Protein Family IF02211

Metagenome Isolate
133 Members
49 Samples
129 Scaffolds
253.01 Avg Length

🧬 Representative Sequence

ID
3300009784|Ga0123357_10070838|Ga0123357_100708382
Length
298 aa
Sequence
VELHEYSAKTVGKNNQQNRKKLFIRTFFNFPAKINVLRNNLLVLLKKKAQIKFIRSLEKKKFRNESVCFLAEGNKLIADILPFFECECLIAKASWLATQGDIRTKELIVAEDNDLERVSLLKTPQDVLAVFRQPQYILDDESLKNELSLVLDGIQDPGNMGTIVRLADWFGIKQLICSPDTADIYNPKTIQATMGAIARVRVFYTSLPDWLSKMKDIPVYGAFLEGKNIYTEALSPSGLIVMGNEGKGISPAVEKMVTQKLYIPNYPPEAESSESLNVATATAIVCSEFRRKIIYHL*

📊 Sample Types

Isolate 3.0%
Metagenome 97.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 35.4%
Kalotermitidae 27.1%
Unclassified 10.4%
Termopsidae 6.2%
Armadillidiidae 6.2%
Rhinotermitidae 6.2%
Passalidae 4.2%
Blattidae 4.2%

🌳 Taxonomy

Archaea 1
Bacteria 126
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
2 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
3 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
4 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
5 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
6 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
7 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
8 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
9 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
10 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
11 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
12 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
13 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
14 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
15 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
16 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
17 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
18 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
19 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
20 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
21 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
22 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
23 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
24 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
25 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
26 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
27 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
28 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
29 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
30 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
31 3004667792 Bacteroides sp. 519 Isolate Blattidae
32 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
33 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
34 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
35 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
36 2922326829 Bacteroides sp. 224 Isolate Blattidae
37 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
38 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
39 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
40 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
41 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
42 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
43 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
44 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
45 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
46 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
47 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
48 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
49 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_146148 3300042611 Bacteria 2056
2 Ga0466713_046789 3300042602 Bacteria 28948
3 Ga0466713_077669 3300042602 Bacteria 61043
4 Ga0466719_333138 3300042606 Bacteria 18795
5 Ga0466719_359523 3300042606 Bacteria 7027
6 Ga0466722_113813 3300042609 Bacteria 8452
7 Ga0123357_10014632 3300009784 Bacteria 10250
8 Ga0123354_10010075 3300010882 Bacteria 14521
9 Ga0160468_100098 3300012819 Bacteria 101080
10 Ga0466691_088105 3300042593 Bacteria 24612
11 Ga0466735_119079 3300042624 Bacteria 1634
12 Ga0466735_131511 3300042624 Bacteria 1750
13 Ga0466703_018901 3300042636 Bacteria 24174
14 Ga0466709_260946 3300042648 Bacteria 35410
15 Ga0466708_114916 3300042652 Bacteria 8975
16 Ga0466697_139692 3300042611 Bacteria 246544
17 Ga0466715_324184 3300042616 Bacteria 11897
18 Ga0466723_193771 3300042618 Bacteria 7591
19 Ga0466701_094969 3300042598 Bacteria 3165
20 Ga0466700_006872 3300042600 Bacteria 12799
21 Ga0123357_10080113 3300009784 Bacteria 4297
22 Ga0123354_10087297 3300010882 Bacteria 4351
23 Ga0466692_008378 3300042591 Bacteria 4108
24 Ga0466703_003368 3300042636 Bacteria 6974
25 Ga0466703_317345 3300042636 Bacteria 6233
26 Ga0466727_211677 3300042655 Bacteria 4030
27 2227465740 2225789004 Bacteria 5178
28 IMNBL1DRAFT_c0001302 3300000062 Bacteria 18774
29 Ga0072941_1084190 3300005201 Bacteria 4108
30 Ga0072941_1208960 3300005201 Bacteria 2449
31 Ga0466733_069547 3300042659 Bacteria 2552
32 Ga0466715_220088 3300042616 Bacteria 21738
33 Ga0466715_613439 3300042616 Bacteria 11044
34 Ga0466726_392059 3300042619 Bacteria 15168
35 Ga0466729_022809 3300042621 Bacteria 5307
36 Ga0466700_387454 3300042600 Bacteria 47059
37 Ga0466707_084096 3300042601 Archaea 2293
38 Ga0466707_271688 3300042601 Bacteria 2064
39 Ga0466722_033284 3300042609 Bacteria 7519
40 Ga0466722_225610 3300042609 Bacteria 4316
41 Ga0123353_10054274 3300010167 Bacteria 6408
42 Ga0123354_10072340 3300010882 Bacteria 4966
43 Ga0160467_100008 3300012829 Bacteria 615500
44 Ga0160433_100237 3300012846 Bacteria 40097
45 Ga0466690_408627 3300042590 Bacteria 146519
46 Ga0466696_004585 3300042596 Bacteria 1113
47 Ga0466735_146630 3300042624 Bacteria 3011
48 Ga0466709_340454 3300042648 Bacteria 8954
49 Ga0466715_281118 3300042616 Bacteria 34148
50 Ga0466715_370780 3300042616 Bacteria 15947
51 Ga0466729_182112 3300042621 Bacteria 5797
52 Ga0466700_145792 3300042600 Bacteria 5863
53 Ga0466716_413834 3300042605 Bacteria 9260
54 Ga0123356_10018384 3300010049 Bacteria 6639
55 Ga0466690_005231 3300042590 Bacteria 13066
56 Ga0466694_177139 3300042594 Bacteria 2018
57 Ga0466735_067715 3300042624 Bacteria 9180
58 Ga0466735_196574 3300042624 Bacteria 2108
59 Ga0466703_287753 3300042636 Bacteria 32822
60 JGI24699J35502_11133921 3300002509 Bacteria 19438
61 JGI24699J35502_11134108 3300002509 Bacteria 31504
62 Ga0466723_149228 3300042618 Bacteria 8202
63 Ga0466726_243932 3300042619 Bacteria 4080
64 Ga0466707_213150 3300042601 Bacteria 55646
65 Ga0466713_074755 3300042602 Bacteria 27009
66 Ga0466713_125910 3300042602 Bacteria 7183
67 Ga0466719_152510 3300042606 Bacteria 18200
68 Ga0466698_404660 3300042610 Bacteria 1538
69 Ga0123357_10017547 3300009784 Bacteria 9479
70 Ga0123357_10055008 3300009784 Bacteria 5362
71 Ga0123357_10070838 3300009784 Bacteria 4626
72 Ga0123357_10080642 3300009784 Bacteria 4279
73 Ga0123357_10182683 3300009784 Bacteria 2443
74 Ga0123354_10054090 3300010882 Bacteria 6028
75 Ga0123354_10059523 3300010882 Unclassified 5663
76 Ga0466657_331339 3300042582 Bacteria 2480
77 Ga0466690_177838 3300042590 Bacteria 5342
78 Ga0466693_438390 3300042592 Bacteria 1809
79 Ga0466735_159700 3300042624 Unclassified 6698
80 Ga0466709_216670 3300042648 Bacteria 31600
81 Ga0466727_164704 3300042655 Bacteria 2491
82 Ga0466727_219349 3300042655 Bacteria 4825
83 Ga0466727_303601 3300042655 Unclassified 6432
84 Ga0068305_10159626 3300005083 Unclassified 3938
85 Ga0466711_007932 3300042615 Bacteria 16347
86 Ga0466723_369313 3300042618 Bacteria 13885
87 Ga0466726_113663 3300042619 Bacteria 25973
88 Ga0466707_084520 3300042601 Bacteria 2843
89 Ga0466707_197832 3300042601 Bacteria 9282
90 Ga0466707_281435 3300042601 Bacteria 29788
91 Ga0466722_157838 3300042609 Bacteria 26726
92 Ga0123357_10125568 3300009784 Bacteria 3216
93 Ga0123357_10420998 3300009784 Bacteria 1191
94 Ga0123354_10001987 3300010882 Bacteria 26220
95 Ga0466656_055636 3300042550 Bacteria 2250
96 Ga0466694_010196 3300042594 Bacteria 3755
97 Ga0466696_375260 3300042596 Bacteria 12113
98 Ga0466735_197620 3300042624 Bacteria 1334
99 Ga0466704_164604 3300042643 Bacteria 18380
100 Ga0466704_550063 3300042643 Bacteria 6500
101 Ga0466708_271279 3300042652 Bacteria 16274
102 Ga0466727_157040 3300042655 Bacteria 33034
103 IMNBL1DRAFT_c0001062 3300000062 Bacteria 21213
104 Ga0068305_10274057 3300005083 Bacteria 9984
105 Ga0123357_10001046 3300009784 Bacteria 28431
106 Ga0466726_064262 3300042619 Unclassified 1618
107 Ga0466700_208356 3300042600 Bacteria 19306
108 Ga0466707_039538 3300042601 Bacteria 34189
109 Ga0466707_255418 3300042601 Bacteria 6860
110 Ga0123357_10079995 3300009784 Bacteria 4301
111 Ga0123354_10020386 3300010882 Bacteria 10429
112 Ga0123354_10070315 3300010882 Bacteria 5064
113 Ga0123354_10255994 3300010882 Bacteria 1760
114 Ga0466703_103211 3300042636 Bacteria 6470
115 IMNBL1DRAFT_c0001286 3300000062 Bacteria 18905
116 JGI24702J35022_10015571 3300002462 Bacteria 4180
117 Ga0072941_1176446 3300005201 Bacteria 1694
118 Ga0466697_153645 3300042611 Unclassified 5066
119 Ga0466732_208480 3300042656 Bacteria 5557
120 Ga0466710_033380 3300042613 Bacteria 5907
121 Ga0466715_390650 3300042616 Bacteria 6472
122 Ga0466728_116605 3300042620 Bacteria 6597
123 Ga0466713_080452 3300042602 Bacteria 6401
124 Ga0466716_188273 3300042605 Bacteria 5268
125 Ga0466719_539717 3300042606 Bacteria 7128
126 Ga0123356_10266097 3300010049 Bacteria 1801
127 Ga0466692_039401 3300042591 Bacteria 14180
128 Ga0466696_464019 3300042596 Bacteria 3841
129 JGI24702J35022_10000404 3300002462 Bacteria 25728

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042656 Ga0466732_208480 Ga0466732_208480_2079_2825 235
2 3300042652 Ga0466708_114916 Ga0466708_114916_3209_3970 239
3 3300009784 Ga0123357_10420998 Ga0123357_104209982 240
4 3300042655 Ga0466727_303601 Ga0466727_303601_5400_6122 240
5 2225789004 2227465740 2227904115 247
6 3300000062 IMNBL1DRAFT_c0001062 IMNBL1DRAFT_000106211 248
7 3300012829 Ga0160467_100008 Ga0160467_100008412 248
8 3300009784 Ga0123357_10055008 Ga0123357_100550084 249
9 3300010882 Ga0123354_10087297 Ga0123354_100872973 249
10 3300012819 Ga0160468_100098 Ga0160468_10009814 249
11 3300012846 Ga0160433_100237 Ga0160433_10023712 249
12 3300042596 Ga0466696_004585 Ga0466696_004585_319_1068 249
13 3300042613 Ga0466710_033380 Ga0466710_033380_2513_3262 249
14 3300042624 Ga0466735_119079 Ga0466735_119079_654_1403 249
15 3300042624 Ga0466735_131511 Ga0466735_131511_671_1420 249
16 3300042652 Ga0466708_271279 Ga0466708_271279_7482_8231 249
17 3300042590 Ga0466690_005231 Ga0466690_005231_2006_2758 250
18 3300042591 Ga0466692_008378 Ga0466692_008378_1438_2190 250
19 3300042596 Ga0466696_375260 Ga0466696_375260_6162_6914 250
20 3300042605 Ga0466716_413834 Ga0466716_413834_1723_2475 250
21 3300042606 Ga0466719_152510 Ga0466719_152510_5746_6498 250
22 3300042606 Ga0466719_333138 Ga0466719_333138_3508_4260 250
23 3300042609 Ga0466722_157838 Ga0466722_157838_25663_26415 250
24 3300042611 Ga0466697_146148 Ga0466697_146148_1280_2032 250
25 3300042611 Ga0466697_153645 Ga0466697_153645_3902_4654 250
26 3300042616 Ga0466715_324184 Ga0466715_324184_9634_10386 250
27 3300042618 Ga0466723_369313 Ga0466723_369313_12513_13265 250
28 3300042636 Ga0466703_103211 Ga0466703_103211_2412_3164 250
29 3300042648 Ga0466709_260946 Ga0466709_260946_19723_20475 250
30 3300000062 IMNBL1DRAFT_c0001302 IMNBL1DRAFT_00013023 251
31 3300002462 JGI24702J35022_10015571 JGI24702J35022_100155712 251
32 3300005083 Ga0068305_10159626 Ga0068305_101596263 251
33 3300005201 Ga0072941_1084190 Ga0072941_10841901 251
34 3300005201 Ga0072941_1208960 Ga0072941_12089602 251
35 3300009784 Ga0123357_10017547 Ga0123357_100175475 251
36 3300010167 Ga0123353_10054274 Ga0123353_100542744 251
37 3300042592 Ga0466693_438390 Ga0466693_438390_569_1324 251
38 3300042598 Ga0466701_094969 Ga0466701_094969_1383_2138 251
39 3300042601 Ga0466707_213150 Ga0466707_213150_12484_13239 251
40 3300042602 Ga0466713_125910 Ga0466713_125910_1403_2158 251
41 3300042610 Ga0466698_404660 Ga0466698_404660_343_1098 251
42 3300042659 Ga0466733_069547 Ga0466733_069547_202_957 251
43 iso_pr_bacteria 2820778767 2820781478 251
44 iso_pr_bacteria 2922326829 2922329790 251
45 iso_pr_bacteria 3004667792 3004669693 251
46 3300000062 IMNBL1DRAFT_c0001286 IMNBL1DRAFT_00012869 252
47 3300009784 Ga0123357_10014632 Ga0123357_100146323 252
48 3300009784 Ga0123357_10079995 Ga0123357_100799952 252
49 3300009784 Ga0123357_10080113 Ga0123357_100801132 252
50 3300010882 Ga0123354_10054090 Ga0123354_100540905 252
51 3300010882 Ga0123354_10070315 Ga0123354_100703153 252
52 3300042550 Ga0466656_055636 Ga0466656_055636_449_1207 252
53 3300042600 Ga0466700_145792 Ga0466700_145792_4455_5213 252
54 3300042600 Ga0466700_208356 Ga0466700_208356_2981_3739 252
55 3300042600 Ga0466700_387454 Ga0466700_387454_44667_45425 252
56 3300042601 Ga0466707_281435 Ga0466707_281435_4755_5513 252
57 3300042602 Ga0466713_046789 Ga0466713_046789_8360_9118 252
58 3300042606 Ga0466719_539717 Ga0466719_539717_100_858 252
59 3300042609 Ga0466722_113813 Ga0466722_113813_537_1295 252
60 3300042611 Ga0466697_139692 Ga0466697_139692_32707_33495 252
61 3300042619 Ga0466726_113663 Ga0466726_113663_11918_12676 252
62 3300042620 Ga0466728_116605 Ga0466728_116605_2716_3474 252
63 3300042636 Ga0466703_018901 Ga0466703_018901_5348_6106 252
64 3300042643 Ga0466704_164604 Ga0466704_164604_9202_9960 252
65 3300042655 Ga0466727_157040 Ga0466727_157040_10631_11389 252
66 iso_pr_bacteria 2820759988 2820761257 252
67 3300002462 JGI24702J35022_10000404 JGI24702J35022_1000040415 253
68 3300002509 JGI24699J35502_11133921 JGI24699J35502_111339215 253
69 3300002509 JGI24699J35502_11134108 JGI24699J35502_1113410821 253
70 3300009784 Ga0123357_10080642 Ga0123357_100806423 253
71 3300010049 Ga0123356_10018384 Ga0123356_100183845 253
72 3300010049 Ga0123356_10266097 Ga0123356_102660972 253
73 3300010882 Ga0123354_10001987 Ga0123354_1000198711 253
74 3300010882 Ga0123354_10010075 Ga0123354_1001007511 253
75 3300010882 Ga0123354_10020386 Ga0123354_100203869 253
76 3300010882 Ga0123354_10059523 Ga0123354_100595233 253
77 3300010882 Ga0123354_10072340 Ga0123354_100723403 253
78 3300010882 Ga0123354_10255994 Ga0123354_102559942 253
79 3300042590 Ga0466690_177838 Ga0466690_177838_837_1598 253
80 3300042590 Ga0466690_408627 Ga0466690_408627_46133_46894 253
81 3300042591 Ga0466692_039401 Ga0466692_039401_1763_2524 253
82 3300042600 Ga0466700_006872 Ga0466700_006872_9139_9900 253
83 3300042601 Ga0466707_197832 Ga0466707_197832_3493_4254 253
84 3300042601 Ga0466707_255418 Ga0466707_255418_2938_3699 253
85 3300042602 Ga0466713_077669 Ga0466713_077669_59717_60478 253
86 3300042602 Ga0466713_080452 Ga0466713_080452_4912_5673 253
87 3300042605 Ga0466716_188273 Ga0466716_188273_4077_4838 253
88 3300042615 Ga0466711_007932 Ga0466711_007932_5416_6177 253
89 3300042616 Ga0466715_220088 Ga0466715_220088_14867_15628 253
90 3300042616 Ga0466715_370780 Ga0466715_370780_5387_6148 253
91 3300042618 Ga0466723_149228 Ga0466723_149228_4964_5725 253
92 3300042618 Ga0466723_193771 Ga0466723_193771_3243_4004 253
93 3300042619 Ga0466726_064262 Ga0466726_064262_274_1035 253
94 3300042619 Ga0466726_243932 Ga0466726_243932_560_1321 253
95 3300042621 Ga0466729_022809 Ga0466729_022809_1670_2431 253
96 3300042624 Ga0466735_067715 Ga0466735_067715_7962_8723 253
97 3300042624 Ga0466735_196574 Ga0466735_196574_653_1414 253
98 3300042636 Ga0466703_003368 Ga0466703_003368_4128_4889 253
99 3300042636 Ga0466703_317345 Ga0466703_317345_3031_3792 253
100 3300042643 Ga0466704_550063 Ga0466704_550063_971_1732 253
101 3300042648 Ga0466709_216670 Ga0466709_216670_27097_27858 253
102 3300042648 Ga0466709_340454 Ga0466709_340454_1879_2640 253
103 3300042655 Ga0466727_164704 Ga0466727_164704_700_1461 253
104 3300042655 Ga0466727_211677 Ga0466727_211677_2580_3341 253
105 3300005201 Ga0072941_1176446 Ga0072941_11764462 254
106 3300009784 Ga0123357_10182683 Ga0123357_101826832 254
107 3300042602 Ga0466713_074755 Ga0466713_074755_1841_2605 254
108 3300042616 Ga0466715_613439 Ga0466715_613439_1099_1863 254
109 3300042624 Ga0466735_146630 Ga0466735_146630_898_1662 254
110 3300042624 Ga0466735_159700 Ga0466735_159700_3737_4501 254
111 3300042624 Ga0466735_197620 Ga0466735_197620_265_1029 254
112 3300005083 Ga0068305_10274057 Ga0068305_102740573 255
113 3300009784 Ga0123357_10001046 Ga0123357_100010463 255
114 3300042594 Ga0466694_177139 Ga0466694_177139_1014_1781 255
115 3300042606 Ga0466719_359523 Ga0466719_359523_4770_5537 255
116 3300042609 Ga0466722_033284 Ga0466722_033284_2061_2828 255
117 3300042655 Ga0466727_219349 Ga0466727_219349_2708_3475 255
118 3300042601 Ga0466707_084096 Ga0466707_084096_610_1380 256
119 3300042601 Ga0466707_084520 Ga0466707_084520_1208_1978 256
120 3300042593 Ga0466691_088105 Ga0466691_088105_648_1427 259
121 3300042616 Ga0466715_281118 Ga0466715_281118_8200_8979 259
122 3300042616 Ga0466715_390650 Ga0466715_390650_5010_5789 259
123 3300042636 Ga0466703_287753 Ga0466703_287753_18847_19626 259
124 3300042596 Ga0466696_464019 Ga0466696_464019_2436_3218 260
125 3300042601 Ga0466707_271688 Ga0466707_271688_16_798 260
126 3300042582 Ga0466657_331339 Ga0466657_331339_98_886 262
127 3300042621 Ga0466729_182112 Ga0466729_182112_375_1163 262
128 3300042601 Ga0466707_039538 Ga0466707_039538_2127_2918 263
129 3300042619 Ga0466726_392059 Ga0466726_392059_2880_3680 266
130 3300042609 Ga0466722_225610 Ga0466722_225610_79_888 269
131 3300042594 Ga0466694_010196 Ga0466694_010196_441_1253 270
132 3300009784 Ga0123357_10125568 Ga0123357_101255682 274
133 3300009784 Ga0123357_10070838 Ga0123357_100708382 298

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF22435 MRM3-like_sub_bind MRM3-like substrate binding domain 49 129 0.95
PF00588 SpoU_methylase SpoU rRNA Methylase family 147 286 0.94

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.82 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.