Protein Family IF02263
Metagenome
Isolate
115
Members
35
Samples
112
Scaffolds
69.99
Avg Length
Representative Sequence
- ID
- 3300009784|Ga0123357_10664377|Ga0123357_106643772
- Length
- 72 aa
- Sequence
- MSAWGSAKARRVLAALLQMGWTVRRESGGSHKILARAGWPDFVFAFHDGEEIGPRMMARIAKHTGLKPEDL*
Sample Types
Isolate
2.6%
Metagenome
97.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
65.6%
Kalotermitidae
12.5%
Unclassified
9.4%
Rhinotermitidae
9.4%
Culicidae
3.1%
Taxonomy
Archaea
1
Bacteria
88
Eukaryota
0
Viruses
0
Unclassified
26
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 2 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 3 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 4 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 5 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 6 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 7 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 8 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 9 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 10 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 11 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 12 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 13 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 14 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 15 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 16 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 17 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 18 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 19 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 20 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 21 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 22 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 23 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 24 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 25 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 26 | 2758568796 | Unclassified Deltaproteobacteria Th196P3_bin21 | Isolate | Unclassified |
| 27 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 28 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 29 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 30 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 31 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 32 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 33 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 34 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 35 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466729_080356 | 3300042621 | Unclassified | 1097 |
| 2 | Ga0466731_020288 | 3300042622 | Bacteria | 1056 |
| 3 | Ga0466731_046949 | 3300042622 | Bacteria | 4758 |
| 4 | Ga0466731_077532 | 3300042622 | Bacteria | 1507 |
| 5 | Ga0466734_009894 | 3300042623 | Bacteria | 5425 |
| 6 | Ga0466694_042162 | 3300042594 | Bacteria | 1377 |
| 7 | Ga0466695_342131 | 3300042595 | Bacteria | 2165 |
| 8 | Ga0466699_005487 | 3300042597 | Bacteria | 3575 |
| 9 | Ga0466699_440996 | 3300042597 | Unclassified | 8085 |
| 10 | Ga0123357_10510497 | 3300009784 | Bacteria | 990 |
| 11 | Ga0123356_13429736 | 3300010049 | Bacteria | 550 |
| 12 | Ga0466722_030336 | 3300042609 | Bacteria | 6536 |
| 13 | FAAS_10294847 | 3300001880 | Unclassified | 508 |
| 14 | JGI24695J34938_10048694 | 3300002450 | Unclassified | 1865 |
| 15 | JGI24695J34938_10611810 | 3300002450 | Unclassified | 508 |
| 16 | JGI24696J40584_12288895 | 3300002834 | Unclassified | 515 |
| 17 | Ga0466718_066768 | 3300042617 | Bacteria | 1062 |
| 18 | Ga0160460_106383 | 3300012845 | Bacteria | 1618 |
| 19 | Ga0466699_233364 | 3300042597 | Bacteria | 1476 |
| 20 | Ga0123357_10664377 | 3300009784 | Bacteria | 764 |
| 21 | Ga0123356_10213135 | 3300010049 | Bacteria | 1982 |
| 22 | Ga0123356_10562210 | 3300010049 | Bacteria | 1303 |
| 23 | Ga0123356_13170036 | 3300010049 | Bacteria | 573 |
| 24 | Ga0123353_10119860 | 3300010167 | Bacteria | 4231 |
| 25 | Ga0466720_016479 | 3300042607 | Unclassified | 8843 |
| 26 | Ga0466720_031989 | 3300042607 | Bacteria | 4090 |
| 27 | JGI24698J34947_10345024 | 3300002449 | Bacteria | 523 |
| 28 | Ga0072941_1004432 | 3300005201 | Bacteria | 5981 |
| 29 | Ga0415639_006598 | 3300038395 | Bacteria | 2186 |
| 30 | Ga0466694_034141 | 3300042594 | Bacteria | 11434 |
| 31 | Ga0466699_175760 | 3300042597 | Bacteria | 1043 |
| 32 | Ga0466699_213273 | 3300042597 | Bacteria | 2496 |
| 33 | Ga0466699_358088 | 3300042597 | Bacteria | 1320 |
| 34 | Ga0466720_002650 | 3300042607 | Bacteria | 6838 |
| 35 | Ga0466722_100600 | 3300042609 | Bacteria | 2266 |
| 36 | FAAS_10706730 | 3300001880 | Unclassified | 544 |
| 37 | JGI24695J34938_10044560 | 3300002450 | Bacteria | 1972 |
| 38 | JGI24695J34938_10058470 | 3300002450 | Bacteria | 1653 |
| 39 | JGI24695J34938_10256920 | 3300002450 | Bacteria | 743 |
| 40 | Ga0466690_265655 | 3300042590 | Bacteria | 1569 |
| 41 | Ga0466694_202517 | 3300042594 | Bacteria | 6239 |
| 42 | Ga0466695_116777 | 3300042595 | Archaea | 9558 |
| 43 | Ga0123357_10135754 | 3300009784 | Bacteria | 3044 |
| 44 | Ga0123355_11531920 | 3300009826 | Bacteria | 648 |
| 45 | Ga0123356_10004995 | 3300010049 | Bacteria | 13603 |
| 46 | Ga0123356_10497937 | 3300010049 | Bacteria | 1374 |
| 47 | Ga0123356_12558433 | 3300010049 | Unclassified | 639 |
| 48 | Ga0123356_13071004 | 3300010049 | Bacteria | 582 |
| 49 | Ga0123353_11510272 | 3300010167 | Bacteria | 855 |
| 50 | Ga0123353_11883043 | 3300010167 | Bacteria | 739 |
| 51 | Ga0123353_12487973 | 3300010167 | Bacteria | 616 |
| 52 | Ga0466720_039741 | 3300042607 | Unclassified | 22089 |
| 53 | JGI24695J34938_10056401 | 3300002450 | Bacteria | 1694 |
| 54 | Ga0072941_1012181 | 3300005201 | Bacteria | 8260 |
| 55 | Ga0466731_002481 | 3300042622 | Bacteria | 2939 |
| 56 | Ga0466709_024062 | 3300042648 | Bacteria | 1139 |
| 57 | Ga0264413_106475 | 3300024493 | Bacteria | 11923 |
| 58 | Ga0415639_000907 | 3300038395 | Unclassified | 9228 |
| 59 | Ga0466692_181921 | 3300042591 | Bacteria | 1795 |
| 60 | Ga0466694_162085 | 3300042594 | Unclassified | 1136 |
| 61 | Ga0123355_11971128 | 3300009826 | Unclassified | 543 |
| 62 | Ga0123356_10972699 | 3300010049 | Bacteria | 1019 |
| 63 | Ga0123356_11479042 | 3300010049 | Bacteria | 837 |
| 64 | Ga0123353_11507384 | 3300010167 | Bacteria | 856 |
| 65 | AustNasuHG_c1020908 | 3300000089 | Bacteria | 2125 |
| 66 | JGI24695J34938_10336644 | 3300002450 | Unclassified | 660 |
| 67 | Ga0466715_442483 | 3300042616 | Unclassified | 2002 |
| 68 | Ga0264413_111276 | 3300024493 | Unclassified | 1050 |
| 69 | Ga0466694_028348 | 3300042594 | Bacteria | 1973 |
| 70 | Ga0466694_041541 | 3300042594 | Bacteria | 2407 |
| 71 | Ga0466695_061335 | 3300042595 | Bacteria | 29701 |
| 72 | Ga0466695_103735 | 3300042595 | Unclassified | 1142 |
| 73 | Ga0466695_366125 | 3300042595 | Bacteria | 2616 |
| 74 | Ga0123357_10338967 | 3300009784 | Unclassified | 1456 |
| 75 | Ga0123356_10102380 | 3300010049 | Bacteria | 2749 |
| 76 | Ga0123356_10709067 | 3300010049 | Bacteria | 1175 |
| 77 | Ga0123356_12931460 | 3300010049 | Unclassified | 596 |
| 78 | Ga0123356_13245999 | 3300010049 | Bacteria | 566 |
| 79 | Ga0123353_10040621 | 3300010167 | Bacteria | 7341 |
| 80 | Ga0466720_010958 | 3300042607 | Bacteria | 6743 |
| 81 | Ga0466720_051426 | 3300042607 | Unclassified | 1105 |
| 82 | Ga0466722_000589 | 3300042609 | Unclassified | 2770 |
| 83 | JGI24695J34938_10000688 | 3300002450 | Bacteria | 31893 |
| 84 | Ga0466712_170230 | 3300042614 | Bacteria | 2177 |
| 85 | Ga0466718_167940 | 3300042617 | Bacteria | 1252 |
| 86 | Ga0466731_037945 | 3300042622 | Bacteria | 1379 |
| 87 | Ga0466690_174579 | 3300042590 | Bacteria | 2072 |
| 88 | Ga0466693_234028 | 3300042592 | Bacteria | 1195 |
| 89 | Ga0466694_126390 | 3300042594 | Bacteria | 2112 |
| 90 | Ga0466694_381837 | 3300042594 | Bacteria | 1689 |
| 91 | Ga0123357_10215119 | 3300009784 | Bacteria | 2147 |
| 92 | Ga0123357_10447561 | 3300009784 | Bacteria | 1124 |
| 93 | Ga0123355_10578433 | 3300009826 | Unclassified | 1344 |
| 94 | Ga0123356_10000152 | 3300010049 | Bacteria | 78065 |
| 95 | Ga0123353_11074575 | 3300010167 | Bacteria | 1072 |
| 96 | Ga0466720_136972 | 3300042607 | Bacteria | 8053 |
| 97 | Ga0466720_191287 | 3300042607 | Bacteria | 1100 |
| 98 | Ga0466721_083050 | 3300042608 | Bacteria | 33732 |
| 99 | Nasutiter_Contig34343 | 2030936001 | Unclassified | 546 |
| 100 | AustNasuHG_c1051391 | 3300000089 | Bacteria | 877 |
| 101 | JGI24696J40584_12858529 | 3300002834 | Unclassified | 1004 |
| 102 | Ga0466712_265763 | 3300042614 | Bacteria | 1554 |
| 103 | Ga0466718_058819 | 3300042617 | Bacteria | 8796 |
| 104 | Ga0466729_203665 | 3300042621 | Bacteria | 1223 |
| 105 | Ga0466704_091286 | 3300042643 | Bacteria | 4678 |
| 106 | Ga0264413_108539 | 3300024493 | Bacteria | 4406 |
| 107 | Ga0466699_089161 | 3300042597 | Bacteria | 3810 |
| 108 | Ga0123356_11780617 | 3300010049 | Bacteria | 765 |
| 109 | Ga0123353_11789076 | 3300010167 | Unclassified | 764 |
| 110 | Ga0466698_492549 | 3300042610 | Bacteria | 1500 |
| 111 | JGI24695J34938_10041103 | 3300002450 | Unclassified | 2078 |
| 112 | Ga0123357_10003185 | 3300009784 | Bacteria | 18677 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042597 | Ga0466699_358088 | Ga0466699_358088_397_573 | 58 |
| 2 | 3300042621 | Ga0466729_203665 | Ga0466729_203665_519_695 | 58 |
| 3 | 3300002450 | JGI24695J34938_10056401 | JGI24695J34938_100564012 | 59 |
| 4 | 3300009784 | Ga0123357_10447561 | Ga0123357_104475612 | 61 |
| 5 | 3300042607 | Ga0466720_136972 | Ga0466720_136972_188_382 | 64 |
| 6 | 3300010049 | Ga0123356_11479042 | Ga0123356_114790423 | 65 |
| 7 | 3300005201 | Ga0072941_1004432 | Ga0072941_10044323 | 69 |
| 8 | 3300042617 | Ga0466718_058819 | Ga0466718_058819_7556_7765 | 69 |
| 9 | 2030936001 | Nasutiter_Contig34343 | Nasutiterm_1100730 | 70 |
| 10 | 3300024493 | Ga0264413_106475 | Ga0264413_1064753 | 70 |
| 11 | 3300024493 | Ga0264413_108539 | Ga0264413_1085391 | 70 |
| 12 | 3300024493 | Ga0264413_111276 | Ga0264413_1112761 | 70 |
| 13 | 3300038395 | Ga0415639_000907 | Ga0415639_000907_7958_8170 | 70 |
| 14 | 3300038395 | Ga0415639_006598 | Ga0415639_006598_535_747 | 70 |
| 15 | 3300042590 | Ga0466690_174579 | Ga0466690_174579_505_717 | 70 |
| 16 | 3300042590 | Ga0466690_265655 | Ga0466690_265655_909_1121 | 70 |
| 17 | 3300042591 | Ga0466692_181921 | Ga0466692_181921_1334_1546 | 70 |
| 18 | 3300042592 | Ga0466693_234028 | Ga0466693_234028_860_1072 | 70 |
| 19 | 3300042594 | Ga0466694_028348 | Ga0466694_028348_224_436 | 70 |
| 20 | 3300042594 | Ga0466694_034141 | Ga0466694_034141_3336_3548 | 70 |
| 21 | 3300042594 | Ga0466694_041541 | Ga0466694_041541_347_559 | 70 |
| 22 | 3300042594 | Ga0466694_042162 | Ga0466694_042162_388_600 | 70 |
| 23 | 3300042594 | Ga0466694_126390 | Ga0466694_126390_89_301 | 70 |
| 24 | 3300042594 | Ga0466694_162085 | Ga0466694_162085_477_689 | 70 |
| 25 | 3300042594 | Ga0466694_202517 | Ga0466694_202517_1490_1702 | 70 |
| 26 | 3300042594 | Ga0466694_381837 | Ga0466694_381837_169_381 | 70 |
| 27 | 3300042595 | Ga0466695_061335 | Ga0466695_061335_28209_28421 | 70 |
| 28 | 3300042595 | Ga0466695_103735 | Ga0466695_103735_888_1100 | 70 |
| 29 | 3300042595 | Ga0466695_116777 | Ga0466695_116777_576_788 | 70 |
| 30 | 3300042595 | Ga0466695_366125 | Ga0466695_366125_1836_2048 | 70 |
| 31 | 3300042597 | Ga0466699_005487 | Ga0466699_005487_2872_3084 | 70 |
| 32 | 3300042597 | Ga0466699_089161 | Ga0466699_089161_827_1039 | 70 |
| 33 | 3300042597 | Ga0466699_175760 | Ga0466699_175760_750_962 | 70 |
| 34 | 3300042597 | Ga0466699_213273 | Ga0466699_213273_1491_1703 | 70 |
| 35 | 3300042597 | Ga0466699_233364 | Ga0466699_233364_848_1060 | 70 |
| 36 | 3300042597 | Ga0466699_440996 | Ga0466699_440996_1105_1317 | 70 |
| 37 | 3300042607 | Ga0466720_002650 | Ga0466720_002650_1616_1828 | 70 |
| 38 | 3300042607 | Ga0466720_010958 | Ga0466720_010958_2829_3041 | 70 |
| 39 | 3300042607 | Ga0466720_016479 | Ga0466720_016479_6700_6912 | 70 |
| 40 | 3300042607 | Ga0466720_031989 | Ga0466720_031989_3095_3307 | 70 |
| 41 | 3300042607 | Ga0466720_039741 | Ga0466720_039741_21036_21248 | 70 |
| 42 | 3300042607 | Ga0466720_051426 | Ga0466720_051426_386_598 | 70 |
| 43 | 3300042607 | Ga0466720_191287 | Ga0466720_191287_291_503 | 70 |
| 44 | 3300042608 | Ga0466721_083050 | Ga0466721_083050_33002_33214 | 70 |
| 45 | 3300042609 | Ga0466722_000589 | Ga0466722_000589_540_752 | 70 |
| 46 | 3300042609 | Ga0466722_030336 | Ga0466722_030336_404_616 | 70 |
| 47 | 3300042609 | Ga0466722_100600 | Ga0466722_100600_871_1083 | 70 |
| 48 | 3300042610 | Ga0466698_492549 | Ga0466698_492549_251_463 | 70 |
| 49 | 3300042614 | Ga0466712_170230 | Ga0466712_170230_1666_1878 | 70 |
| 50 | 3300042616 | Ga0466715_442483 | Ga0466715_442483_833_1045 | 70 |
| 51 | 3300042617 | Ga0466718_066768 | Ga0466718_066768_773_985 | 70 |
| 52 | 3300042617 | Ga0466718_167940 | Ga0466718_167940_476_688 | 70 |
| 53 | 3300042621 | Ga0466729_080356 | Ga0466729_080356_673_885 | 70 |
| 54 | 3300042622 | Ga0466731_002481 | Ga0466731_002481_2528_2740 | 70 |
| 55 | 3300042622 | Ga0466731_020288 | Ga0466731_020288_580_792 | 70 |
| 56 | 3300042622 | Ga0466731_037945 | Ga0466731_037945_888_1100 | 70 |
| 57 | 3300042622 | Ga0466731_046949 | Ga0466731_046949_2372_2584 | 70 |
| 58 | 3300042622 | Ga0466731_077532 | Ga0466731_077532_411_623 | 70 |
| 59 | 3300042623 | Ga0466734_009894 | Ga0466734_009894_543_755 | 70 |
| 60 | 3300042643 | Ga0466704_091286 | Ga0466704_091286_995_1207 | 70 |
| 61 | 3300042648 | Ga0466709_024062 | Ga0466709_024062_554_766 | 70 |
| 62 | iso_pr_bacteria | 2781125660 | 2781331020 | 70 |
| 63 | iso_pr_bacteria | 2781125664 | 2781339862 | 70 |
| 64 | 3300000089 | AustNasuHG_c1020908 | AustNasuHG_10209082 | 71 |
| 65 | 3300000089 | AustNasuHG_c1051391 | AustNasuHG_10513912 | 71 |
| 66 | 3300001880 | FAAS_10294847 | FAAS_102948472 | 71 |
| 67 | 3300001880 | FAAS_10706730 | FAAS_107067301 | 71 |
| 68 | 3300002449 | JGI24698J34947_10345024 | JGI24698J34947_103450241 | 71 |
| 69 | 3300002450 | JGI24695J34938_10000688 | JGI24695J34938_100006883 | 71 |
| 70 | 3300002450 | JGI24695J34938_10041103 | JGI24695J34938_100411031 | 71 |
| 71 | 3300002450 | JGI24695J34938_10044560 | JGI24695J34938_100445604 | 71 |
| 72 | 3300002450 | JGI24695J34938_10048694 | JGI24695J34938_100486945 | 71 |
| 73 | 3300002450 | JGI24695J34938_10058470 | JGI24695J34938_100584705 | 71 |
| 74 | 3300002450 | JGI24695J34938_10256920 | JGI24695J34938_102569201 | 71 |
| 75 | 3300002450 | JGI24695J34938_10336644 | JGI24695J34938_103366442 | 71 |
| 76 | 3300002450 | JGI24695J34938_10611810 | JGI24695J34938_106118102 | 71 |
| 77 | 3300002834 | JGI24696J40584_12288895 | JGI24696J40584_122888952 | 71 |
| 78 | 3300002834 | JGI24696J40584_12858529 | JGI24696J40584_128585292 | 71 |
| 79 | 3300005201 | Ga0072941_1012181 | Ga0072941_10121815 | 71 |
| 80 | 3300009784 | Ga0123357_10003185 | Ga0123357_1000318518 | 71 |
| 81 | 3300009784 | Ga0123357_10135754 | Ga0123357_101357543 | 71 |
| 82 | 3300009784 | Ga0123357_10338967 | Ga0123357_103389672 | 71 |
| 83 | 3300009784 | Ga0123357_10510497 | Ga0123357_105104972 | 71 |
| 84 | 3300009826 | Ga0123355_10578433 | Ga0123355_105784333 | 71 |
| 85 | 3300009826 | Ga0123355_11531920 | Ga0123355_115319201 | 71 |
| 86 | 3300010049 | Ga0123356_10000152 | Ga0123356_1000015236 | 71 |
| 87 | 3300010049 | Ga0123356_10004995 | Ga0123356_100049958 | 71 |
| 88 | 3300010049 | Ga0123356_10102380 | Ga0123356_101023805 | 71 |
| 89 | 3300010049 | Ga0123356_10213135 | Ga0123356_102131353 | 71 |
| 90 | 3300010049 | Ga0123356_10497937 | Ga0123356_104979372 | 71 |
| 91 | 3300010049 | Ga0123356_10562210 | Ga0123356_105622102 | 71 |
| 92 | 3300010049 | Ga0123356_10709067 | Ga0123356_107090672 | 71 |
| 93 | 3300010049 | Ga0123356_10972699 | Ga0123356_109726991 | 71 |
| 94 | 3300010049 | Ga0123356_12558433 | Ga0123356_125584331 | 71 |
| 95 | 3300010049 | Ga0123356_12931460 | Ga0123356_129314601 | 71 |
| 96 | 3300010049 | Ga0123356_13071004 | Ga0123356_130710041 | 71 |
| 97 | 3300010049 | Ga0123356_13170036 | Ga0123356_131700362 | 71 |
| 98 | 3300010049 | Ga0123356_13245999 | Ga0123356_132459992 | 71 |
| 99 | 3300010049 | Ga0123356_13429736 | Ga0123356_134297362 | 71 |
| 100 | 3300010167 | Ga0123353_10040621 | Ga0123353_100406217 | 71 |
| 101 | 3300010167 | Ga0123353_10119860 | Ga0123353_101198604 | 71 |
| 102 | 3300010167 | Ga0123353_11074575 | Ga0123353_110745751 | 71 |
| 103 | 3300010167 | Ga0123353_11507384 | Ga0123353_115073842 | 71 |
| 104 | 3300010167 | Ga0123353_11510272 | Ga0123353_115102723 | 71 |
| 105 | 3300010167 | Ga0123353_11789076 | Ga0123353_117890761 | 71 |
| 106 | 3300010167 | Ga0123353_11883043 | Ga0123353_118830432 | 71 |
| 107 | 3300010167 | Ga0123353_12487973 | Ga0123353_124879732 | 71 |
| 108 | 3300012845 | Ga0160460_106383 | Ga0160460_1063832 | 71 |
| 109 | 3300042595 | Ga0466695_342131 | Ga0466695_342131_971_1186 | 71 |
| 110 | 3300042614 | Ga0466712_265763 | Ga0466712_265763_894_1109 | 71 |
| 111 | iso_pr_bacteria | 2758568796 | 2761046956 | 71 |
| 112 | 3300009784 | Ga0123357_10215119 | Ga0123357_102151191 | 72 |
| 113 | 3300009784 | Ga0123357_10664377 | Ga0123357_106643772 | 72 |
| 114 | 3300009826 | Ga0123355_11971128 | Ga0123355_119711281 | 72 |
| 115 | 3300010049 | Ga0123356_11780617 | Ga0123356_117806171 | 72 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF07927 | HicA_toxin | HicA toxin of bacterial toxin-antitoxin, | 10 | 66 | 0.93 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF07927 | GO:0003729 | mRNA binding | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.82 | 0.82 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.