Protein Family IF02238

Metagenome Isolate
151 Members
38 Samples
148 Scaffolds
397.4 Avg Length

🧬 Representative Sequence

ID
3300009784|Ga0123357_10219322|Ga0123357_102193222
Length
450 aa
Sequence
VKLAILGGSFNPVHIGHLFLADSVATGLGYDRVILVPAFQSPFKAGAEGASPQDRMEMLAASIAADPRLTIDDCEIRREGVSYTIDTLKDIIARYLPTGKPGLILGDDLASTFHNWRSPGEIAELAEIIIARRVLDTPLSPKGEGSEWNHGSPAGSPAGGDEYACKEDSRAREGPGTFPYPYRALDNEIINVSSRQVREKIGRFDAWRYLVPSGARNIIEDRGLYGFSGPGIRQSFRTGESVSGGESAPAVLFGDSRGLTETIVRLENDVRSILSPGRFMHSRNTALQVWDLCRRFGIDPQKGYLAGIAHDMCKSLGEKELFRLARADGGSISKLEQRKPGLLHARAAAVQLKRKYGIGDRDVLDAIRYHTTGTRDMNDLAKIVYIADKIEVGRPGIEASLRELKESADLETLFAAVLNNTVAFLRSRELDISYGTKRLLSAMHKRNSL*

📊 Sample Types

Isolate 2.0%
Metagenome 98.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 36.8%
Termitidae 36.8%
Unclassified 15.8%
Rhinotermitidae 7.9%
Termopsidae 2.6%

🌳 Taxonomy

Archaea 0
Bacteria 147
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
2 2781125652 Treponema sp. Cu122P5bin1 Isolate Unclassified
3 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
4 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
5 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
6 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
7 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
8 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
9 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
10 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
11 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
12 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
13 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
14 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
15 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
16 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
17 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
18 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
19 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
20 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
21 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
22 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
23 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
24 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
25 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
26 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
27 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
28 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
29 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
30 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
31 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
32 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
33 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
34 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
35 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
36 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
37 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
38 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_211043 3300042612 Bacteria 3138
2 Ga0466694_245051 3300042594 Bacteria 1614
3 Ga0466696_216510 3300042596 Bacteria 2299
4 Ga0466696_265916 3300042596 Bacteria 7413
5 Ga0466712_050010 3300042614 Bacteria 6772
6 Ga0466712_130896 3300042614 Bacteria 2807
7 Ga0466723_068472 3300042618 Bacteria 6995
8 Ga0466728_029165 3300042620 Bacteria 14439
9 Ga0466728_270174 3300042620 Bacteria 3006
10 Ga0466728_414620 3300042620 Bacteria 3600
11 Ga0123353_10331386 3300010167 Bacteria 2304
12 Ga0466707_016082 3300042601 Bacteria 1714
13 Ga0466720_089281 3300042607 Bacteria 1699
14 Ga0466703_283225 3300042636 Bacteria 6229
15 Ga0466703_422769 3300042636 Bacteria 16643
16 Ga0466704_204218 3300042643 Bacteria 13888
17 Ga0466704_504387 3300042643 Bacteria 19855
18 Ga0466708_437332 3300042652 Bacteria 8785
19 Ga0466705_101001 3300042612 Bacteria 2084
20 Ga0466705_207149 3300042612 Bacteria 11213
21 Ga0466690_005234 3300042590 Bacteria 9620
22 Ga0466692_190614 3300042591 Bacteria 21035
23 Ga0466699_056525 3300042597 Unclassified 2929
24 Ga0466699_404426 3300042597 Bacteria 1763
25 Ga0466715_065782 3300042616 Bacteria 6945
26 Ga0466728_015487 3300042620 Bacteria 17071
27 Ga0123357_10109183 3300009784 Bacteria 3535
28 Ga0123355_10135464 3300009826 Bacteria 3784
29 Ga0466707_164406 3300042601 Bacteria 2233
30 Ga0466719_286417 3300042606 Bacteria 62956
31 Ga0466719_541293 3300042606 Bacteria 5960
32 Ga0466720_157778 3300042607 Bacteria 10739
33 Ga0466709_066076 3300042648 Bacteria 20720
34 Ga0466709_137960 3300042648 Bacteria 14959
35 Ga0466709_269965 3300042648 Bacteria 2911
36 Ga0466708_101893 3300042652 Bacteria 12133
37 JGI24698J34947_10013389 3300002449 Unclassified 4479
38 Ga0068305_10173101 3300005083 Bacteria 35194
39 Ga0466705_217785 3300042612 Bacteria 9980
40 Ga0466690_353099 3300042590 Bacteria 4572
41 Ga0466690_426217 3300042590 Bacteria 2113
42 Ga0466691_137989 3300042593 Bacteria 6566
43 Ga0466696_246247 3300042596 Bacteria 10396
44 Ga0466696_371533 3300042596 Bacteria 2219
45 Ga0466699_056422 3300042597 Bacteria 6374
46 Ga0466711_229884 3300042615 Bacteria 15610
47 Ga0466711_289524 3300042615 Bacteria 53110
48 Ga0466728_312536 3300042620 Bacteria 5478
49 Ga0123353_10323100 3300010167 Bacteria 2341
50 Ga0466713_107241 3300042602 Bacteria 3112
51 Ga0466703_020390 3300042636 Bacteria 20134
52 Ga0466708_112988 3300042652 Bacteria 3130
53 Ga0466708_236730 3300042652 Bacteria 12750
54 Ga0466705_176508 3300042612 Bacteria 9104
55 Ga0466691_119958 3300042593 Bacteria 6360
56 Ga0466696_067834 3300042596 Bacteria 5394
57 Ga0466699_035974 3300042597 Bacteria 2480
58 Ga0466699_273395 3300042597 Bacteria 3320
59 Ga0466705_405133 3300042612 Bacteria 2513
60 Ga0466705_423543 3300042612 Bacteria 4670
61 Ga0466723_012087 3300042618 Bacteria 2597
62 Ga0466723_012293 3300042618 Bacteria 4804
63 Ga0466723_088491 3300042618 Bacteria 13099
64 Ga0466723_107104 3300042618 Bacteria 6262
65 Ga0466728_412044 3300042620 Bacteria 2368
66 Ga0466729_016682 3300042621 Bacteria 1643
67 Ga0123356_10335483 3300010049 Bacteria 1630
68 Ga0466719_406469 3300042606 Bacteria 10049
69 Ga0466703_072751 3300042636 Bacteria 7973
70 Ga0466704_564294 3300042643 Bacteria 10525
71 Ga0466708_386703 3300042652 Bacteria 27535
72 Ga0074263_100859 3300005485 Bacteria 1439
73 Ga0466692_023781 3300042591 Bacteria 21532
74 Ga0466692_066607 3300042591 Bacteria 1726
75 Ga0466691_007663 3300042593 Bacteria 8719
76 Ga0466705_527441 3300042612 Bacteria 2255
77 Ga0466715_092572 3300042616 Bacteria 11227
78 Ga0466715_201361 3300042616 Bacteria 6489
79 Ga0466715_306093 3300042616 Unclassified 3931
80 Ga0466728_065455 3300042620 Bacteria 10146
81 Ga0466728_396279 3300042620 Bacteria 2685
82 Ga0466716_001080 3300042605 Bacteria 7359
83 Ga0466716_496261 3300042605 Bacteria 1603
84 Ga0466703_132099 3300042636 Bacteria 29234
85 Ga0466703_257353 3300042636 Bacteria 13035
86 JGI24702J35022_10001485 3300002462 Bacteria 14553
87 JGI24702J35022_10022030 3300002462 Bacteria 3453
88 Ga0466705_054669 3300042612 Bacteria 14933
89 Ga0466732_018499 3300042656 Bacteria 1732
90 Ga0415639_023283 3300038395 Bacteria 6428
91 Ga0466691_061889 3300042593 Bacteria 7226
92 Ga0466696_368836 3300042596 Bacteria 4158
93 Ga0466715_155138 3300042616 Bacteria 4187
94 Ga0466723_025521 3300042618 Unclassified 2867
95 Ga0466723_076357 3300042618 Bacteria 13425
96 Ga0466723_132418 3300042618 Bacteria 6362
97 Ga0466723_295027 3300042618 Bacteria 11999
98 Ga0466723_369581 3300042618 Bacteria 64268
99 Ga0123357_10219322 3300009784 Bacteria 2114
100 Ga0466722_136339 3300042609 Bacteria 31433
101 Ga0466703_153577 3300042636 Bacteria 30864
102 Ga0466704_002963 3300042643 Bacteria 15827
103 Ga0466704_123376 3300042643 Bacteria 5853
104 Ga0466704_569051 3300042643 Bacteria 1531
105 Ga0466708_116392 3300042652 Bacteria 2812
106 JGI24695J34938_10002475 3300002450 Bacteria 14085
107 Ga0068305_10013479 3300005083 Bacteria 16490
108 Ga0074263_105758 3300005485 Bacteria 1551
109 Ga0466691_130794 3300042593 Bacteria 27270
110 Ga0466694_297967 3300042594 Bacteria 2175
111 Ga0466699_117382 3300042597 Bacteria 7366
112 Ga0466711_053127 3300042615 Bacteria 43418
113 Ga0466715_337854 3300042616 Bacteria 6518
114 Ga0123357_10044679 3300009784 Bacteria 6014
115 Ga0123353_10661388 3300010167 Bacteria 1476
116 Ga0466719_225394 3300042606 Bacteria 70315
117 Ga0466719_357995 3300042606 Bacteria 2120
118 Ga0466719_419712 3300042606 Bacteria 3875
119 Ga0466720_076308 3300042607 Bacteria 13359
120 Ga0466703_249883 3300042636 Bacteria 4505
121 Ga0466703_416155 3300042636 Bacteria 14576
122 Ga0466704_143666 3300042643 Bacteria 20926
123 Ga0466704_411029 3300042643 Bacteria 56242
124 Ga0466704_555238 3300042643 Bacteria 15816
125 Ga0466708_177332 3300042652 Bacteria 7585
126 Ga0466705_045890 3300042612 Bacteria 3772
127 Ga0466705_128262 3300042612 Bacteria 15574
128 Ga0466705_156372 3300042612 Bacteria 5377
129 Ga0466732_253716 3300042656 Bacteria 3592
130 Ga0466691_225301 3300042593 Bacteria 13445
131 Ga0466694_015206 3300042594 Bacteria 16868
132 Ga0466696_399139 3300042596 Bacteria 8907
133 Ga0466699_441402 3300042597 Bacteria 1249
134 Ga0466711_250812 3300042615 Bacteria 11619
135 Ga0466711_253954 3300042615 Bacteria 3775
136 Ga0466715_333621 3300042616 Bacteria 6602
137 Ga0466723_132263 3300042618 Bacteria 24648
138 Ga0466728_032581 3300042620 Bacteria 5309
139 Ga0466719_089683 3300042606 Bacteria 7170
140 Ga0466703_255570 3300042636 Bacteria 3368
141 Ga0466704_235102 3300042643 Bacteria 10892
142 Ga0466704_412182 3300042643 Bacteria 4622
143 Ga0466708_109511 3300042652 Bacteria 32313
144 Ga0466708_163864 3300042652 Bacteria 25092
145 Ga0466708_318237 3300042652 Bacteria 2812
146 Ga0466727_022593 3300042655 Bacteria 6490
147 Ga0466727_257981 3300042655 Bacteria 1846
148 JGI24702J35022_10069625 3300002462 Bacteria 1893

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042597 Ga0466699_441402 Ga0466699_441402_120_1193 357
2 3300005485 Ga0074263_100859 Ga0074263_1008592 364
3 3300042615 Ga0466711_053127 Ga0466711_053127_39801_40919 372
4 3300042606 Ga0466719_286417 Ga0466719_286417_34735_35937 374
5 3300042636 Ga0466703_132099 Ga0466703_132099_8596_9726 376
6 3300042643 Ga0466704_143666 Ga0466704_143666_4760_5890 376
7 3300042620 Ga0466728_015487 Ga0466728_015487_11877_13052 377
8 3300042596 Ga0466696_216510 Ga0466696_216510_136_1275 379
9 3300042606 Ga0466719_357995 Ga0466719_357995_758_1897 379
10 3300042612 Ga0466705_405133 Ga0466705_405133_558_1784 379
11 3300042643 Ga0466704_123376 Ga0466704_123376_2849_4045 382
12 3300042652 Ga0466708_109511 Ga0466708_109511_25883_27064 382
13 3300005083 Ga0068305_10013479 Ga0068305_100134798 384
14 3300042602 Ga0466713_107241 Ga0466713_107241_210_1367 385
15 3300042612 Ga0466705_527441 Ga0466705_527441_23_1207 385
16 3300042615 Ga0466711_289524 Ga0466711_289524_6054_7259 385
17 3300005083 Ga0068305_10173101 Ga0068305_1017310120 386
18 3300042616 Ga0466715_155138 Ga0466715_155138_752_1948 386
19 3300042636 Ga0466703_249883 Ga0466703_249883_2418_3614 386
20 3300042636 Ga0466703_257353 Ga0466703_257353_11498_12721 386
21 3300042643 Ga0466704_412182 Ga0466704_412182_2533_3693 386
22 3300042612 Ga0466705_423543 Ga0466705_423543_2497_3660 387
23 3300042616 Ga0466715_201361 Ga0466715_201361_3289_4452 387
24 3300042616 Ga0466715_337854 Ga0466715_337854_1358_2548 387
25 3300042620 Ga0466728_029165 Ga0466728_029165_5130_6320 387
26 3300042620 Ga0466728_312536 Ga0466728_312536_1251_2474 387
27 3300010167 Ga0123353_10661388 Ga0123353_106613881 388
28 3300042596 Ga0466696_399139 Ga0466696_399139_7553_8719 388
29 3300042601 Ga0466707_164406 Ga0466707_164406_96_1262 388
30 3300042621 Ga0466729_016682 Ga0466729_016682_62_1228 388
31 3300042591 Ga0466692_023781 Ga0466692_023781_15691_16860 389
32 3300042614 Ga0466712_130896 Ga0466712_130896_1290_2459 389
33 3300042618 Ga0466723_012293 Ga0466723_012293_2398_3594 389
34 3300042643 Ga0466704_235102 Ga0466704_235102_3201_4370 389
35 3300042655 Ga0466727_022593 Ga0466727_022593_4123_5292 389
36 3300002449 JGI24698J34947_10013389 JGI24698J34947_100133895 390
37 3300042594 Ga0466694_245051 Ga0466694_245051_156_1328 390
38 3300042594 Ga0466694_297967 Ga0466694_297967_776_1948 390
39 3300042606 Ga0466719_541293 Ga0466719_541293_4131_5303 390
40 3300042609 Ga0466722_136339 Ga0466722_136339_27186_28382 390
41 3300042618 Ga0466723_076357 Ga0466723_076357_4240_5454 391
42 3300042618 Ga0466723_088491 Ga0466723_088491_2133_3308 391
43 3300042620 Ga0466728_414620 Ga0466728_414620_55_1230 391
44 3300042618 Ga0466723_025521 Ga0466723_025521_576_1859 392
45 3300042618 Ga0466723_107104 Ga0466723_107104_4735_5913 392
46 3300042593 Ga0466691_130794 Ga0466691_130794_23850_25031 393
47 3300042606 Ga0466719_225394 Ga0466719_225394_33922_35103 393
48 3300042612 Ga0466705_176508 Ga0466705_176508_510_1691 393
49 3300042612 Ga0466705_207149 Ga0466705_207149_2670_3851 393
50 3300042615 Ga0466711_229884 Ga0466711_229884_12105_13319 393
51 3300042618 Ga0466723_132263 Ga0466723_132263_17144_18325 393
52 3300042636 Ga0466703_020390 Ga0466703_020390_1415_2596 393
53 3300042643 Ga0466704_204218 Ga0466704_204218_10342_11523 393
54 3300042652 Ga0466708_386703 Ga0466708_386703_20338_21519 393
55 3300042652 Ga0466708_437332 Ga0466708_437332_5080_6261 393
56 3300042597 Ga0466699_035974 Ga0466699_035974_439_1683 394
57 3300042616 Ga0466715_092572 Ga0466715_092572_8683_9867 394
58 3300042656 Ga0466732_253716 Ga0466732_253716_1398_2582 394
59 3300042612 Ga0466705_045890 Ga0466705_045890_272_1459 395
60 3300042643 Ga0466704_555238 Ga0466704_555238_5318_6532 395
61 3300042652 Ga0466708_163864 Ga0466708_163864_21350_22537 395
62 3300042594 Ga0466694_015206 Ga0466694_015206_12633_13823 396
63 3300042605 Ga0466716_496261 Ga0466716_496261_359_1549 396
64 3300042612 Ga0466705_101001 Ga0466705_101001_97_1287 396
65 3300042612 Ga0466705_156372 Ga0466705_156372_2908_4098 396
66 3300042620 Ga0466728_065455 Ga0466728_065455_6485_7675 396
67 3300042636 Ga0466703_255570 Ga0466703_255570_718_1956 396
68 3300042643 Ga0466704_564294 Ga0466704_564294_6466_7686 396
69 3300010049 Ga0123356_10335483 Ga0123356_103354832 397
70 3300042590 Ga0466690_426217 Ga0466690_426217_42_1235 397
71 3300042596 Ga0466696_067834 Ga0466696_067834_1977_3170 397
72 3300042615 Ga0466711_253954 Ga0466711_253954_122_1354 397
73 3300042636 Ga0466703_283225 Ga0466703_283225_2793_3986 397
74 3300042648 Ga0466709_066076 Ga0466709_066076_2589_3782 397
75 3300042591 Ga0466692_190614 Ga0466692_190614_2915_4111 398
76 3300042593 Ga0466691_061889 Ga0466691_061889_3727_4923 398
77 3300042593 Ga0466691_119958 Ga0466691_119958_2841_4037 398
78 3300042593 Ga0466691_137989 Ga0466691_137989_2555_3751 398
79 3300042593 Ga0466691_225301 Ga0466691_225301_5689_6885 398
80 3300042612 Ga0466705_128262 Ga0466705_128262_12948_14144 398
81 3300042616 Ga0466715_333621 Ga0466715_333621_2433_3629 398
82 3300042618 Ga0466723_012087 Ga0466723_012087_450_1646 398
83 3300042618 Ga0466723_132418 Ga0466723_132418_4714_5910 398
84 3300042620 Ga0466728_032581 Ga0466728_032581_615_1811 398
85 3300042620 Ga0466728_270174 Ga0466728_270174_1202_2398 398
86 3300042620 Ga0466728_396279 Ga0466728_396279_863_2059 398
87 3300042648 Ga0466709_269965 Ga0466709_269965_1464_2660 398
88 3300042652 Ga0466708_101893 Ga0466708_101893_8821_10017 398
89 3300042652 Ga0466708_116392 Ga0466708_116392_1568_2764 398
90 3300042652 Ga0466708_236730 Ga0466708_236730_7919_9115 398
91 3300042652 Ga0466708_318237 Ga0466708_318237_1568_2764 398
92 3300042601 Ga0466707_016082 Ga0466707_016082_303_1502 399
93 3300042648 Ga0466709_137960 Ga0466709_137960_9727_10926 399
94 3300002462 JGI24702J35022_10001485 JGI24702J35022_1000148512 400
95 3300010167 Ga0123353_10323100 Ga0123353_103231002 400
96 3300042618 Ga0466723_369581 Ga0466723_369581_28904_30106 400
97 3300042643 Ga0466704_569051 Ga0466704_569051_265_1467 400
98 3300002462 JGI24702J35022_10069625 JGI24702J35022_100696252 401
99 3300042590 Ga0466690_005234 Ga0466690_005234_6576_7781 401
100 3300042593 Ga0466691_007663 Ga0466691_007663_5126_6331 401
101 3300042596 Ga0466696_246247 Ga0466696_246247_3898_5103 401
102 3300042597 Ga0466699_404426 Ga0466699_404426_132_1337 401
103 3300042606 Ga0466719_406469 Ga0466719_406469_6790_7995 401
104 3300042612 Ga0466705_217785 Ga0466705_217785_2716_3921 401
105 3300042614 Ga0466712_050010 Ga0466712_050010_1266_2471 401
106 3300042616 Ga0466715_065782 Ga0466715_065782_4401_5606 401
107 3300042618 Ga0466723_068472 Ga0466723_068472_2757_3962 401
108 3300042618 Ga0466723_295027 Ga0466723_295027_5911_7116 401
109 3300042652 Ga0466708_177332 Ga0466708_177332_3356_4561 401
110 3300042590 Ga0466690_353099 Ga0466690_353099_1922_3130 402
111 3300042596 Ga0466696_371533 Ga0466696_371533_802_2010 402
112 3300042620 Ga0466728_412044 Ga0466728_412044_831_2039 402
113 3300042606 Ga0466719_419712 Ga0466719_419712_570_1781 403
114 3300042612 Ga0466705_211043 Ga0466705_211043_614_1825 403
115 3300042636 Ga0466703_072751 Ga0466703_072751_2070_3281 403
116 3300042643 Ga0466704_504387 Ga0466704_504387_8960_10171 403
117 3300042636 Ga0466703_416155 Ga0466703_416155_12276_13490 404
118 3300009826 Ga0123355_10135464 Ga0123355_101354642 405
119 3300042596 Ga0466696_265916 Ga0466696_265916_779_1996 405
120 3300042652 Ga0466708_112988 Ga0466708_112988_1359_2576 405
121 3300042597 Ga0466699_056422 Ga0466699_056422_3718_4938 406
122 3300042597 Ga0466699_056525 Ga0466699_056525_880_2100 406
123 3300042597 Ga0466699_273395 Ga0466699_273395_1258_2478 406
124 3300042606 Ga0466719_089683 Ga0466719_089683_1457_2677 406
125 3300042643 Ga0466704_002963 Ga0466704_002963_8599_9819 406
126 3300042655 Ga0466727_257981 Ga0466727_257981_160_1380 406
127 iso_pr_bacteria 2781125638 2781284794 407
128 3300002450 JGI24695J34938_10002475 JGI24695J34938_100024759 408
129 3300009784 Ga0123357_10109183 Ga0123357_101091832 408
130 3300042636 Ga0466703_153577 Ga0466703_153577_1901_3127 408
131 3300042612 Ga0466705_054669 Ga0466705_054669_1785_3014 409
132 3300042656 Ga0466732_018499 Ga0466732_018499_423_1682 409
133 3300042605 Ga0466716_001080 Ga0466716_001080_5016_6248 410
134 3300042596 Ga0466696_368836 Ga0466696_368836_554_1789 411
135 3300042597 Ga0466699_117382 Ga0466699_117382_295_1530 411
136 3300042643 Ga0466704_411029 Ga0466704_411029_5136_6371 411
137 3300042591 Ga0466692_066607 Ga0466692_066607_357_1595 412
138 3300042607 Ga0466720_076308 Ga0466720_076308_1314_2555 413
139 3300042607 Ga0466720_157778 Ga0466720_157778_1753_2994 413
140 3300005485 Ga0074263_105758 Ga0074263_1057581 414
141 3300038395 Ga0415639_023283 Ga0415639_023283_3476_4720 414
142 3300042615 Ga0466711_250812 Ga0466711_250812_8355_9599 414
143 iso_pr_bacteria 2781125697 2781443832 414
144 3300002462 JGI24702J35022_10022030 JGI24702J35022_100220301 415
145 3300042616 Ga0466715_306093 Ga0466715_306093_146_1393 415
146 3300009784 Ga0123357_10044679 Ga0123357_100446797 418
147 3300042636 Ga0466703_422769 Ga0466703_422769_8219_9475 418
148 iso_pr_bacteria 2781125652 2781312262 427
149 3300042607 Ga0466720_089281 Ga0466720_089281_368_1657 429
150 3300010167 Ga0123353_10331386 Ga0123353_103313862 444
151 3300009784 Ga0123357_10219322 Ga0123357_102193222 450

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01966 HD HD domain 278 391 0.87
PF01467 CTP_transf_like Cytidylyltransferase-like 5 148 0.81

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.77 0.85 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.