Protein Family IF02302

Metagenome Metatranscriptome Isolate
122 Members
55 Samples
96 Scaffolds
174.15 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10001203|Ga0123355_1000120325
Length
156 aa
Sequence
MLRNLATNLLYHGRIQTTETRAKEVRKVAEKLITLAVKEKDNFSEVTKTFKVAQKDAAGRRVKKTVYDTVERKVKVDHPTRLNARRKILSVLYPVTEVPADGRKKRSLTTSVNMAEKLFNEIAPKYESRKGGYTRIIKIGKRKGDAAEMVFIELV*

📊 Sample Types

Isolate 21.3%
Metagenome 77.9%
MAG 0.0%
Metatranscriptome 0.8%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 49.1%
Termitidae 34.0%
Kalotermitidae 5.7%
Termopsidae 5.7%
Hodotermitidae 1.9%
Rhinotermitidae 1.9%
Passalidae 1.9%

🌳 Taxonomy

Archaea 0
Bacteria 117
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820378768 Unclassified Firmicutes Nt197P1bin7 Isolate Unclassified
2 2820401926 Unclassified Firmicutes Mp193P1bin2 Isolate Unclassified
3 2820459456 Unclassified Firmicutes Lab288P3bin148 Isolate Unclassified
4 2820528380 Unclassified Firmicutes Lab288P1bin143 Isolate Unclassified
5 2820535361 Unclassified Firmicutes Lab288P1bin14 Isolate Unclassified
6 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
7 2820285501 Unclassified Firmicutes Th196P3bin142 Isolate Unclassified
8 2820495292 Unclassified Firmicutes Lab288P1bin59 Isolate Unclassified
9 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
10 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
11 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
12 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
13 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
14 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
15 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
16 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
17 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
18 2820481688 Unclassified Firmicutes Lab288P1bin76 Isolate Unclassified
19 2820490862 Unclassified Firmicutes Lab288P1bin64 Isolate Unclassified
20 2820633305 Unclassified Firmicutes Emb289P1bin118 Isolate Unclassified
21 2820685979 Unclassified Firmicutes Co191P1bin81 Isolate Unclassified
22 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
23 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
24 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
25 2820309449 Unclassified Firmicutes Th196P1bin10 Isolate Unclassified
26 2820501819 Unclassified Firmicutes Lab288P1bin51 Isolate Unclassified
27 2820547636 Unclassified Firmicutes Lab288P1bin10 Isolate Unclassified
28 2820598593 Unclassified Firmicutes Emb289P1bin53 Isolate Unclassified
29 2820607737 Unclassified Firmicutes Emb289P1bin48 Isolate Unclassified
30 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
31 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
32 2820469612 Unclassified Firmicutes Lab288P1bin92 Isolate Unclassified
33 2820522177 Unclassified Firmicutes Lab288P1bin22 Isolate Unclassified
34 2820581541 Unclassified Firmicutes Emb289P3bin127 Isolate Unclassified
35 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
36 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
37 2820431532 Unclassified Firmicutes Lab288P3bin230 Isolate Unclassified
38 2820487239 Unclassified Firmicutes Lab288P1bin71 Isolate Unclassified
39 2820539610 Unclassified Firmicutes Lab288P1bin136 Isolate Unclassified
40 2820673891 Unclassified Firmicutes Co191P3bin18 Isolate Unclassified
41 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
42 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
43 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
44 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
45 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
46 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
47 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
48 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
49 3300021239 Termite gut microbial communities from nest from French Guiana - FG16_17_4 mRNA SA Metatranscriptome
50 2820592308 Unclassified Firmicutes Emb289P1bin71 Isolate Unclassified
51 2820619171 Unclassified Firmicutes Emb289P1bin130 Isolate Unclassified
52 2820630457 Unclassified Firmicutes Emb289P1bin119 Isolate Unclassified
53 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
54 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
55 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466693_291663 3300042592 Bacteria 2040
2 Ga0123355_10004431 3300009826 Bacteria 20424
3 Ga0123355_10030826 3300009826 Bacteria 8697
4 Ga0123355_10037361 3300009826 Bacteria 7897
5 Ga0123355_10109227 3300009826 Bacteria 4327
6 Ga0123355_10729451 3300009826 Bacteria 1127
7 Ga0123356_10747090 3300010049 Unclassified 1148
8 Ga0123353_10088307 3300010167 Bacteria 4993
9 Ga0072941_1233089 3300005201 Bacteria 4881
10 Ga0466722_090267 3300042609 Bacteria 1965
11 Ga0415639_014911 3300038395 Bacteria 11711
12 Ga0466693_133506 3300042592 Bacteria 1160
13 Ga0466693_149370 3300042592 Bacteria 5868
14 Ga0123357_10531989 3300009784 Bacteria 952
15 Ga0123355_10010920 3300009826 Bacteria 13973
16 Ga0123355_10035834 3300009826 Bacteria 8066
17 Ga0123355_10110504 3300009826 Bacteria 4296
18 Ga0123355_10171170 3300009826 Bacteria 3246
19 Ga0123355_10185230 3300009826 Bacteria 3080
20 Ga0123355_10252510 3300009826 Bacteria 2480
21 Ga0123355_10306068 3300009826 Bacteria 2160
22 Ga0123356_11027287 3300010049 Bacteria 994
23 Ga0466725_082702 3300042654 Bacteria 32093
24 IMNBL1DRAFT_c0000272 3300000062 Bacteria 45809
25 JGI24702J35022_10013714 3300002462 Bacteria 4482
26 Ga0072941_1715128 3300005201 Bacteria 833
27 Ga0466714_162255 3300042603 Bacteria 1390
28 Ga0466712_283525 3300042614 Bacteria 2273
29 Ga0466726_324507 3300042619 Bacteria 16558
30 Ga0415639_009883 3300038395 Bacteria 16360
31 Ga0415639_142896 3300038395 Bacteria 1283
32 Ga0123355_10012755 3300009826 Bacteria 13033
33 Ga0123355_10036685 3300009826 Bacteria 7970
34 Ga0123355_10056741 3300009826 Bacteria 6338
35 Ga0123355_10392413 3300009826 Bacteria 1798
36 Ga0123356_12538940 3300010049 Bacteria 641
37 Ga0123353_10253977 3300010167 Bacteria 2720
38 Ga0123353_11313749 3300010167 Bacteria 938
39 JGI24695J34938_10000403 3300002450 Bacteria 42148
40 Ga0466700_413888 3300042600 Bacteria 1236
41 Ga0466710_187996 3300042613 Bacteria 1890
42 Ga0415639_015454 3300038395 Bacteria 11733
43 Ga0123355_10032582 3300009826 Bacteria 8459
44 Ga0123353_10223446 3300010167 Unclassified 2942
45 Ga0123353_10343061 3300010167 Bacteria 2255
46 Ga0123353_12067799 3300010167 Bacteria 695
47 Ga0466705_061344 3300042612 Bacteria 17468
48 Ga0466733_125740 3300042659 Bacteria 1128
49 Ga0415639_026367 3300038395 Bacteria 19858
50 Ga0415639_036653 3300038395 Bacteria 2599
51 Ga0415639_041246 3300038395 Bacteria 4725
52 Ga0415639_079592 3300038395 Bacteria 3213
53 Ga0415639_099932 3300038395 Bacteria 3237
54 Ga0123355_10001203 3300009826 Bacteria 36038
55 IMNBL1DRAFT_c0000426 3300000062 Bacteria 35421
56 JGI24697J35500_11274940 3300002507 Bacteria 15937
57 Ga0072941_1007162 3300005201 Bacteria 33370
58 Ga0466706_103864 3300042599 Bacteria 13046
59 Ga0466714_011158 3300042603 Unclassified 5407
60 Ga0466714_011230 3300042603 Bacteria 1209
61 Ga0466714_077025 3300042603 Unclassified 1757
62 Ga0466714_150226 3300042603 Bacteria 7330
63 Ga0466719_203918 3300042606 Bacteria 15671
64 Ga0466693_123263 3300042592 Bacteria 2716
65 Ga0466699_385939 3300042597 Bacteria 1795
66 Ga0123355_10787082 3300009826 Bacteria 1064
67 Ga0123356_10041278 3300010049 Bacteria 4299
68 Ga0466725_069889 3300042654 Bacteria 3786
69 Ga0466725_224368 3300042654 Bacteria 9572
70 Ga0466727_099274 3300042655 Bacteria 1328
71 IMNBL1DRAFT_c0010636 3300000062 Bacteria 4375
72 JGI24703J35330_11743454 3300002501 Bacteria 3910
73 JGI24700J35501_10930794 3300002508 Bacteria 24253
74 Ga0466700_432738 3300042600 Bacteria 6555
75 Ga0223677_1004576 3300021239 Bacteria 2255
76 Ga0415639_201391 3300038395 Bacteria 1557
77 Ga0123355_10001471 3300009826 Bacteria 32759
78 Ga0123355_10388150 3300009826 Bacteria 1812
79 Ga0123353_10042873 3300010167 Bacteria 7161
80 Ga0123353_10062630 3300010167 Bacteria 5965
81 JGI24703J35330_11723783 3300002501 Bacteria 2469
82 Ga0466722_107279 3300042609 Bacteria 1386
83 Ga0466715_232257 3300042616 Bacteria 9357
84 Ga0415639_008085 3300038395 Bacteria 2886
85 Ga0466693_295147 3300042592 Bacteria 1428
86 Ga0123357_10251249 3300009784 Bacteria 1891
87 Ga0123355_10003449 3300009826 Bacteria 22687
88 Ga0123355_10149733 3300009826 Bacteria 3548
89 Ga0123355_10150515 3300009826 Bacteria 3536
90 Ga0123355_10151816 3300009826 Bacteria 3517
91 Ga0123355_10222639 3300009826 Bacteria 2710
92 Ga0123355_10224732 3300009826 Unclassified 2693
93 Ga0123355_10389524 3300009826 Bacteria 1808
94 Ga0123355_10894949 3300009826 Bacteria 966
95 Ga0466735_050127 3300042624 Bacteria 1690
96 Ga0466725_226992 3300042654 Bacteria 1623

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300009826 Ga0123355_10392413 Ga0123355_103924132 154
2 iso_pr_bacteria 2820547636 2820548020 154
3 3300009826 Ga0123355_10001203 Ga0123355_1000120325 156
4 3300009826 Ga0123355_10151816 Ga0123355_101518163 156
5 3300038395 Ga0415639_079592 Ga0415639_079592_1998_2474 158
6 3300038395 Ga0415639_009883 Ga0415639_009883_15172_15660 162
7 3300038395 Ga0415639_014911 Ga0415639_014911_6282_6770 162
8 3300038395 Ga0415639_026367 Ga0415639_026367_9944_10432 162
9 3300038395 Ga0415639_036653 Ga0415639_036653_77_565 162
10 3300038395 Ga0415639_099932 Ga0415639_099932_1360_1848 162
11 3300042592 Ga0466693_295147 Ga0466693_295147_814_1302 162
12 3300042603 Ga0466714_011158 Ga0466714_011158_2956_3444 162
13 3300042603 Ga0466714_077025 Ga0466714_077025_230_718 162
14 3300042603 Ga0466714_150226 Ga0466714_150226_6782_7270 162
15 3300042613 Ga0466710_187996 Ga0466710_187996_1022_1510 162
16 3300042614 Ga0466712_283525 Ga0466712_283525_41_529 162
17 3300042654 Ga0466725_069889 Ga0466725_069889_287_775 162
18 3300042654 Ga0466725_224368 Ga0466725_224368_1342_1830 162
19 3300042654 Ga0466725_226992 Ga0466725_226992_1093_1581 162
20 3300009826 Ga0123355_10003449 Ga0123355_1000344939 163
21 3300009826 Ga0123355_10036685 Ga0123355_1003668513 163
22 3300009826 Ga0123355_10037361 Ga0123355_100373618 163
23 3300009826 Ga0123355_10224732 Ga0123355_102247323 163
24 3300009826 Ga0123355_10388150 Ga0123355_103881502 163
25 3300009826 Ga0123355_10787082 Ga0123355_107870822 163
26 3300009826 Ga0123355_10894949 Ga0123355_108949493 163
27 3300010049 Ga0123356_10747090 Ga0123356_107470902 163
28 3300010049 Ga0123356_11027287 Ga0123356_110272872 163
29 3300010167 Ga0123353_10088307 Ga0123353_100883073 163
30 3300010167 Ga0123353_10223446 Ga0123353_102234461 163
31 3300010167 Ga0123353_11313749 Ga0123353_113137492 163
32 3300042619 Ga0466726_324507 Ga0466726_324507_9194_9730 167
33 3300009826 Ga0123355_10030826 Ga0123355_100308262 169
34 iso_pr_bacteria 2820607737 2820609072 177
35 3300021239 Ga0223677_1004576 Ga0223677_10045762 178
36 3300038395 Ga0415639_008085 Ga0415639_008085_778_1314 178
37 3300038395 Ga0415639_015454 Ga0415639_015454_9605_10141 178
38 3300038395 Ga0415639_041246 Ga0415639_041246_2786_3322 178
39 3300038395 Ga0415639_201391 Ga0415639_201391_267_803 178
40 3300042592 Ga0466693_123263 Ga0466693_123263_127_663 178
41 3300042592 Ga0466693_133506 Ga0466693_133506_112_648 178
42 3300042592 Ga0466693_149370 Ga0466693_149370_4607_5143 178
43 3300042592 Ga0466693_291663 Ga0466693_291663_1077_1613 178
44 3300042597 Ga0466699_385939 Ga0466699_385939_677_1213 178
45 3300042599 Ga0466706_103864 Ga0466706_103864_8078_8614 178
46 3300042600 Ga0466700_413888 Ga0466700_413888_106_642 178
47 3300042600 Ga0466700_432738 Ga0466700_432738_3709_4245 178
48 3300042603 Ga0466714_011230 Ga0466714_011230_586_1122 178
49 3300042603 Ga0466714_162255 Ga0466714_162255_224_760 178
50 3300042609 Ga0466722_090267 Ga0466722_090267_892_1428 178
51 3300042609 Ga0466722_107279 Ga0466722_107279_713_1249 178
52 3300042612 Ga0466705_061344 Ga0466705_061344_179_715 178
53 3300042624 Ga0466735_050127 Ga0466735_050127_124_660 178
54 3300042654 Ga0466725_082702 Ga0466725_082702_12456_12992 178
55 3300042655 Ga0466727_099274 Ga0466727_099274_596_1132 178
56 3300042659 Ga0466733_125740 Ga0466733_125740_579_1115 178
57 iso_pr_bacteria 2820285501 2820286231 178
58 iso_pr_bacteria 2820309449 2820311036 178
59 iso_pr_bacteria 2820378768 2820379408 178
60 iso_pr_bacteria 2820401926 2820403347 178
61 iso_pr_bacteria 2820431532 2820432095 178
62 iso_pr_bacteria 2820459456 2820460132 178
63 iso_pr_bacteria 2820469612 2820470766 178
64 iso_pr_bacteria 2820481688 2820481930 178
65 iso_pr_bacteria 2820487239 2820488579 178
66 iso_pr_bacteria 2820490862 2820491689 178
67 iso_pr_bacteria 2820495292 2820495349 178
68 iso_pr_bacteria 2820501819 2820503013 178
69 iso_pr_bacteria 2820522177 2820524449 178
70 iso_pr_bacteria 2820528380 2820529418 178
71 iso_pr_bacteria 2820535361 2820536595 178
72 iso_pr_bacteria 2820581541 2820582248 178
73 iso_pr_bacteria 2820592308 2820593513 178
74 iso_pr_bacteria 2820598593 2820599320 178
75 iso_pr_bacteria 2820619171 2820619509 178
76 iso_pr_bacteria 2820630457 2820632033 178
77 iso_pr_bacteria 2820633305 2820633738 178
78 iso_pr_bacteria 2820673891 2820675065 178
79 iso_pr_bacteria 2820685979 2820686964 178
80 3300000062 IMNBL1DRAFT_c0000426 IMNBL1DRAFT_000042620 179
81 3300000062 IMNBL1DRAFT_c0010636 IMNBL1DRAFT_00106367 179
82 3300002450 JGI24695J34938_10000403 JGI24695J34938_1000040360 179
83 3300002462 JGI24702J35022_10013714 JGI24702J35022_100137144 179
84 3300002501 JGI24703J35330_11743454 JGI24703J35330_117434543 179
85 3300002507 JGI24697J35500_11274940 JGI24697J35500_112749404 179
86 3300002508 JGI24700J35501_10930794 JGI24700J35501_1093079412 179
87 3300005201 Ga0072941_1007162 Ga0072941_100716234 179
88 3300005201 Ga0072941_1233089 Ga0072941_12330896 179
89 3300005201 Ga0072941_1715128 Ga0072941_17151281 179
90 3300009784 Ga0123357_10251249 Ga0123357_102512493 179
91 3300009784 Ga0123357_10531989 Ga0123357_105319892 179
92 3300009826 Ga0123355_10001471 Ga0123355_1000147110 179
93 3300009826 Ga0123355_10010920 Ga0123355_100109208 179
94 3300009826 Ga0123355_10032582 Ga0123355_1003258212 179
95 3300009826 Ga0123355_10035834 Ga0123355_1003583416 179
96 3300009826 Ga0123355_10056741 Ga0123355_100567419 179
97 3300009826 Ga0123355_10109227 Ga0123355_101092272 179
98 3300009826 Ga0123355_10149733 Ga0123355_101497332 179
99 3300009826 Ga0123355_10150515 Ga0123355_101505154 179
100 3300009826 Ga0123355_10171170 Ga0123355_101711703 179
101 3300009826 Ga0123355_10185230 Ga0123355_101852304 179
102 3300009826 Ga0123355_10222639 Ga0123355_102226394 179
103 3300009826 Ga0123355_10252510 Ga0123355_102525101 179
104 3300009826 Ga0123355_10389524 Ga0123355_103895241 179
105 3300009826 Ga0123355_10729451 Ga0123355_107294511 179
106 3300010049 Ga0123356_10041278 Ga0123356_100412786 179
107 3300010049 Ga0123356_12538940 Ga0123356_125389401 179
108 3300010167 Ga0123353_10042873 Ga0123353_100428732 179
109 3300010167 Ga0123353_10062630 Ga0123353_1006263010 179
110 3300010167 Ga0123353_10253977 Ga0123353_102539772 179
111 3300010167 Ga0123353_10343061 Ga0123353_103430612 179
112 iso_pr_bacteria 2820539610 2820540039 179
113 3300002501 JGI24703J35330_11723783 JGI24703J35330_117237831 180
114 3300009826 Ga0123355_10004431 Ga0123355_1000443133 180
115 3300009826 Ga0123355_10110504 Ga0123355_101105042 180
116 3300009826 Ga0123355_10306068 Ga0123355_103060683 180
117 3300010167 Ga0123353_12067799 Ga0123353_120677991 180
118 3300000062 IMNBL1DRAFT_c0000272 IMNBL1DRAFT_000027248 181
119 3300009826 Ga0123355_10012755 Ga0123355_1001275522 181
120 3300042616 Ga0466715_232257 Ga0466715_232257_249_794 181
121 3300038395 Ga0415639_142896 Ga0415639_142896_436_987 183
122 3300042606 Ga0466719_203918 Ga0466719_203918_14293_14859 188

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01196 Ribosomal_L17 Ribosomal protein L17 1 155 0.84

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.8 0.84 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.