Ga0466690_322279 Ga0466690_322279_115_765 216
25 3300042591 Ga0466692_157688 Ga0466692_157688_25354_26004 216
26 3300042592 Ga0466693_114810 Ga0466693_114810_34_684 216
27 3300042593 Ga0466691_064539 Ga0466691_064539_1376_2026 216
28 3300042596 Ga0466696_374762 Ga0466696_374762_650_1300 216
29 3300042602 Ga0466713_140012 Ga0466713_140012_180671_181321 216
30 3300042605 Ga0466716_219287 Ga0466716_219287_5625_6275 216
31 3300042612 Ga0466705_197153 Ga0466705_197153_4690_5340 216
32 3300042612 Ga0466705_199573 Ga0466705_199573_1535_2185 216
33 3300042612 Ga0466705_521894 Ga0466705_521894_119025_119675 216
34 3300042615 Ga0466711_152765 Ga0466711_152765_859_1509 216
35 3300042615 Ga0466711_217679 Ga0466711_217679_74_724 216
36 3300042620 Ga0466728_088755 Ga0466728_088755_697_1347 216
37 3300042621 Ga0466729_282327 Ga0466729_282327_2741_3391 216
38 3300042623 Ga0466734_141441 Ga0466734_141441_159_809 216
39 3300042623 Ga0466734_169842 Ga0466734_169842_258_908 216
40 3300042625 Ga0466730_102285 Ga0466730_102285_27478_28128 216
41 3300042635 Ga0466702_234745 Ga0466702_234745_593_1243 216
42 3300042636 Ga0466703_175891 Ga0466703_175891_1888_2538 216
43 3300042659 Ga0466733_071235 Ga0466733_071235_2296_2946 216
44 iso_pr_bacteria 2820314258 2820316122 216
45 iso_pr_bacteria 2820593525 2820594270 216
46 iso_pr_bacteria 8004118532 8004122599 216
47 3300002504 JGI24705J35276_12231007 JGI24705J35276_122310074 217
48 3300002504 JGI24705J35276_12237959 JGI24705J35276_122379593 217
49 3300009784 Ga0123357_10273420 Ga0123357_102734202 217
50 3300009826 Ga0123355_10138024 Ga0123355_101380242 217
51 3300010049 Ga0123356_10267156 Ga0123356_102671562 217
52 3300010049 Ga0123356_10304444 Ga0123356_103044443 217
53 3300010167 Ga0123353_10211654 Ga0123353_102116542 217
54 3300042606 Ga0466719_150934 Ga0466719_150934_7734_8387 217
55 3300042615 Ga0466711_096294 Ga0466711_096294_1504_2157 217
56 3300042619 Ga0466726_358552 Ga0466726_358552_2677_3330 217
57 3300042620 Ga0466728_368689 Ga0466728_368689_27438_28091 217
58 3300042620 Ga0466728_447271 Ga0466728_447271_436_1089 217
59 3300042652 Ga0466708_296209 Ga0466708_296209_2070_2723 217
60 iso_pr_bacteria 2940228231 2940229386 217
61 iso_pr_bacteria 8024031916 8024036079 217
62 2225789004 2227458023 2227893810 218
63 3300009826 Ga0123355_10076251 Ga0123355_100762513 218
64 3300009826 Ga0123355_10119877 Ga0123355_101198772 218
65 3300010049 Ga0123356_10562149 Ga0123356_105621492 218
66 3300042593 Ga0466691_062263 Ga0466691_062263_898_1554 218
67 3300042599 Ga0466706_267989 Ga0466706_267989_134_790 218
68 3300042601 Ga0466707_399987 Ga0466707_399987_381_1037 218
69 3300042602 Ga0466713_024227 Ga0466713_024227_743_1399 218
70 3300042602 Ga0466713_123108 Ga0466713_123108_350_1006 218
71 3300042606 Ga0466719_398556 Ga0466719_398556_1308_1964 218
72 3300042613 Ga0466710_080265 Ga0466710_080265_1694_2350 218
73 3300042615 Ga0466711_122991 Ga0466711_122991_148_804 218
74 3300042656 Ga0466732_332135 Ga0466732_332135_250_906 218
75 3300042659 Ga0466733_056006 Ga0466733_056006_12735_13391 218
76 3300056790 Ga0562379_0255 Ga0562379_0255_79290_79946 218
77 iso_pr_bacteria 2820768849 2820769178 218
78 iso_pr_bacteria 2820774381 2820776021 218
79 3300000062 IMNBL1DRAFT_c0002264 IMNBL1DRAFT_00022642 219
80 3300010049 Ga0123356_11340296 Ga0123356_113402961 219
81 3300010049 Ga0123356_11565717 Ga0123356_115657171 219
82 3300010167 Ga0123353_10000005 Ga0123353_1000000522 219
83 3300010167 Ga0123353_10234044 Ga0123353_102340442 219
84 3300010167 Ga0123353_10281907 Ga0123353_102819072 219
85 3300042550 Ga0466656_185926 Ga0466656_185926_247_906 219
86 3300042593 Ga0466691_028162 Ga0466691_028162_17_676 219
87 3300042596 Ga0466696_408175 Ga0466696_408175_313_972 219
88 3300042597 Ga0466699_405756 Ga0466699_405756_673_1332 219
89 3300042599 Ga0466706_136725 Ga0466706_136725_4802_5461 219
90 3300042603 Ga0466714_015173 Ga0466714_015173_2819_3478 219
91 3300042603 Ga0466714_169727 Ga0466714_169727_6245_6904 219
92 3300042605 Ga0466716_275870 Ga0466716_275870_445_1104 219
93 3300042608 Ga0466721_080342 Ga0466721_080342_3572_4231 219
94 3300042612 Ga0466705_350878 Ga0466705_350878_173_832 219
95 3300042612 Ga0466705_390569 Ga0466705_390569_938_1597 219
96 3300042612 Ga0466705_425951 Ga0466705_425951_4733_5392 219
97 3300042615 Ga0466711_412975 Ga0466711_412975_1365_2024 219
98 3300042616 Ga0466715_367765 Ga0466715_367765_2236_2895 219
99 3300042616 Ga0466715_433640 Ga0466715_433640_9186_9845 219
100 3300042643 Ga0466704_273038 Ga0466704_273038_1505_2164 219
101 3300042656 Ga0466732_006404 Ga0466732_006404_3577_4236 219
102 iso_pr_bacteria 2820282995 2820283788 219
103 iso_pr_bacteria 2820746860 2820748885 219
104 iso_pr_bacteria 2820776227 2820776516 219
105 iso_pr_bacteria 2820786992 2820787095 219
106 iso_pr_bacteria 2820788205 2820788468 219
107 iso_pr_bacteria 2940218408 2940220221 219
108 iso_pr_bacteria 2940261461 2940263234 219
109 3300002462 JGI24702J35022_10004325 JGI24702J35022_100043257 220
110 3300009784 Ga0123357_10000360 Ga0123357_100003608 220
111 3300009826 Ga0123355_10000055 Ga0123355_1000005542 220
112 3300009826 Ga0123355_10009158 Ga0123355_1000915814 220
113 3300009826 Ga0123355_10080736 Ga0123355_100807364 220
114 3300010049 Ga0123356_10213238 Ga0123356_102132382 220
115 3300010167 Ga0123353_10649351 Ga0123353_106493512 220
116 3300010167 Ga0123353_10899595 Ga0123353_108995952 220
117 3300009826 Ga0123355_10000009 Ga0123355_10000009117 221
118 3300042594 Ga0466694_396391 Ga0466694_396391_200_865 221
119 3300042603 Ga0466714_049478 Ga0466714_049478_1551_2216 221
120 3300042603 Ga0466714_119698 Ga0466714_119698_579_1244 221
121 3300042656 Ga0466732_275786 Ga0466732_275786_12340_13005 221
122 iso_pr_bacteria 2518285522 2518342476 221
123 iso_pr_bacteria 2590828840 2593255908 221
124 iso_pr_bacteria 2593339125 2595066817 221
125 iso_pr_bacteria 3000861951 3000863421 221
126 3300042636 Ga0466703_266802 Ga0466703_266802_3364_4032 222
127 iso_pr_bacteria 8001394582 8001395940 222
128 3300005071 Ga0068302_10037660 Ga0068302_100376604 223
129 3300042601 Ga0466707_026343 Ga0466707_026343_14343_15014 223
130 3300042601 Ga0466707_291876 Ga0466707_291876_401_1072 223
131 3300042601 Ga0466707_306658 Ga0466707_306658_828_1499 223
132 3300042605 Ga0466716_162403 Ga0466716_162403_1295_1966 223
133 3300042616 Ga0466715_134531 Ga0466715_134531_651_1322 223
134 3300042619 Ga0466726_478588 Ga0466726_478588_413_1087 224
135 3300009826 Ga0123355_10001042 Ga0123355_1000104217 225
136 iso_pr_bacteria 2531839005 2531866775 225
137 iso_pr_bacteria 2908136803 2908142179 225
138 iso_pr_bacteria 8042061949 8042062426 225
139 3300042616 Ga0466715_179998 Ga0466715_179998_3719_4399 226
140 3300042652 Ga0466708_046866 Ga0466708_046866_7229_7915 228
141 3300042606 Ga0466719_395330 Ga0466719_395330_6203_6892 229
142 3300042625 Ga0466730_039143 Ga0466730_039143_379_1083 234
143 3300042619 Ga0466726_186408 Ga0466726_186408_1520_2233 237
144 3300010167 Ga0123353_10190224 Ga0123353_101902243 240
145 3300009826 Ga0123355_10001570 Ga0123355_1000157021 259

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01144 CoA_trans Coenzyme A transferase 48 242 0.96
PF13336 AcetylCoA_hyd_C Acetyl-CoA hydrolase/transferase C-terminal domain 142 234 0.87

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01144 GO:0008410 CoA-transferase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.81 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.