Protein Family IF02245
Metagenome
Isolate
120
Members
56
Samples
110
Scaffolds
293.29
Avg Length
Representative Sequence
- ID
- 3300009784|Ga0123357_10274749|Ga0123357_102747492
- Length
- 345 aa
- Sequence
- MSRTGYTAFKSGSPEELPYEKLNQTTRKISLKTSGYLGILKAEERRHQMSKTSIRFFDDKEVRAVWDDDSSKWWFSAVDIVGVLSQSTDSRNYWYVLKNRLKKAGSEVLTNCKGFKQMAPDGKHRTTDCLTNDGVIALAKEFPGKKANRFIEWFTYSEDTIDGKSKSKAYALFDSSLLDTIEVGTVKGLQQIHGYLFGGLYDFAGQIRTLNIAKGGFKFAVARFLPETLKTIEQMPDTDFEEIADKYIEMNVAHPFMEGNGRSTRIWLDLILKKRLRLCIDWSQIDKKGYLSAMEKSVANGAQIKSLLQNALTDKINDREVFMKGIDYSYYYEQENDITGDDEK*
Sample Types
Isolate
8.3%
Metagenome
91.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
43.6%
Unclassified
21.8%
Kalotermitidae
21.8%
Termopsidae
5.5%
Passalidae
3.6%
Rhinotermitidae
1.8%
Hodotermitidae
1.8%
Taxonomy
Archaea
3
Bacteria
113
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820084079 | Unclassified Proteobacteria Lab288P4bin103 | Isolate | Unclassified |
| 2 | 2820211246 | Unclassified Kiritimatiellaeota Nt197P3bin96 | Isolate | Unclassified |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 2820671341 | Unclassified Firmicutes Co191P3bin20 | Isolate | Unclassified |
| 11 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 12 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 13 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 14 | 2820813074 | Unclassified Actinobacteria Nt197P3bin52 | Isolate | Unclassified |
| 15 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 16 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 17 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 18 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 19 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 20 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 21 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 22 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 23 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 24 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 25 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 26 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 27 | 2773857697 | Unclassified Methanomassiliicoccaceae Th196P4bin34 | Isolate | Unclassified |
| 28 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 29 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 30 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 31 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 32 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 33 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 34 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 35 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 36 | 2773857679 | Unclassified Methanomassiliicoccaceae Cu122P4bin8 | Isolate | Unclassified |
| 37 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 38 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 39 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 40 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 41 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 42 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 43 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 44 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 45 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 46 | 2820086750 | Unclassified Proteobacteria Lab288P3bin98 | Isolate | Unclassified |
| 47 | 2820462123 | Unclassified Firmicutes Lab288P3bin129 | Isolate | Unclassified |
| 48 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 49 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 50 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 51 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 52 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 53 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 54 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 55 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 56 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_183265 | 3300042612 | Bacteria | 3388 |
| 2 | Ga0466706_125047 | 3300042599 | Bacteria | 6354 |
| 3 | Ga0466700_005216 | 3300042600 | Bacteria | 1756 |
| 4 | Ga0466698_227777 | 3300042610 | Bacteria | 2382 |
| 5 | Ga0123356_10082728 | 3300010049 | Bacteria | 3040 |
| 6 | Ga0123356_10590659 | 3300010049 | Bacteria | 1274 |
| 7 | Ga0123353_10002848 | 3300010167 | Bacteria | 21620 |
| 8 | Ga0123353_10097702 | 3300010167 | Bacteria | 4733 |
| 9 | Ga0123353_10164059 | 3300010167 | Bacteria | 3534 |
| 10 | Ga0466710_026130 | 3300042613 | Bacteria | 1005 |
| 11 | Ga0466726_219204 | 3300042619 | Bacteria | 9354 |
| 12 | Ga0466731_362726 | 3300042622 | Bacteria | 1979 |
| 13 | Ga0466734_036998 | 3300042623 | Bacteria | 1590 |
| 14 | Ga0466704_525205 | 3300042643 | Bacteria | 3464 |
| 15 | Ga0466690_180791 | 3300042590 | Bacteria | 1807 |
| 16 | Ga0466693_106328 | 3300042592 | Bacteria | 2349 |
| 17 | Ga0466691_102347 | 3300042593 | Bacteria | 1408 |
| 18 | IMNBL1DRAFT_c0015014 | 3300000062 | Bacteria | 3381 |
| 19 | JGI24702J35022_10000894 | 3300002462 | Bacteria | 18528 |
| 20 | JGI24705J35276_12195051 | 3300002504 | Bacteria | 1520 |
| 21 | Ga0072940_1192275 | 3300005200 | Bacteria | 984 |
| 22 | Ga0466705_107830 | 3300042612 | Bacteria | 6362 |
| 23 | Ga0466713_008999 | 3300042602 | Bacteria | 1207 |
| 24 | Ga0466713_134397 | 3300042602 | Bacteria | 97168 |
| 25 | Ga0466719_323705 | 3300042606 | Bacteria | 8339 |
| 26 | Ga0466720_180564 | 3300042607 | Bacteria | 3914 |
| 27 | Ga0123353_10193286 | 3300010167 | Bacteria | 3210 |
| 28 | Ga0123353_10553028 | 3300010167 | Bacteria | 1659 |
| 29 | Ga0466715_596626 | 3300042616 | Bacteria | 4959 |
| 30 | Ga0466702_157643 | 3300042635 | Bacteria | 1512 |
| 31 | Ga0466727_242056 | 3300042655 | Bacteria | 12576 |
| 32 | Ga0264413_125474 | 3300024493 | Bacteria | 28962 |
| 33 | Ga0466690_415222 | 3300042590 | Bacteria | 2723 |
| 34 | Ga0466693_044186 | 3300042592 | Bacteria | 1376 |
| 35 | JGI24695J34938_10001111 | 3300002450 | Bacteria | 24278 |
| 36 | Ga0466705_147179 | 3300042612 | Bacteria | 9569 |
| 37 | Ga0466717_246815 | 3300042604 | Bacteria | 1500 |
| 38 | Ga0123353_10087084 | 3300010167 | Bacteria | 5031 |
| 39 | Ga0466715_280399 | 3300042616 | Bacteria | 9359 |
| 40 | Ga0466715_582410 | 3300042616 | Bacteria | 1265 |
| 41 | Ga0466723_229501 | 3300042618 | Bacteria | 4074 |
| 42 | Ga0466731_363326 | 3300042622 | Bacteria | 2250 |
| 43 | Ga0466704_487845 | 3300042643 | Bacteria | 1078 |
| 44 | Ga0466708_015349 | 3300042652 | Bacteria | 9632 |
| 45 | Ga0466694_289466 | 3300042594 | Bacteria | 1346 |
| 46 | Ga0466699_063802 | 3300042597 | Bacteria | 1323 |
| 47 | JGI24695J34938_10002816 | 3300002450 | Bacteria | 12700 |
| 48 | JGI24702J35022_10108942 | 3300002462 | Bacteria | 1522 |
| 49 | Ga0068302_10064761 | 3300005071 | Bacteria | 2515 |
| 50 | Ga0466705_163757 | 3300042612 | Bacteria | 3172 |
| 51 | Ga0466705_268829 | 3300042612 | Bacteria | 2427 |
| 52 | Ga0123353_10951998 | 3300010167 | Unclassified | 1161 |
| 53 | Ga0123353_11122721 | 3300010167 | Bacteria | 1041 |
| 54 | Ga0466711_412373 | 3300042615 | Bacteria | 1147 |
| 55 | Ga0466704_324690 | 3300042643 | Unclassified | 2280 |
| 56 | Ga0466708_015015 | 3300042652 | Bacteria | 16444 |
| 57 | IMNBL1DRAFT_c0048698 | 3300000062 | Bacteria | 1357 |
| 58 | Ga0466701_028663 | 3300042598 | Archaea | 4444 |
| 59 | Ga0466707_137281 | 3300042601 | Bacteria | 1190 |
| 60 | Ga0466707_391832 | 3300042601 | Bacteria | 6856 |
| 61 | Ga0466713_027432 | 3300042602 | Bacteria | 5300 |
| 62 | Ga0466721_117647 | 3300042608 | Unclassified | 1015 |
| 63 | Ga0123357_10274749 | 3300009784 | Bacteria | 1753 |
| 64 | Ga0123355_10747445 | 3300009826 | Bacteria | 1107 |
| 65 | Ga0123356_10156808 | 3300010049 | Bacteria | 2268 |
| 66 | Ga0123353_10314369 | 3300010167 | Bacteria | 2381 |
| 67 | Ga0123354_10367095 | 3300010882 | Unclassified | 1261 |
| 68 | Ga0466711_169981 | 3300042615 | Bacteria | 12126 |
| 69 | Ga0466711_437810 | 3300042615 | Bacteria | 2522 |
| 70 | Ga0466715_056401 | 3300042616 | Bacteria | 1793 |
| 71 | Ga0466726_428163 | 3300042619 | Bacteria | 2088 |
| 72 | Ga0466728_212425 | 3300042620 | Bacteria | 7485 |
| 73 | Ga0466731_289333 | 3300042622 | Bacteria | 23043 |
| 74 | Ga0466708_036680 | 3300042652 | Bacteria | 14829 |
| 75 | Ga0466696_478131 | 3300042596 | Bacteria | 4098 |
| 76 | 2227672939 | 2225789004 | Bacteria | 1889 |
| 77 | Ga0123356_10005206 | 3300010049 | Bacteria | 13295 |
| 78 | Ga0123356_10098099 | 3300010049 | Bacteria | 2805 |
| 79 | Ga0123356_10980975 | 3300010049 | Bacteria | 1015 |
| 80 | Ga0123353_10416083 | 3300010167 | Bacteria | 1994 |
| 81 | Ga0466715_373478 | 3300042616 | Bacteria | 15598 |
| 82 | Ga0466713_125045 | 3300042602 | Bacteria | 5041 |
| 83 | Ga0466717_312070 | 3300042604 | Bacteria | 2819 |
| 84 | Ga0466716_302468 | 3300042605 | Bacteria | 23384 |
| 85 | Ga0123353_10001427 | 3300010167 | Bacteria | 29228 |
| 86 | Ga0466715_270118 | 3300042616 | Bacteria | 3661 |
| 87 | Ga0466731_074379 | 3300042622 | Bacteria | 7103 |
| 88 | Ga0466704_173086 | 3300042643 | Bacteria | 14728 |
| 89 | Ga0466704_384324 | 3300042643 | Bacteria | 2147 |
| 90 | Ga0466708_178773 | 3300042652 | Bacteria | 8613 |
| 91 | Ga0466694_000795 | 3300042594 | Bacteria | 3583 |
| 92 | Ga0466696_289123 | 3300042596 | Bacteria | 1562 |
| 93 | JGI24695J34938_10027419 | 3300002450 | Bacteria | 2692 |
| 94 | JGI24695J34938_10034625 | 3300002450 | Bacteria | 2316 |
| 95 | Ga0123357_10000533 | 3300009784 | Bacteria | 37401 |
| 96 | Ga0466705_308341 | 3300042612 | Bacteria | 1996 |
| 97 | Ga0466700_419497 | 3300042600 | Bacteria | 5992 |
| 98 | Ga0466698_465129 | 3300042610 | Bacteria | 4142 |
| 99 | Ga0123357_10043522 | 3300009784 | Bacteria | 6101 |
| 100 | Ga0123357_10113300 | 3300009784 | Bacteria | 3448 |
| 101 | Ga0123353_10000222 | 3300010167 | Bacteria | 72156 |
| 102 | Ga0123353_10009456 | 3300010167 | Bacteria | 13466 |
| 103 | Ga0415639_006505 | 3300038395 | Bacteria | 2412 |
| 104 | Ga0466657_072008 | 3300042582 | Bacteria | 27064 |
| 105 | Ga0466692_154281 | 3300042591 | Bacteria | 3148 |
| 106 | Ga0466693_017167 | 3300042592 | Bacteria | 1073 |
| 107 | Ga0466693_227863 | 3300042592 | Bacteria | 3679 |
| 108 | Ga0466696_132750 | 3300042596 | Bacteria | 1291 |
| 109 | Ga0466699_370029 | 3300042597 | Bacteria | 1197 |
| 110 | Ga0068302_10006116 | 3300005071 | Bacteria | 10405 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300010167 | Ga0123353_10164059 | Ga0123353_101640593 | 278 |
| 2 | 3300042592 | Ga0466693_017167 | Ga0466693_017167_20_913 | 279 |
| 3 | 3300042590 | Ga0466690_180791 | Ga0466690_180791_838_1725 | 281 |
| 4 | 3300042592 | Ga0466693_106328 | Ga0466693_106328_253_1143 | 283 |
| 5 | 3300042594 | Ga0466694_289466 | Ga0466694_289466_142_1032 | 283 |
| 6 | 3300010167 | Ga0123353_10314369 | Ga0123353_103143693 | 284 |
| 7 | 3300042608 | Ga0466721_117647 | Ga0466721_117647_92_988 | 284 |
| 8 | 3300042592 | Ga0466693_227863 | Ga0466693_227863_2017_2874 | 285 |
| 9 | 3300038395 | Ga0415639_006505 | Ga0415639_006505_749_1609 | 286 |
| 10 | 3300042604 | Ga0466717_312070 | Ga0466717_312070_297_1181 | 286 |
| 11 | 3300042643 | Ga0466704_525205 | Ga0466704_525205_811_1671 | 286 |
| 12 | iso_pr_bacteria | 2820776227 | 2820776644 | 286 |
| 13 | 3300002450 | JGI24695J34938_10027419 | JGI24695J34938_100274193 | 287 |
| 14 | 3300009784 | Ga0123357_10000533 | Ga0123357_1000053334 | 287 |
| 15 | 3300010049 | Ga0123356_10098099 | Ga0123356_100980992 | 287 |
| 16 | 3300010167 | Ga0123353_10553028 | Ga0123353_105530282 | 287 |
| 17 | 3300010167 | Ga0123353_10951998 | Ga0123353_109519982 | 287 |
| 18 | 3300010882 | Ga0123354_10367095 | Ga0123354_103670952 | 287 |
| 19 | 3300042591 | Ga0466692_154281 | Ga0466692_154281_1591_2454 | 287 |
| 20 | 3300042596 | Ga0466696_289123 | Ga0466696_289123_380_1243 | 287 |
| 21 | 3300042597 | Ga0466699_063802 | Ga0466699_063802_42_905 | 287 |
| 22 | 3300042605 | Ga0466716_302468 | Ga0466716_302468_19596_20459 | 287 |
| 23 | 3300042610 | Ga0466698_227777 | Ga0466698_227777_1449_2312 | 287 |
| 24 | 3300042615 | Ga0466711_169981 | Ga0466711_169981_10136_10999 | 287 |
| 25 | 3300042622 | Ga0466731_289333 | Ga0466731_289333_21631_22494 | 287 |
| 26 | 3300042635 | Ga0466702_157643 | Ga0466702_157643_423_1286 | 287 |
| 27 | 3300000062 | IMNBL1DRAFT_c0015014 | IMNBL1DRAFT_00150143 | 288 |
| 28 | 3300002450 | JGI24695J34938_10001111 | JGI24695J34938_1000111122 | 288 |
| 29 | 3300010049 | Ga0123356_10005206 | Ga0123356_100052064 | 288 |
| 30 | 3300010049 | Ga0123356_10156808 | Ga0123356_101568082 | 288 |
| 31 | 3300010167 | Ga0123353_10001427 | Ga0123353_100014272 | 288 |
| 32 | 3300042593 | Ga0466691_102347 | Ga0466691_102347_350_1216 | 288 |
| 33 | 3300042599 | Ga0466706_125047 | Ga0466706_125047_4124_4990 | 288 |
| 34 | 3300042612 | Ga0466705_107830 | Ga0466705_107830_5328_6194 | 288 |
| 35 | 3300042612 | Ga0466705_183265 | Ga0466705_183265_721_1587 | 288 |
| 36 | 3300042618 | Ga0466723_229501 | Ga0466723_229501_614_1480 | 288 |
| 37 | 3300042622 | Ga0466731_362726 | Ga0466731_362726_827_1717 | 289 |
| 38 | iso_pr_bacteria | 2820084079 | 2820084204 | 289 |
| 39 | iso_pr_bacteria | 2820086750 | 2820087624 | 289 |
| 40 | 3300005071 | Ga0068302_10006116 | Ga0068302_1000611612 | 290 |
| 41 | 3300010167 | Ga0123353_10000222 | Ga0123353_1000022246 | 290 |
| 42 | 3300042597 | Ga0466699_370029 | Ga0466699_370029_193_1065 | 290 |
| 43 | 3300042598 | Ga0466701_028663 | Ga0466701_028663_2154_3026 | 290 |
| 44 | 3300042601 | Ga0466707_391832 | Ga0466707_391832_252_1124 | 290 |
| 45 | 3300042607 | Ga0466720_180564 | Ga0466720_180564_1973_2845 | 290 |
| 46 | 3300005071 | Ga0068302_10064761 | Ga0068302_100647612 | 291 |
| 47 | 3300042610 | Ga0466698_465129 | Ga0466698_465129_1620_2495 | 291 |
| 48 | iso_pr_bacteria | 2820211246 | 2820211477 | 291 |
| 49 | 3300042594 | Ga0466694_000795 | Ga0466694_000795_1326_2204 | 292 |
| 50 | 3300042602 | Ga0466713_008999 | Ga0466713_008999_121_999 | 292 |
| 51 | 3300042613 | Ga0466710_026130 | Ga0466710_026130_92_970 | 292 |
| 52 | 3300042615 | Ga0466711_437810 | Ga0466711_437810_653_1531 | 292 |
| 53 | 3300042622 | Ga0466731_363326 | Ga0466731_363326_1288_2184 | 292 |
| 54 | 3300009784 | Ga0123357_10043522 | Ga0123357_100435223 | 293 |
| 55 | 3300010167 | Ga0123353_11122721 | Ga0123353_111227211 | 293 |
| 56 | 3300042582 | Ga0466657_072008 | Ga0466657_072008_2397_3278 | 293 |
| 57 | 3300042655 | Ga0466727_242056 | Ga0466727_242056_11391_12272 | 293 |
| 58 | 3300010049 | Ga0123356_10980975 | Ga0123356_109809751 | 294 |
| 59 | 3300042600 | Ga0466700_005216 | Ga0466700_005216_643_1527 | 294 |
| 60 | 3300042600 | Ga0466700_419497 | Ga0466700_419497_246_1130 | 294 |
| 61 | 3300042606 | Ga0466719_323705 | Ga0466719_323705_5896_6780 | 294 |
| 62 | 3300042652 | Ga0466708_015349 | Ga0466708_015349_3743_4627 | 294 |
| 63 | iso_pr_bacteria | 2781125647 | 2781303882 | 294 |
| 64 | iso_pu_archaea | 2773857679 | 2774150052 | 294 |
| 65 | 3300000062 | IMNBL1DRAFT_c0048698 | IMNBL1DRAFT_00486981 | 295 |
| 66 | 3300002450 | JGI24695J34938_10002816 | JGI24695J34938_1000281614 | 295 |
| 67 | 3300010049 | Ga0123356_10590659 | Ga0123356_105906592 | 295 |
| 68 | 3300024493 | Ga0264413_125474 | Ga0264413_12547416 | 295 |
| 69 | 3300042596 | Ga0466696_132750 | Ga0466696_132750_251_1138 | 295 |
| 70 | 3300042604 | Ga0466717_246815 | Ga0466717_246815_296_1183 | 295 |
| 71 | 3300042612 | Ga0466705_268829 | Ga0466705_268829_1282_2169 | 295 |
| 72 | 3300042616 | Ga0466715_270118 | Ga0466715_270118_391_1278 | 295 |
| 73 | 3300042616 | Ga0466715_280399 | Ga0466715_280399_7068_7955 | 295 |
| 74 | 3300042616 | Ga0466715_373478 | Ga0466715_373478_11381_12268 | 295 |
| 75 | 3300042619 | Ga0466726_428163 | Ga0466726_428163_284_1171 | 295 |
| 76 | 3300042620 | Ga0466728_212425 | Ga0466728_212425_1284_2171 | 295 |
| 77 | 3300042622 | Ga0466731_074379 | Ga0466731_074379_5221_6108 | 295 |
| 78 | 3300042643 | Ga0466704_324690 | Ga0466704_324690_56_943 | 295 |
| 79 | 3300042652 | Ga0466708_015015 | Ga0466708_015015_10633_11520 | 295 |
| 80 | 3300042652 | Ga0466708_036680 | Ga0466708_036680_4770_5657 | 295 |
| 81 | 3300042652 | Ga0466708_178773 | Ga0466708_178773_3755_4642 | 295 |
| 82 | 3300002504 | JGI24705J35276_12195051 | JGI24705J35276_121950512 | 296 |
| 83 | 3300005200 | Ga0072940_1192275 | Ga0072940_11922751 | 296 |
| 84 | 3300009784 | Ga0123357_10113300 | Ga0123357_101133003 | 296 |
| 85 | 3300009826 | Ga0123355_10747445 | Ga0123355_107474452 | 296 |
| 86 | 3300042590 | Ga0466690_415222 | Ga0466690_415222_132_1022 | 296 |
| 87 | 3300042602 | Ga0466713_134397 | Ga0466713_134397_11278_12168 | 296 |
| 88 | 3300042612 | Ga0466705_147179 | Ga0466705_147179_5554_6444 | 296 |
| 89 | 3300042612 | Ga0466705_163757 | Ga0466705_163757_210_1100 | 296 |
| 90 | 3300042612 | Ga0466705_308341 | Ga0466705_308341_774_1664 | 296 |
| 91 | 3300042616 | Ga0466715_056401 | Ga0466715_056401_581_1471 | 296 |
| 92 | 3300042616 | Ga0466715_596626 | Ga0466715_596626_3722_4612 | 296 |
| 93 | 3300042619 | Ga0466726_219204 | Ga0466726_219204_7648_8538 | 296 |
| 94 | 3300042623 | Ga0466734_036998 | Ga0466734_036998_274_1164 | 296 |
| 95 | 3300042643 | Ga0466704_173086 | Ga0466704_173086_3939_4829 | 296 |
| 96 | 3300042643 | Ga0466704_384324 | Ga0466704_384324_785_1675 | 296 |
| 97 | 3300042643 | Ga0466704_487845 | Ga0466704_487845_127_1017 | 296 |
| 98 | iso_pr_bacteria | 2820671341 | 2820671753 | 296 |
| 99 | iso_pr_bacteria | 2820813074 | 2820814047 | 296 |
| 100 | 3300002462 | JGI24702J35022_10108942 | JGI24702J35022_101089421 | 297 |
| 101 | 3300010167 | Ga0123353_10009456 | Ga0123353_100094565 | 297 |
| 102 | 3300010167 | Ga0123353_10193286 | Ga0123353_101932864 | 297 |
| 103 | 3300042616 | Ga0466715_582410 | Ga0466715_582410_175_1068 | 297 |
| 104 | 3300010167 | Ga0123353_10416083 | Ga0123353_104160832 | 298 |
| 105 | 3300042592 | Ga0466693_044186 | Ga0466693_044186_153_1049 | 298 |
| 106 | 3300042601 | Ga0466707_137281 | Ga0466707_137281_273_1169 | 298 |
| 107 | 3300042602 | Ga0466713_125045 | Ga0466713_125045_223_1119 | 298 |
| 108 | 3300010049 | Ga0123356_10082728 | Ga0123356_100827283 | 299 |
| 109 | 3300010167 | Ga0123353_10087084 | Ga0123353_100870843 | 299 |
| 110 | 2225789004 | 2227672939 | 2228279178 | 300 |
| 111 | 3300002450 | JGI24695J34938_10034625 | JGI24695J34938_100346252 | 300 |
| 112 | 3300042596 | Ga0466696_478131 | Ga0466696_478131_1813_2715 | 300 |
| 113 | iso_pr_bacteria | 2820462123 | 2820462134 | 300 |
| 114 | iso_pu_archaea | 2773857697 | 2774174841 | 300 |
| 115 | 3300002462 | JGI24702J35022_10000894 | JGI24702J35022_1000089413 | 301 |
| 116 | 3300010167 | Ga0123353_10002848 | Ga0123353_1000284812 | 301 |
| 117 | 3300042602 | Ga0466713_027432 | Ga0466713_027432_1045_1953 | 302 |
| 118 | 3300010167 | Ga0123353_10097702 | Ga0123353_100977024 | 319 |
| 119 | 3300042615 | Ga0466711_412373 | Ga0466711_412373_94_1107 | 337 |
| 120 | 3300009784 | Ga0123357_10274749 | Ga0123357_102747492 | 345 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.64 | 0.71 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.