Protein Family IF02272

Metagenome Isolate
131 Members
61 Samples
93 Scaffolds
753.4 Avg Length

🧬 Representative Sequence

ID
3300009826|Ga0123355_10000035|Ga0123355_1000003599
Length
814 aa
Sequence
MAEKTTRKDTVPQYMLDAFAAAGVRVDGLIYAIHTDMAADGDFADAYVAVDATNLYILYGEERVVKTEGARRIVAEYEIRELVTHPLLALSGLTTQTMLSTCRLINNPDKKADEENEGEKXXXXKPAGSSGRETLILLFSLGCQGFVDRLLKVIRNINKGDDPLQEIKEENPLFCPECGTRYPEPDRQLCPKCTDKMSIFMRLMGYFKYYKKQVALVSAGMLAVTVLSILAPYVGTRLLIDEVLTPPTRYYSAPSGEIISEHTRLLSAAPDYVYAYVETRGGQWYEMVGLIVLAIIAMRIVTTLFNIMQQYILSRTMPWMIYDLQMRIFEAMQRLSVSFYTSKRTGALMNRVSRDARNIYWFFVDGLPFIVINVILFIGIFGIMLWMDWRLALICITIIPFSAVMFRLLRSMFGRIWHKQWTINSQMNNMVSDAVNGQRVIKAFAREGEESRRFTDMGNKHAAVDVKGANLAWTAFPLIYLFMFIGQVAVTAYGGWMVIQGEITLGVLMAFLTYLGMLYGPLEFLSVVSNWWARCVDSAQRVFEVVDAKAEIEEPKNPVIIENMRGEIELDDVWFQYDPATPVLKGMTLHVPAGKTLGIVGKTGAGKSTMANLIARLYDTTEGVIKVDGINVRNMSLKQLRTSIGIVSQDIYLFIGSIVENIRYARPDATIEEVIWAAKMASAHDFITLLPDGYETRVGAGGQDLSGGEKQRLSIARTIIQNPKILILDEATAAMDTETEGKIQNALNELQSGRTTIAIAHRLSTLKDAENLAVIKDGKVVETGTHEELMRKKAEYHKLYSIQMEGLKVISME*

📊 Sample Types

Isolate 29.0%
Metagenome 71.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 63.3%
Termitidae 21.7%
Kalotermitidae 6.7%
Rhinotermitidae 3.3%
Passalidae 3.3%
Termopsidae 1.7%

🌳 Taxonomy

Archaea 0
Bacteria 127
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820265624 Unclassified Firmicutes Th196P3bin36 Isolate Unclassified
2 2820303403 Unclassified Firmicutes Th196P1bin2 Isolate Unclassified
3 2820332331 Unclassified Firmicutes Nt197P3bin75 Isolate Unclassified
4 2820342392 Unclassified Firmicutes Nt197P3bin64 Isolate Unclassified
5 2820522177 Unclassified Firmicutes Lab288P1bin22 Isolate Unclassified
6 2820541116 Unclassified Firmicutes Lab288P1bin109 Isolate Unclassified
7 2820596822 Unclassified Firmicutes Emb289P1bin58 Isolate Unclassified
8 2820644600 Unclassified Firmicutes Cu122P5bin39 Isolate Unclassified
9 2820702360 Unclassified Firmicutes Co191P1bin4 Isolate Unclassified
10 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
11 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
12 2820385248 Unclassified Firmicutes Nt197P1bin19 Isolate Unclassified
13 2820676843 Unclassified Firmicutes Co191P3bin17 Isolate Unclassified
14 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
15 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
16 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
17 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
18 2820285501 Unclassified Firmicutes Th196P3bin142 Isolate Unclassified
19 2820405014 Unclassified Firmicutes Lab288P4bin88 Isolate Unclassified
20 2820435670 Unclassified Firmicutes Lab288P3bin217 Isolate Unclassified
21 2820698910 Unclassified Firmicutes Co191P1bin64 Isolate Unclassified
22 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
23 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
24 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
25 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
26 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
27 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
28 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
29 2820630457 Unclassified Firmicutes Emb289P1bin119 Isolate Unclassified
30 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
31 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
32 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
33 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
34 2820582954 Unclassified Firmicutes Emb289P3bin119 Isolate Unclassified
35 2820623020 Unclassified Firmicutes Emb289P1bin126 Isolate Unclassified
36 2820685979 Unclassified Firmicutes Co191P1bin81 Isolate Unclassified
37 2820696217 Unclassified Firmicutes Co191P1bin66 Isolate Unclassified
38 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
39 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
40 2820292184 Unclassified Firmicutes Th196P3bin109 Isolate Unclassified
41 2820380671 Unclassified Firmicutes Nt197P1bin4 Isolate Unclassified
42 2820432912 Unclassified Firmicutes Lab288P3bin219 Isolate Unclassified
43 2820530790 Unclassified Firmicutes Lab288P1bin141 Isolate Unclassified
44 2820566695 Unclassified Firmicutes Emb289P3bin50 Isolate Unclassified
45 2820600392 Unclassified Firmicutes Emb289P1bin52 Isolate Unclassified
46 2820607737 Unclassified Firmicutes Emb289P1bin48 Isolate Unclassified
47 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
48 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
49 2820329821 Unclassified Firmicutes Nt197P3bin77 Isolate Unclassified
50 2820378768 Unclassified Firmicutes Nt197P1bin7 Isolate Unclassified
51 2820382897 Unclassified Firmicutes Nt197P1bin3 Isolate Unclassified
52 2820424542 Unclassified Firmicutes Lab288P3bin47 Isolate Unclassified
53 2820573558 Unclassified Firmicutes Emb289P3bin140 Isolate Unclassified
54 2820617402 Unclassified Firmicutes Emb289P1bin131 Isolate Unclassified
55 2820627938 Unclassified Firmicutes Emb289P1bin122 Isolate Unclassified
56 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
57 2820375548 Unclassified Firmicutes Nt197P1bin8 Isolate Unclassified
58 2820408893 Unclassified Firmicutes Lab288P4bin80 Isolate Unclassified
59 2820615445 Unclassified Firmicutes Emb289P1bin132 Isolate Unclassified
60 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
61 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123355_10000062 3300009826 Bacteria 114407
2 Ga0123355_10000118 3300009826 Bacteria 90212
3 Ga0123355_10001753 3300009826 Bacteria 30327
4 Ga0123356_10025434 3300010049 Bacteria 5565
5 Ga0123353_10014634 3300010167 Bacteria 11324
6 Ga0123353_10024731 3300010167 Bacteria 9126
7 Ga0123353_10112149 3300010167 Bacteria 4391
8 Ga0123353_10116375 3300010167 Bacteria 4302
9 Ga0123354_10058332 3300010882 Bacteria 5737
10 Ga0415639_037643 3300038395 Bacteria 9179
11 Ga0415639_058984 3300038395 Bacteria 5895
12 Ga0415639_088338 3300038395 Bacteria 4952
13 Ga0072941_1257164 3300005201 Bacteria 6654
14 Ga0466704_079148 3300042643 Bacteria 6468
15 Ga0466725_206937 3300042654 Bacteria 4710
16 Ga0123355_10000180 3300009826 Bacteria 77979
17 Ga0123355_10000311 3300009826 Bacteria 62673
18 Ga0123355_10000810 3300009826 Bacteria 42835
19 Ga0123355_10044374 3300009826 Unclassified 7238
20 Ga0123353_10005930 3300010167 Bacteria 16165
21 Ga0123353_10016165 3300010167 Bacteria 10892
22 Ga0415639_007632 3300038395 Bacteria 40242
23 Ga0415639_103229 3300038395 Bacteria 4582
24 Ga0466693_090916 3300042592 Bacteria 8480
25 Ga0123355_10000035 3300009826 Bacteria 135705
26 Ga0123355_10000137 3300009826 Bacteria 86760
27 Ga0123355_10000442 3300009826 Bacteria 54682
28 Ga0123355_10002541 3300009826 Unclassified 25857
29 Ga0123355_10015824 3300009826 Bacteria 11867
30 Ga0123355_10043576 3300009826 Bacteria 7301
31 Ga0123354_10021327 3300010882 Bacteria 10206
32 Ga0466696_317835 3300042596 Bacteria 25489
33 2227183584 2225789004 Bacteria 8026
34 IMNBL1DRAFT_c0000390 3300000062 Bacteria 37618
35 IMNBL1DRAFT_c0003821 3300000062 Bacteria 9387
36 JGI24698J34947_10004523 3300002449 Bacteria 7570
37 JGI24698J34947_10013398 3300002449 Bacteria 4478
38 JGI24695J34938_10001874 3300002450 Bacteria 17086
39 Ga0466719_104678 3300042606 Bacteria 18699
40 Ga0466721_216600 3300042608 Bacteria 10727
41 Ga0466722_096423 3300042609 Bacteria 7641
42 Ga0123355_10008263 3300009826 Bacteria 15724
43 Ga0123353_10174159 3300010167 Bacteria 3413
44 Ga0415639_002310 3300038395 Bacteria 154573
45 Ga0415639_087647 3300038395 Unclassified 6633
46 Ga0466693_411070 3300042592 Bacteria 3780
47 Ga0466715_032155 3300042616 Bacteria 207155
48 Ga0123355_10001661 3300009826 Bacteria 30966
49 Ga0123355_10006689 3300009826 Bacteria 17143
50 Ga0123355_10075887 3300009826 Bacteria 5378
51 Ga0123356_10035665 3300010049 Unclassified 4645
52 Ga0123353_10045730 3300010167 Bacteria 6950
53 Ga0123353_10052026 3300010167 Bacteria 6538
54 Ga0123353_10152384 3300010167 Bacteria 3689
55 Ga0415639_009825 3300038395 Bacteria 17478
56 Ga0466715_317474 3300042616 Bacteria 28415
57 Ga0123355_10002208 3300009826 Bacteria 27480
58 Ga0123355_10021157 3300009826 Bacteria 10408
59 Ga0123355_10028385 3300009826 Bacteria 9048
60 Ga0123355_10034260 3300009826 Bacteria 8250
61 Ga0123355_10077654 3300009826 Bacteria 5308
62 Ga0123356_10001271 3300010049 Bacteria 27891
63 Ga0415639_013760 3300038395 Bacteria 13189
64 Ga0466693_317432 3300042592 Bacteria 5844
65 JGI24703J35330_11748611 3300002501 Bacteria 22015
66 JGI24700J35501_10930583 3300002508 Bacteria 16187
67 Ga0466700_343883 3300042600 Bacteria 6831
68 Ga0466700_389641 3300042600 Bacteria 10295
69 Ga0123355_10000034 3300009826 Bacteria 138123
70 Ga0123355_10000486 3300009826 Bacteria 52714
71 Ga0123355_10001945 3300009826 Bacteria 29124
72 Ga0123355_10016483 3300009826 Bacteria 11646
73 Ga0123355_10028809 3300009826 Bacteria 8982
74 Ga0123353_10000037 3300010167 Bacteria 145591
75 Ga0123353_10001271 3300010167 Bacteria 30913
76 Ga0415639_001150 3300038395 Bacteria 31684
77 Ga0415639_046052 3300038395 Bacteria 14703
78 Ga0466692_158736 3300042591 Bacteria 36083
79 JGI24698J34947_10001082 3300002449 Bacteria 14037
80 JGI24695J34938_10009860 3300002450 Bacteria 5278
81 JGI24703J35330_11748634 3300002501 Bacteria 22914
82 Ga0466721_043033 3300042608 Bacteria 5521
83 Ga0466727_176323 3300042655 Bacteria 3030
84 Ga0123355_10000463 3300009826 Bacteria 53565
85 Ga0123355_10001566 3300009826 Bacteria 31924
86 Ga0123355_10030958 3300009826 Bacteria 8679
87 Ga0123355_10040498 3300009826 Bacteria 7583
88 Ga0123355_10192308 3300009826 Bacteria 3002
89 Ga0123356_10001598 3300010049 Bacteria 24871
90 Ga0415639_001085 3300038395 Bacteria 60940
91 Ga0466693_404092 3300042592 Bacteria 6940
92 IMNBL1DRAFT_c0001461 3300000062 Bacteria 17666
93 JGI24695J34938_10000024 3300002450 Bacteria 109661

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 2820378768 2820379191 687
2 3300002449 JGI24698J34947_10001082 JGI24698J34947_100010829 702
3 3300009826 Ga0123355_10000034 Ga0123355_10000034109 702
4 3300009826 Ga0123355_10040498 Ga0123355_100404982 704
5 3300010049 Ga0123356_10035665 Ga0123356_100356653 705
6 iso_pr_bacteria 2820582954 2820583580 705
7 3300042591 Ga0466692_158736 Ga0466692_158736_3284_5569 707
8 3300010167 Ga0123353_10174159 Ga0123353_101741592 719
9 3300010167 Ga0123353_10016165 Ga0123353_1001616511 721
10 3300038395 Ga0415639_046052 Ga0415639_046052_6060_8282 722
11 3300010167 Ga0123353_10001271 Ga0123353_100012719 723
12 3300000062 IMNBL1DRAFT_c0003821 IMNBL1DRAFT_00038215 724
13 3300038395 Ga0415639_037643 Ga0415639_037643_846_3191 724
14 3300038395 Ga0415639_103229 Ga0415639_103229_443_2743 729
15 3300002449 JGI24698J34947_10004523 JGI24698J34947_100045233 730
16 3300002449 JGI24698J34947_10013398 JGI24698J34947_100133983 731
17 3300009826 Ga0123355_10192308 Ga0123355_101923082 731
18 3300002508 JGI24700J35501_10930583 JGI24700J35501_109305838 732
19 3300038395 Ga0415639_058984 Ga0415639_058984_2070_4307 732
20 3300042608 Ga0466721_216600 Ga0466721_216600_1134_3374 732
21 2225789004 2227183584 2227602294 733
22 3300009826 Ga0123355_10000311 Ga0123355_1000031140 733
23 3300009826 Ga0123355_10015824 Ga0123355_1001582411 733
24 3300042609 Ga0466722_096423 Ga0466722_096423_599_2845 733
25 3300042600 Ga0466700_389641 Ga0466700_389641_4237_6474 734
26 3300002450 JGI24695J34938_10001874 JGI24695J34938_100018743 735
27 3300010167 Ga0123353_10045730 Ga0123353_100457303 735
28 3300010167 Ga0123353_10024731 Ga0123353_100247316 736
29 3300010167 Ga0123353_10112149 Ga0123353_101121493 736
30 3300038395 Ga0415639_088338 Ga0415639_088338_1281_3518 737
31 3300009826 Ga0123355_10028809 Ga0123355_100288094 739
32 3300000062 IMNBL1DRAFT_c0001461 IMNBL1DRAFT_000146113 740
33 3300009826 Ga0123355_10044374 Ga0123355_100443743 740
34 3300042592 Ga0466693_090916 Ga0466693_090916_2222_4480 740
35 3300010167 Ga0123353_10014634 Ga0123353_100146345 741
36 3300038395 Ga0415639_002310 Ga0415639_002310_115997_118246 741
37 3300009826 Ga0123355_10000810 Ga0123355_1000081015 743
38 3300009826 Ga0123355_10001566 Ga0123355_1000156616 743
39 3300005201 Ga0072941_1257164 Ga0072941_12571642 744
40 3300038395 Ga0415639_007632 Ga0415639_007632_36148_38385 745
41 3300038395 Ga0415639_013760 Ga0415639_013760_2606_4879 746
42 3300042592 Ga0466693_317432 Ga0466693_317432_2719_4977 746
43 3300042596 Ga0466696_317835 Ga0466696_317835_20282_22525 747
44 3300042600 Ga0466700_343883 Ga0466700_343883_4273_6534 747
45 3300042606 Ga0466719_104678 Ga0466719_104678_1407_3650 747
46 3300042616 Ga0466715_032155 Ga0466715_032155_179779_182022 747
47 3300038395 Ga0415639_001085 Ga0415639_001085_17390_19651 748
48 3300042655 Ga0466727_176323 Ga0466727_176323_82_2385 748
49 3300009826 Ga0123355_10000486 Ga0123355_1000048611 749
50 3300010167 Ga0123353_10152384 Ga0123353_101523842 749
51 iso_pr_bacteria 2820285501 2820286013 750
52 iso_pr_bacteria 2820382897 2820382966 750
53 3300010049 Ga0123356_10025434 Ga0123356_100254344 751
54 3300042592 Ga0466693_404092 Ga0466693_404092_724_2979 751
55 3300042654 Ga0466725_206937 Ga0466725_206937_1710_3965 751
56 iso_pr_bacteria 2820303403 2820305547 751
57 iso_pr_bacteria 2820385248 2820386889 751
58 3300002501 JGI24703J35330_11748611 JGI24703J35330_117486118 752
59 3300009826 Ga0123355_10000442 Ga0123355_1000044234 752
60 3300009826 Ga0123355_10006689 Ga0123355_100066898 752
61 iso_pr_bacteria 2820424542 2820425800 752
62 3300000062 IMNBL1DRAFT_c0000390 IMNBL1DRAFT_000039035 753
63 3300002501 JGI24703J35330_11748634 JGI24703J35330_117486342 753
64 3300009826 Ga0123355_10001661 Ga0123355_1000166114 753
65 iso_pr_bacteria 2820292184 2820292259 753
66 iso_pr_bacteria 2820329821 2820329956 753
67 iso_pr_bacteria 2820342392 2820344478 753
68 iso_pr_bacteria 2820615445 2820615984 753
69 iso_pr_bacteria 2820630457 2820631648 753
70 iso_pr_bacteria 2820702360 2820703349 753
71 3300002450 JGI24695J34938_10009860 JGI24695J34938_100098604 754
72 3300009826 Ga0123355_10001945 Ga0123355_1000194517 754
73 3300010049 Ga0123356_10001271 Ga0123356_1000127117 754
74 3300010167 Ga0123353_10052026 Ga0123353_100520266 754
75 3300038395 Ga0415639_087647 Ga0415639_087647_2372_4636 754
76 3300042592 Ga0466693_411070 Ga0466693_411070_1473_3737 754
77 3300042608 Ga0466721_043033 Ga0466721_043033_1874_4138 754
78 iso_pr_bacteria 2820265624 2820266405 754
79 iso_pr_bacteria 2820432912 2820435599 754
80 iso_pr_bacteria 2820530790 2820532976 754
81 iso_pr_bacteria 2820573558 2820574597 754
82 iso_pr_bacteria 2820607737 2820609255 754
83 3300009826 Ga0123355_10016483 Ga0123355_1001648310 755
84 3300010167 Ga0123353_10005930 Ga0123353_100059307 755
85 iso_pr_bacteria 2820332331 2820333640 755
86 iso_pr_bacteria 2820685979 2820686845 755
87 3300009826 Ga0123355_10000062 Ga0123355_1000006248 757
88 3300010049 Ga0123356_10001598 Ga0123356_100015985 757
89 3300009826 Ga0123355_10021157 Ga0123355_100211575 758
90 3300042616 Ga0466715_317474 Ga0466715_317474_21254_23530 758
91 3300042643 Ga0466704_079148 Ga0466704_079148_3088_5364 758
92 iso_pr_bacteria 2820375548 2820378656 758
93 3300009826 Ga0123355_10002541 Ga0123355_1000254117 759
94 3300010167 Ga0123353_10116375 Ga0123353_101163753 759
95 iso_pr_bacteria 2820405014 2820405652 759
96 3300010882 Ga0123354_10021327 Ga0123354_100213275 760
97 iso_pr_bacteria 2820522177 2820522405 760
98 3300038395 Ga0415639_001150 Ga0415639_001150_20327_22789 761
99 3300010167 Ga0123353_10000037 Ga0123353_10000037111 762
100 3300038395 Ga0415639_009825 Ga0415639_009825_14569_17052 763
101 3300009826 Ga0123355_10000180 Ga0123355_1000018013 764
102 3300009826 Ga0123355_10000463 Ga0123355_1000046339 764
103 iso_pr_bacteria 2820596822 2820597532 764
104 iso_pr_bacteria 2820380671 2820382343 765
105 3300009826 Ga0123355_10043576 Ga0123355_100435765 767
106 3300002450 JGI24695J34938_10000024 JGI24695J34938_10000024108 772
107 3300009826 Ga0123355_10000118 Ga0123355_1000011825 773
108 3300009826 Ga0123355_10008263 Ga0123355_100082636 776
109 3300009826 Ga0123355_10075887 Ga0123355_100758874 777
110 3300009826 Ga0123355_10000137 Ga0123355_1000013757 781
111 3300010882 Ga0123354_10058332 Ga0123354_100583322 781
112 3300009826 Ga0123355_10002208 Ga0123355_1000220818 782
113 3300009826 Ga0123355_10030958 Ga0123355_100309586 782
114 iso_pr_bacteria 2820435670 2820435784 782
115 iso_pr_bacteria 2820541116 2820543438 782
116 3300009826 Ga0123355_10077654 Ga0123355_100776544 785
117 3300009826 Ga0123355_10028385 Ga0123355_100283853 786
118 iso_pr_bacteria 2820600392 2820600495 786
119 iso_pr_bacteria 2820408893 2820409939 787
120 iso_pr_bacteria 2820267566 2820269445 788
121 iso_pr_bacteria 2820617402 2820617669 792
122 iso_pr_bacteria 2820644600 2820646588 792
123 3300009826 Ga0123355_10001753 Ga0123355_1000175317 795
124 iso_pr_bacteria 2820698910 2820701432 795
125 iso_pr_bacteria 2820623020 2820624730 797
126 3300009826 Ga0123355_10034260 Ga0123355_100342603 802
127 iso_pr_bacteria 2820676843 2820676953 804
128 iso_pr_bacteria 2820696217 2820696470 804
129 iso_pr_bacteria 2820566695 2820568358 809
130 iso_pr_bacteria 2820627938 2820628327 813
131 3300009826 Ga0123355_10000035 Ga0123355_1000003599 814

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00664 ABC_membrane ABC transporter transmembrane region 287 522 0.97
PF00005 ABC_tran ABC transporter 584 733 0.93
PF02463 SMC_N RecF/RecN/SMC N terminal domain 615 776 0.9

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.67 0.69 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.