Protein Family IF02258

Metagenome Isolate
122 Members
41 Samples
121 Scaffolds
266.34 Avg Length

🧬 Representative Sequence

ID
3300009784|Ga0123357_10447149|Ga0123357_104471491
Length
302 aa
Sequence
MFKKELIIGAIAGDIIGSVYEWHNVKTMNFDLFCSHSKFTDDSVLTLATMDAIMNQNKYSSTYQLFGRNYPNRGYGGHFRSWIQSENPKPYNSWGNGSAMRVSPIGWYGNSIEEVLAEAKKSAECTHNHPEGIKGAQSVAAAVFLARKGKSKEEIRSFIVDTFGKTNGCNSRIKIQTNGKVRVKRDYDDFDSNDEKEFLDYRLQRTIDEIRPYYTFDVTCEGSVPVAIIAFLESKNYENAIRLAISIGGDSDTIACITGGIAEAYYQEIPDNIIENILKILPNELIGIVDEFSKKYRAKSK*

📊 Sample Types

Isolate 0.8%
Metagenome 99.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 48.7%
Kalotermitidae 30.8%
Rhinotermitidae 7.7%
Termopsidae 7.7%
Unclassified 5.1%

🌳 Taxonomy

Archaea 0
Bacteria 112
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
2 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
3 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
4 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
5 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
6 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
7 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
8 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
9 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
10 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
11 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
12 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
13 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
14 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
15 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
16 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
17 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
18 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
19 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
20 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
21 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
22 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
23 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
24 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
25 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
26 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
27 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
28 2820013017 Unclassified Spirochaetes Th196P3bin152 Isolate Unclassified
29 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
30 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
31 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
32 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
33 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
34 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
35 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
36 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
37 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
38 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
39 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
40 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
41 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123356_10541160 3300010049 Bacteria 1325
2 Ga0466693_445965 3300042592 Bacteria 1655
3 Ga0466713_132512 3300042602 Bacteria 7778
4 Ga0466720_125050 3300042607 Unclassified 1487
5 Ga0466711_026776 3300042615 Bacteria 65764
6 Ga0466711_220239 3300042615 Bacteria 5017
7 Ga0466728_025870 3300042620 Bacteria 2564
8 Ga0466731_115990 3300042622 Bacteria 1207
9 AustNasuHG_c1005546 3300000089 Bacteria 4510
10 JGI24698J34947_10002111 3300002449 Bacteria 10636
11 JGI24698J34947_10005914 3300002449 Bacteria 6710
12 JGI24698J34947_10034130 3300002449 Bacteria 2665
13 JGI24698J34947_10043724 3300002449 Bacteria 2295
14 JGI24695J34938_10027827 3300002450 Bacteria 2666
15 Ga0466705_203421 3300042612 Bacteria 2657
16 Ga0466691_023491 3300042593 Bacteria 21508
17 Ga0466691_026622 3300042593 Bacteria 2409
18 Ga0466691_155550 3300042593 Bacteria 3361
19 Ga0466696_027854 3300042596 Bacteria 2841
20 Ga0466696_293445 3300042596 Bacteria 2393
21 Ga0466726_269895 3300042619 Bacteria 1755
22 Ga0466728_363615 3300042620 Bacteria 1617
23 Ga0466708_131864 3300042652 Bacteria 16332
24 AustNasuHG_c1019706 3300000089 Bacteria 2209
25 JGI24696J40584_12952219 3300002834 Bacteria 2321
26 Ga0072941_1015395 3300005201 Bacteria 5037
27 Ga0072941_1036257 3300005201 Bacteria 12597
28 Ga0123356_10136042 3300010049 Bacteria 2416
29 Ga0123356_10532855 3300010049 Bacteria 1334
30 Ga0264413_112976 3300024493 Bacteria 1952
31 Ga0264413_137046 3300024493 Bacteria 1041
32 Ga0466699_105304 3300042597 Bacteria 2261
33 Ga0466717_188288 3300042604 Bacteria 3656
34 Ga0466716_376268 3300042605 Bacteria 2912
35 Ga0466716_532282 3300042605 Bacteria 1180
36 Ga0466720_047503 3300042607 Unclassified 6140
37 Ga0466720_098555 3300042607 Bacteria 28743
38 Ga0466712_320575 3300042614 Bacteria 7587
39 Ga0466723_101325 3300042618 Bacteria 8442
40 Ga0466723_173659 3300042618 Unclassified 6401
41 Ga0466726_298269 3300042619 Bacteria 2065
42 AustNasuHG_c1007592 3300000089 Bacteria 3847
43 JGI24702J35022_10113438 3300002462 Bacteria 1492
44 Ga0072941_1008934 3300005201 Bacteria 9263
45 Ga0072941_1029595 3300005201 Bacteria 4650
46 Ga0072941_1117493 3300005201 Bacteria 1381
47 Ga0123357_10447149 3300009784 Unclassified 1125
48 Ga0123356_10327188 3300010049 Bacteria 1648
49 Ga0466690_133995 3300042590 Unclassified 1541
50 Ga0466694_053447 3300042594 Bacteria 7848
51 Ga0466696_056254 3300042596 Bacteria 5795
52 Ga0466699_100033 3300042597 Bacteria 3386
53 Ga0466698_153568 3300042610 Bacteria 2429
54 Ga0466698_199269 3300042610 Bacteria 3046
55 Ga0466712_108210 3300042614 Bacteria 1742
56 Ga0466723_224884 3300042618 Bacteria 1356
57 Ga0466735_050050 3300042624 Bacteria 2371
58 AustNasuHG_c1039551 3300000089 Bacteria 1169
59 JGI24702J35022_10044760 3300002462 Bacteria 2358
60 Ga0123356_10395928 3300010049 Bacteria 1517
61 Ga0264413_136552 3300024493 Bacteria 2035
62 Ga0456237_0004327 3300041968 Bacteria 2288
63 Ga0466690_066972 3300042590 Bacteria 1969
64 Ga0466696_055869 3300042596 Unclassified 2860
65 Ga0466699_139974 3300042597 Bacteria 1141
66 Ga0466716_268198 3300042605 Bacteria 5297
67 Ga0466723_179392 3300042618 Bacteria 6542
68 Ga0466702_166464 3300042635 Bacteria 1109
69 Ga0466704_303779 3300042643 Bacteria 22719
70 Ga0466704_581012 3300042643 Bacteria 1246
71 Ga0466727_327496 3300042655 Bacteria 1775
72 Ga0072941_1000564 3300005201 Bacteria 41647
73 Ga0123356_10001816 3300010049 Bacteria 23215
74 Ga0466699_043555 3300042597 Bacteria 1741
75 Ga0466699_339349 3300042597 Bacteria 1357
76 Ga0466719_507095 3300042606 Bacteria 1493
77 Ga0466718_063006 3300042617 Bacteria 1528
78 Ga0466726_071102 3300042619 Bacteria 1563
79 Ga0466726_133582 3300042619 Bacteria 2043
80 Ga0466726_477766 3300042619 Bacteria 1059
81 Ga0466704_165143 3300042643 Bacteria 22324
82 Ga0466708_239909 3300042652 Bacteria 8995
83 JGI24702J35022_10008525 3300002462 Bacteria 5800
84 Ga0072941_1016102 3300005201 Bacteria 7282
85 Ga0466692_091671 3300042591 Bacteria 2612
86 Ga0466699_189567 3300042597 Bacteria 1069
87 Ga0466716_071685 3300042605 Unclassified 1288
88 Ga0466716_149710 3300042605 Bacteria 2118
89 Ga0466720_055701 3300042607 Bacteria 6969
90 Ga0466722_173475 3300042609 Bacteria 2551
91 Ga0466726_238348 3300042619 Bacteria 4528
92 Ga0466728_060242 3300042620 Bacteria 2155
93 Ga0466704_011816 3300042643 Unclassified 2131
94 Ga0466704_359247 3300042643 Bacteria 1196
95 Ga0466704_618150 3300042643 Bacteria 4701
96 Ga0466727_022846 3300042655 Unclassified 3154
97 Ga0466727_155159 3300042655 Bacteria 1571
98 AustNasuHG_c1041361 3300000089 Bacteria 1112
99 JGI24702J35022_10194879 3300002462 Bacteria 1157
100 Ga0466705_181546 3300042612 Bacteria 1410
101 Ga0466732_297754 3300042656 Bacteria 1526
102 Ga0466691_174285 3300042593 Bacteria 5600
103 Ga0466716_214203 3300042605 Bacteria 2531
104 Ga0466716_374904 3300042605 Bacteria 12313
105 Ga0466719_356694 3300042606 Bacteria 4706
106 Ga0466719_559061 3300042606 Bacteria 2091
107 Ga0466720_028724 3300042607 Bacteria 12378
108 Ga0466720_113108 3300042607 Unclassified 3076
109 Ga0466698_476759 3300042610 Bacteria 1353
110 Ga0466712_002690 3300042614 Bacteria 3506
111 Ga0466712_134113 3300042614 Bacteria 3358
112 Ga0466715_387683 3300042616 Bacteria 4074
113 Ga0466718_065601 3300042617 Bacteria 27923
114 Ga0466718_162904 3300042617 Bacteria 14286
115 Ga0466726_029821 3300042619 Bacteria 1042
116 Ga0466726_287512 3300042619 Bacteria 2745
117 Ga0466708_424535 3300042652 Bacteria 1017
118 Ga0466727_106591 3300042655 Bacteria 4538
119 AustNasuHG_c1004778 3300000089 Bacteria 4851
120 JGI24699J35502_10905680 3300002509 Bacteria 1059
121 Ga0072941_1053523 3300005201 Bacteria 1414

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042619 Ga0466726_287512 Ga0466726_287512_11_748 245
2 3300042597 Ga0466699_105304 Ga0466699_105304_224_1012 247
3 3300042605 Ga0466716_214203 Ga0466716_214203_1546_2337 251
4 3300002509 JGI24699J35502_10905680 JGI24699J35502_109056801 253
5 3300010049 Ga0123356_10136042 Ga0123356_101360421 254
6 3300042635 Ga0466702_166464 Ga0466702_166464_245_1012 255
7 3300005201 Ga0072941_1029595 Ga0072941_10295955 256
8 3300042605 Ga0466716_532282 Ga0466716_532282_83_874 256
9 3300042604 Ga0466717_188288 Ga0466717_188288_1609_2385 258
10 3300042614 Ga0466712_002690 Ga0466712_002690_1542_2318 258
11 3300042617 Ga0466718_065601 Ga0466718_065601_14422_15204 260
12 3300042616 Ga0466715_387683 Ga0466715_387683_881_1666 261
13 3300042619 Ga0466726_269895 Ga0466726_269895_672_1457 261
14 3300042655 Ga0466727_022846 Ga0466727_022846_1681_2466 261
15 3300042655 Ga0466727_155159 Ga0466727_155159_397_1182 261
16 3300042656 Ga0466732_297754 Ga0466732_297754_412_1197 261
17 3300005201 Ga0072941_1000564 Ga0072941_100056430 262
18 3300005201 Ga0072941_1016102 Ga0072941_10161022 262
19 3300024493 Ga0264413_137046 Ga0264413_1370461 262
20 3300042590 Ga0466690_066972 Ga0466690_066972_970_1758 262
21 3300042591 Ga0466692_091671 Ga0466692_091671_1331_2119 262
22 3300042593 Ga0466691_026622 Ga0466691_026622_139_927 262
23 3300042593 Ga0466691_174285 Ga0466691_174285_127_915 262
24 3300042596 Ga0466696_056254 Ga0466696_056254_443_1231 262
25 3300042597 Ga0466699_043555 Ga0466699_043555_349_1137 262
26 3300042597 Ga0466699_100033 Ga0466699_100033_108_896 262
27 3300042597 Ga0466699_339349 Ga0466699_339349_471_1259 262
28 3300042602 Ga0466713_132512 Ga0466713_132512_5460_6248 262
29 3300042605 Ga0466716_149710 Ga0466716_149710_309_1097 262
30 3300042605 Ga0466716_268198 Ga0466716_268198_334_1122 262
31 3300042606 Ga0466719_356694 Ga0466719_356694_1884_2672 262
32 3300042607 Ga0466720_125050 Ga0466720_125050_295_1083 262
33 3300042610 Ga0466698_153568 Ga0466698_153568_901_1689 262
34 3300042610 Ga0466698_476759 Ga0466698_476759_124_912 262
35 3300042612 Ga0466705_181546 Ga0466705_181546_248_1036 262
36 3300042614 Ga0466712_108210 Ga0466712_108210_401_1189 262
37 3300042614 Ga0466712_134113 Ga0466712_134113_303_1091 262
38 3300042614 Ga0466712_320575 Ga0466712_320575_2568_3356 262
39 3300042617 Ga0466718_063006 Ga0466718_063006_556_1344 262
40 3300042618 Ga0466723_173659 Ga0466723_173659_3429_4217 262
41 3300042618 Ga0466723_224884 Ga0466723_224884_34_822 262
42 3300042619 Ga0466726_029821 Ga0466726_029821_213_1001 262
43 3300042620 Ga0466728_025870 Ga0466728_025870_1657_2445 262
44 3300042620 Ga0466728_363615 Ga0466728_363615_532_1320 262
45 3300042643 Ga0466704_165143 Ga0466704_165143_21319_22107 262
46 3300042643 Ga0466704_359247 Ga0466704_359247_181_969 262
47 3300042643 Ga0466704_581012 Ga0466704_581012_35_823 262
48 3300042652 Ga0466708_131864 Ga0466708_131864_14396_15184 262
49 3300000089 AustNasuHG_c1041361 AustNasuHG_10413613 263
50 3300002449 JGI24698J34947_10043724 JGI24698J34947_100437243 263
51 3300002462 JGI24702J35022_10044760 JGI24702J35022_100447603 263
52 3300010049 Ga0123356_10395928 Ga0123356_103959283 263
53 3300041968 Ga0456237_0004327 Ga0456237_0004327_992_1783 263
54 3300042596 Ga0466696_027854 Ga0466696_027854_1139_1930 263
55 3300042605 Ga0466716_071685 Ga0466716_071685_173_964 263
56 3300042605 Ga0466716_376268 Ga0466716_376268_1881_2672 263
57 3300042606 Ga0466719_559061 Ga0466719_559061_1174_1965 263
58 3300042612 Ga0466705_203421 Ga0466705_203421_120_911 263
59 3300042618 Ga0466723_101325 Ga0466723_101325_4009_4800 263
60 3300042643 Ga0466704_011816 Ga0466704_011816_144_935 263
61 3300042643 Ga0466704_618150 Ga0466704_618150_2795_3586 263
62 3300042655 Ga0466727_106591 Ga0466727_106591_3217_4008 263
63 iso_pr_bacteria 2820013017 2820013056 263
64 3300000089 AustNasuHG_c1019706 AustNasuHG_10197062 264
65 3300000089 AustNasuHG_c1039551 AustNasuHG_10395512 264
66 3300002449 JGI24698J34947_10002111 JGI24698J34947_1000211111 264
67 3300002450 JGI24695J34938_10027827 JGI24695J34938_100278272 264
68 3300002462 JGI24702J35022_10008525 JGI24702J35022_100085256 264
69 3300002834 JGI24696J40584_12952219 JGI24696J40584_129522192 264
70 3300042592 Ga0466693_445965 Ga0466693_445965_292_1086 264
71 3300042594 Ga0466694_053447 Ga0466694_053447_4898_5692 264
72 3300042617 Ga0466718_162904 Ga0466718_162904_8805_9599 264
73 3300042620 Ga0466728_060242 Ga0466728_060242_482_1276 264
74 3300042652 Ga0466708_239909 Ga0466708_239909_265_1059 264
75 3300002462 JGI24702J35022_10194879 JGI24702J35022_101948791 265
76 3300010049 Ga0123356_10532855 Ga0123356_105328552 265
77 3300042597 Ga0466699_189567 Ga0466699_189567_125_922 265
78 3300042607 Ga0466720_028724 Ga0466720_028724_4715_5512 265
79 3300042607 Ga0466720_098555 Ga0466720_098555_6165_6962 265
80 3300042615 Ga0466711_220239 Ga0466711_220239_2267_3064 265
81 3300042619 Ga0466726_133582 Ga0466726_133582_516_1313 265
82 3300042624 Ga0466735_050050 Ga0466735_050050_318_1115 265
83 3300002449 JGI24698J34947_10034130 JGI24698J34947_100341301 266
84 3300010049 Ga0123356_10541160 Ga0123356_105411602 266
85 3300024493 Ga0264413_136552 Ga0264413_1365523 266
86 3300042619 Ga0466726_238348 Ga0466726_238348_455_1255 266
87 3300002449 JGI24698J34947_10005914 JGI24698J34947_100059143 267
88 3300005201 Ga0072941_1008934 Ga0072941_10089345 267
89 3300005201 Ga0072941_1117493 Ga0072941_11174932 267
90 3300010049 Ga0123356_10327188 Ga0123356_103271881 267
91 3300024493 Ga0264413_112976 Ga0264413_1129763 267
92 3300042610 Ga0466698_199269 Ga0466698_199269_887_1690 267
93 3300042619 Ga0466726_298269 Ga0466726_298269_92_895 267
94 3300042652 Ga0466708_424535 Ga0466708_424535_22_825 267
95 3300000089 AustNasuHG_c1005546 AustNasuHG_10055462 268
96 3300000089 AustNasuHG_c1004778 AustNasuHG_10047782 269
97 3300002462 JGI24702J35022_10113438 JGI24702J35022_101134382 269
98 3300005201 Ga0072941_1036257 Ga0072941_10362575 269
99 3300042619 Ga0466726_071102 Ga0466726_071102_202_1011 269
100 3300042619 Ga0466726_477766 Ga0466726_477766_58_867 269
101 3300000089 AustNasuHG_c1007592 AustNasuHG_10075923 270
102 3300042597 Ga0466699_139974 Ga0466699_139974_31_843 270
103 3300010049 Ga0123356_10001816 Ga0123356_1000181616 271
104 3300042609 Ga0466722_173475 Ga0466722_173475_741_1556 271
105 3300042593 Ga0466691_155550 Ga0466691_155550_2477_3295 272
106 3300042622 Ga0466731_115990 Ga0466731_115990_229_1047 272
107 3300042607 Ga0466720_113108 Ga0466720_113108_1829_2653 274
108 3300042596 Ga0466696_055869 Ga0466696_055869_1721_2548 275
109 3300042596 Ga0466696_293445 Ga0466696_293445_510_1340 276
110 3300042607 Ga0466720_047503 Ga0466720_047503_2816_3646 276
111 3300042643 Ga0466704_303779 Ga0466704_303779_7058_7888 276
112 3300005201 Ga0072941_1053523 Ga0072941_10535232 277
113 3300042615 Ga0466711_026776 Ga0466711_026776_62560_63396 278
114 3300005201 Ga0072941_1015395 Ga0072941_10153953 281
115 3300042606 Ga0466719_507095 Ga0466719_507095_434_1306 281
116 3300042618 Ga0466723_179392 Ga0466723_179392_701_1558 285
117 3300042607 Ga0466720_055701 Ga0466720_055701_5613_6473 286
118 3300042593 Ga0466691_023491 Ga0466691_023491_5167_6057 296
119 3300009784 Ga0123357_10447149 Ga0123357_104471491 302
120 3300042655 Ga0466727_327496 Ga0466727_327496_501_1409 302
121 3300042605 Ga0466716_374904 Ga0466716_374904_11315_12241 308
122 3300042590 Ga0466690_133995 Ga0466690_133995_172_1164 330

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03747 ADP_ribosyl_GH ADP-ribosylglycohydrolase 7 270 0.87

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.86 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.