Protein Family IF02211
Metagenome
Isolate
133
Members
49
Samples
129
Scaffolds
253.01
Avg Length
Representative Sequence
- ID
- 3300009784|Ga0123357_10070838|Ga0123357_100708382
- Length
- 298 aa
- Sequence
- VELHEYSAKTVGKNNQQNRKKLFIRTFFNFPAKINVLRNNLLVLLKKKAQIKFIRSLEKKKFRNESVCFLAEGNKLIADILPFFECECLIAKASWLATQGDIRTKELIVAEDNDLERVSLLKTPQDVLAVFRQPQYILDDESLKNELSLVLDGIQDPGNMGTIVRLADWFGIKQLICSPDTADIYNPKTIQATMGAIARVRVFYTSLPDWLSKMKDIPVYGAFLEGKNIYTEALSPSGLIVMGNEGKGISPAVEKMVTQKLYIPNYPPEAESSESLNVATATAIVCSEFRRKIIYHL*
Sample Types
Isolate
3.0%
Metagenome
97.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
35.4%
Kalotermitidae
27.1%
Unclassified
10.4%
Termopsidae
6.2%
Armadillidiidae
6.2%
Rhinotermitidae
6.2%
Passalidae
4.2%
Blattidae
4.2%
Taxonomy
Archaea
1
Bacteria
126
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 2 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 3 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 4 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 5 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 6 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 7 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 8 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 9 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 10 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 11 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 12 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 13 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 14 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 15 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 16 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 17 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 18 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 19 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 20 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 21 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 22 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 23 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 24 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 25 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 26 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 27 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 28 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 29 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 30 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 31 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 32 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 33 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 34 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 35 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 36 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 37 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 38 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 39 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 40 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 41 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 42 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 43 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 44 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 45 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 46 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 47 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 48 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 49 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_146148 | 3300042611 | Bacteria | 2056 |
| 2 | Ga0466713_046789 | 3300042602 | Bacteria | 28948 |
| 3 | Ga0466713_077669 | 3300042602 | Bacteria | 61043 |
| 4 | Ga0466719_333138 | 3300042606 | Bacteria | 18795 |
| 5 | Ga0466719_359523 | 3300042606 | Bacteria | 7027 |
| 6 | Ga0466722_113813 | 3300042609 | Bacteria | 8452 |
| 7 | Ga0123357_10014632 | 3300009784 | Bacteria | 10250 |
| 8 | Ga0123354_10010075 | 3300010882 | Bacteria | 14521 |
| 9 | Ga0160468_100098 | 3300012819 | Bacteria | 101080 |
| 10 | Ga0466691_088105 | 3300042593 | Bacteria | 24612 |
| 11 | Ga0466735_119079 | 3300042624 | Bacteria | 1634 |
| 12 | Ga0466735_131511 | 3300042624 | Bacteria | 1750 |
| 13 | Ga0466703_018901 | 3300042636 | Bacteria | 24174 |
| 14 | Ga0466709_260946 | 3300042648 | Bacteria | 35410 |
| 15 | Ga0466708_114916 | 3300042652 | Bacteria | 8975 |
| 16 | Ga0466697_139692 | 3300042611 | Bacteria | 246544 |
| 17 | Ga0466715_324184 | 3300042616 | Bacteria | 11897 |
| 18 | Ga0466723_193771 | 3300042618 | Bacteria | 7591 |
| 19 | Ga0466701_094969 | 3300042598 | Bacteria | 3165 |
| 20 | Ga0466700_006872 | 3300042600 | Bacteria | 12799 |
| 21 | Ga0123357_10080113 | 3300009784 | Bacteria | 4297 |
| 22 | Ga0123354_10087297 | 3300010882 | Bacteria | 4351 |
| 23 | Ga0466692_008378 | 3300042591 | Bacteria | 4108 |
| 24 | Ga0466703_003368 | 3300042636 | Bacteria | 6974 |
| 25 | Ga0466703_317345 | 3300042636 | Bacteria | 6233 |
| 26 | Ga0466727_211677 | 3300042655 | Bacteria | 4030 |
| 27 | 2227465740 | 2225789004 | Bacteria | 5178 |
| 28 | IMNBL1DRAFT_c0001302 | 3300000062 | Bacteria | 18774 |
| 29 | Ga0072941_1084190 | 3300005201 | Bacteria | 4108 |
| 30 | Ga0072941_1208960 | 3300005201 | Bacteria | 2449 |
| 31 | Ga0466733_069547 | 3300042659 | Bacteria | 2552 |
| 32 | Ga0466715_220088 | 3300042616 | Bacteria | 21738 |
| 33 | Ga0466715_613439 | 3300042616 | Bacteria | 11044 |
| 34 | Ga0466726_392059 | 3300042619 | Bacteria | 15168 |
| 35 | Ga0466729_022809 | 3300042621 | Bacteria | 5307 |
| 36 | Ga0466700_387454 | 3300042600 | Bacteria | 47059 |
| 37 | Ga0466707_084096 | 3300042601 | Archaea | 2293 |
| 38 | Ga0466707_271688 | 3300042601 | Bacteria | 2064 |
| 39 | Ga0466722_033284 | 3300042609 | Bacteria | 7519 |
| 40 | Ga0466722_225610 | 3300042609 | Bacteria | 4316 |
| 41 | Ga0123353_10054274 | 3300010167 | Bacteria | 6408 |
| 42 | Ga0123354_10072340 | 3300010882 | Bacteria | 4966 |
| 43 | Ga0160467_100008 | 3300012829 | Bacteria | 615500 |
| 44 | Ga0160433_100237 | 3300012846 | Bacteria | 40097 |
| 45 | Ga0466690_408627 | 3300042590 | Bacteria | 146519 |
| 46 | Ga0466696_004585 | 3300042596 | Bacteria | 1113 |
| 47 | Ga0466735_146630 | 3300042624 | Bacteria | 3011 |
| 48 | Ga0466709_340454 | 3300042648 | Bacteria | 8954 |
| 49 | Ga0466715_281118 | 3300042616 | Bacteria | 34148 |
| 50 | Ga0466715_370780 | 3300042616 | Bacteria | 15947 |
| 51 | Ga0466729_182112 | 3300042621 | Bacteria | 5797 |
| 52 | Ga0466700_145792 | 3300042600 | Bacteria | 5863 |
| 53 | Ga0466716_413834 | 3300042605 | Bacteria | 9260 |
| 54 | Ga0123356_10018384 | 3300010049 | Bacteria | 6639 |
| 55 | Ga0466690_005231 | 3300042590 | Bacteria | 13066 |
| 56 | Ga0466694_177139 | 3300042594 | Bacteria | 2018 |
| 57 | Ga0466735_067715 | 3300042624 | Bacteria | 9180 |
| 58 | Ga0466735_196574 | 3300042624 | Bacteria | 2108 |
| 59 | Ga0466703_287753 | 3300042636 | Bacteria | 32822 |
| 60 | JGI24699J35502_11133921 | 3300002509 | Bacteria | 19438 |
| 61 | JGI24699J35502_11134108 | 3300002509 | Bacteria | 31504 |
| 62 | Ga0466723_149228 | 3300042618 | Bacteria | 8202 |
| 63 | Ga0466726_243932 | 3300042619 | Bacteria | 4080 |
| 64 | Ga0466707_213150 | 3300042601 | Bacteria | 55646 |
| 65 | Ga0466713_074755 | 3300042602 | Bacteria | 27009 |
| 66 | Ga0466713_125910 | 3300042602 | Bacteria | 7183 |
| 67 | Ga0466719_152510 | 3300042606 | Bacteria | 18200 |
| 68 | Ga0466698_404660 | 3300042610 | Bacteria | 1538 |
| 69 | Ga0123357_10017547 | 3300009784 | Bacteria | 9479 |
| 70 | Ga0123357_10055008 | 3300009784 | Bacteria | 5362 |
| 71 | Ga0123357_10070838 | 3300009784 | Bacteria | 4626 |
| 72 | Ga0123357_10080642 | 3300009784 | Bacteria | 4279 |
| 73 | Ga0123357_10182683 | 3300009784 | Bacteria | 2443 |
| 74 | Ga0123354_10054090 | 3300010882 | Bacteria | 6028 |
| 75 | Ga0123354_10059523 | 3300010882 | Unclassified | 5663 |
| 76 | Ga0466657_331339 | 3300042582 | Bacteria | 2480 |
| 77 | Ga0466690_177838 | 3300042590 | Bacteria | 5342 |
| 78 | Ga0466693_438390 | 3300042592 | Bacteria | 1809 |
| 79 | Ga0466735_159700 | 3300042624 | Unclassified | 6698 |
| 80 | Ga0466709_216670 | 3300042648 | Bacteria | 31600 |
| 81 | Ga0466727_164704 | 3300042655 | Bacteria | 2491 |
| 82 | Ga0466727_219349 | 3300042655 | Bacteria | 4825 |
| 83 | Ga0466727_303601 | 3300042655 | Unclassified | 6432 |
| 84 | Ga0068305_10159626 | 3300005083 | Unclassified | 3938 |
| 85 | Ga0466711_007932 | 3300042615 | Bacteria | 16347 |
| 86 | Ga0466723_369313 | 3300042618 | Bacteria | 13885 |
| 87 | Ga0466726_113663 | 3300042619 | Bacteria | 25973 |
| 88 | Ga0466707_084520 | 3300042601 | Bacteria | 2843 |
| 89 | Ga0466707_197832 | 3300042601 | Bacteria | 9282 |
| 90 | Ga0466707_281435 | 3300042601 | Bacteria | 29788 |
| 91 | Ga0466722_157838 | 3300042609 | Bacteria | 26726 |
| 92 | Ga0123357_10125568 | 3300009784 | Bacteria | 3216 |
| 93 | Ga0123357_10420998 | 3300009784 | Bacteria | 1191 |
| 94 | Ga0123354_10001987 | 3300010882 | Bacteria | 26220 |
| 95 | Ga0466656_055636 | 3300042550 | Bacteria | 2250 |
| 96 | Ga0466694_010196 | 3300042594 | Bacteria | 3755 |
| 97 | Ga0466696_375260 | 3300042596 | Bacteria | 12113 |
| 98 | Ga0466735_197620 | 3300042624 | Bacteria | 1334 |
| 99 | Ga0466704_164604 | 3300042643 | Bacteria | 18380 |
| 100 | Ga0466704_550063 | 3300042643 | Bacteria | 6500 |
| 101 | Ga0466708_271279 | 3300042652 | Bacteria | 16274 |
| 102 | Ga0466727_157040 | 3300042655 | Bacteria | 33034 |
| 103 | IMNBL1DRAFT_c0001062 | 3300000062 | Bacteria | 21213 |
| 104 | Ga0068305_10274057 | 3300005083 | Bacteria | 9984 |
| 105 | Ga0123357_10001046 | 3300009784 | Bacteria | 28431 |
| 106 | Ga0466726_064262 | 3300042619 | Unclassified | 1618 |
| 107 | Ga0466700_208356 | 3300042600 | Bacteria | 19306 |
| 108 | Ga0466707_039538 | 3300042601 | Bacteria | 34189 |
| 109 | Ga0466707_255418 | 3300042601 | Bacteria | 6860 |
| 110 | Ga0123357_10079995 | 3300009784 | Bacteria | 4301 |
| 111 | Ga0123354_10020386 | 3300010882 | Bacteria | 10429 |
| 112 | Ga0123354_10070315 | 3300010882 | Bacteria | 5064 |
| 113 | Ga0123354_10255994 | 3300010882 | Bacteria | 1760 |
| 114 | Ga0466703_103211 | 3300042636 | Bacteria | 6470 |
| 115 | IMNBL1DRAFT_c0001286 | 3300000062 | Bacteria | 18905 |
| 116 | JGI24702J35022_10015571 | 3300002462 | Bacteria | 4180 |
| 117 | Ga0072941_1176446 | 3300005201 | Bacteria | 1694 |
| 118 | Ga0466697_153645 | 3300042611 | Unclassified | 5066 |
| 119 | Ga0466732_208480 | 3300042656 | Bacteria | 5557 |
| 120 | Ga0466710_033380 | 3300042613 | Bacteria | 5907 |
| 121 | Ga0466715_390650 | 3300042616 | Bacteria | 6472 |
| 122 | Ga0466728_116605 | 3300042620 | Bacteria | 6597 |
| 123 | Ga0466713_080452 | 3300042602 | Bacteria | 6401 |
| 124 | Ga0466716_188273 | 3300042605 | Bacteria | 5268 |
| 125 | Ga0466719_539717 | 3300042606 | Bacteria | 7128 |
| 126 | Ga0123356_10266097 | 3300010049 | Bacteria | 1801 |
| 127 | Ga0466692_039401 | 3300042591 | Bacteria | 14180 |
| 128 | Ga0466696_464019 | 3300042596 | Bacteria | 3841 |
| 129 | JGI24702J35022_10000404 | 3300002462 | Bacteria | 25728 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042656 | Ga0466732_208480 | Ga0466732_208480_2079_2825 | 235 |
| 2 | 3300042652 | Ga0466708_114916 | Ga0466708_114916_3209_3970 | 239 |
| 3 | 3300009784 | Ga0123357_10420998 | Ga0123357_104209982 | 240 |
| 4 | 3300042655 | Ga0466727_303601 | Ga0466727_303601_5400_6122 | 240 |
| 5 | 2225789004 | 2227465740 | 2227904115 | 247 |
| 6 | 3300000062 | IMNBL1DRAFT_c0001062 | IMNBL1DRAFT_000106211 | 248 |
| 7 | 3300012829 | Ga0160467_100008 | Ga0160467_100008412 | 248 |
| 8 | 3300009784 | Ga0123357_10055008 | Ga0123357_100550084 | 249 |
| 9 | 3300010882 | Ga0123354_10087297 | Ga0123354_100872973 | 249 |
| 10 | 3300012819 | Ga0160468_100098 | Ga0160468_10009814 | 249 |
| 11 | 3300012846 | Ga0160433_100237 | Ga0160433_10023712 | 249 |
| 12 | 3300042596 | Ga0466696_004585 | Ga0466696_004585_319_1068 | 249 |
| 13 | 3300042613 | Ga0466710_033380 | Ga0466710_033380_2513_3262 | 249 |
| 14 | 3300042624 | Ga0466735_119079 | Ga0466735_119079_654_1403 | 249 |
| 15 | 3300042624 | Ga0466735_131511 | Ga0466735_131511_671_1420 | 249 |
| 16 | 3300042652 | Ga0466708_271279 | Ga0466708_271279_7482_8231 | 249 |
| 17 | 3300042590 | Ga0466690_005231 | Ga0466690_005231_2006_2758 | 250 |
| 18 | 3300042591 | Ga0466692_008378 | Ga0466692_008378_1438_2190 | 250 |
| 19 | 3300042596 | Ga0466696_375260 | Ga0466696_375260_6162_6914 | 250 |
| 20 | 3300042605 | Ga0466716_413834 | Ga0466716_413834_1723_2475 | 250 |
| 21 | 3300042606 | Ga0466719_152510 | Ga0466719_152510_5746_6498 | 250 |
| 22 | 3300042606 | Ga0466719_333138 | Ga0466719_333138_3508_4260 | 250 |
| 23 | 3300042609 | Ga0466722_157838 | Ga0466722_157838_25663_26415 | 250 |
| 24 | 3300042611 | Ga0466697_146148 | Ga0466697_146148_1280_2032 | 250 |
| 25 | 3300042611 | Ga0466697_153645 | Ga0466697_153645_3902_4654 | 250 |
| 26 | 3300042616 | Ga0466715_324184 | Ga0466715_324184_9634_10386 | 250 |
| 27 | 3300042618 | Ga0466723_369313 | Ga0466723_369313_12513_13265 | 250 |
| 28 | 3300042636 | Ga0466703_103211 | Ga0466703_103211_2412_3164 | 250 |
| 29 | 3300042648 | Ga0466709_260946 | Ga0466709_260946_19723_20475 | 250 |
| 30 | 3300000062 | IMNBL1DRAFT_c0001302 | IMNBL1DRAFT_00013023 | 251 |
| 31 | 3300002462 | JGI24702J35022_10015571 | JGI24702J35022_100155712 | 251 |
| 32 | 3300005083 | Ga0068305_10159626 | Ga0068305_101596263 | 251 |
| 33 | 3300005201 | Ga0072941_1084190 | Ga0072941_10841901 | 251 |
| 34 | 3300005201 | Ga0072941_1208960 | Ga0072941_12089602 | 251 |
| 35 | 3300009784 | Ga0123357_10017547 | Ga0123357_100175475 | 251 |
| 36 | 3300010167 | Ga0123353_10054274 | Ga0123353_100542744 | 251 |
| 37 | 3300042592 | Ga0466693_438390 | Ga0466693_438390_569_1324 | 251 |
| 38 | 3300042598 | Ga0466701_094969 | Ga0466701_094969_1383_2138 | 251 |
| 39 | 3300042601 | Ga0466707_213150 | Ga0466707_213150_12484_13239 | 251 |
| 40 | 3300042602 | Ga0466713_125910 | Ga0466713_125910_1403_2158 | 251 |
| 41 | 3300042610 | Ga0466698_404660 | Ga0466698_404660_343_1098 | 251 |
| 42 | 3300042659 | Ga0466733_069547 | Ga0466733_069547_202_957 | 251 |
| 43 | iso_pr_bacteria | 2820778767 | 2820781478 | 251 |
| 44 | iso_pr_bacteria | 2922326829 | 2922329790 | 251 |
| 45 | iso_pr_bacteria | 3004667792 | 3004669693 | 251 |
| 46 | 3300000062 | IMNBL1DRAFT_c0001286 | IMNBL1DRAFT_00012869 | 252 |
| 47 | 3300009784 | Ga0123357_10014632 | Ga0123357_100146323 | 252 |
| 48 | 3300009784 | Ga0123357_10079995 | Ga0123357_100799952 | 252 |
| 49 | 3300009784 | Ga0123357_10080113 | Ga0123357_100801132 | 252 |
| 50 | 3300010882 | Ga0123354_10054090 | Ga0123354_100540905 | 252 |
| 51 | 3300010882 | Ga0123354_10070315 | Ga0123354_100703153 | 252 |
| 52 | 3300042550 | Ga0466656_055636 | Ga0466656_055636_449_1207 | 252 |
| 53 | 3300042600 | Ga0466700_145792 | Ga0466700_145792_4455_5213 | 252 |
| 54 | 3300042600 | Ga0466700_208356 | Ga0466700_208356_2981_3739 | 252 |
| 55 | 3300042600 | Ga0466700_387454 | Ga0466700_387454_44667_45425 | 252 |
| 56 | 3300042601 | Ga0466707_281435 | Ga0466707_281435_4755_5513 | 252 |
| 57 | 3300042602 | Ga0466713_046789 | Ga0466713_046789_8360_9118 | 252 |
| 58 | 3300042606 | Ga0466719_539717 | Ga0466719_539717_100_858 | 252 |
| 59 | 3300042609 | Ga0466722_113813 | Ga0466722_113813_537_1295 | 252 |
| 60 | 3300042611 | Ga0466697_139692 | Ga0466697_139692_32707_33495 | 252 |
| 61 | 3300042619 | Ga0466726_113663 | Ga0466726_113663_11918_12676 | 252 |
| 62 | 3300042620 | Ga0466728_116605 | Ga0466728_116605_2716_3474 | 252 |
| 63 | 3300042636 | Ga0466703_018901 | Ga0466703_018901_5348_6106 | 252 |
| 64 | 3300042643 | Ga0466704_164604 | Ga0466704_164604_9202_9960 | 252 |
| 65 | 3300042655 | Ga0466727_157040 | Ga0466727_157040_10631_11389 | 252 |
| 66 | iso_pr_bacteria | 2820759988 | 2820761257 | 252 |
| 67 | 3300002462 | JGI24702J35022_10000404 | JGI24702J35022_1000040415 | 253 |
| 68 | 3300002509 | JGI24699J35502_11133921 | JGI24699J35502_111339215 | 253 |
| 69 | 3300002509 | JGI24699J35502_11134108 | JGI24699J35502_1113410821 | 253 |
| 70 | 3300009784 | Ga0123357_10080642 | Ga0123357_100806423 | 253 |
| 71 | 3300010049 | Ga0123356_10018384 | Ga0123356_100183845 | 253 |
| 72 | 3300010049 | Ga0123356_10266097 | Ga0123356_102660972 | 253 |
| 73 | 3300010882 | Ga0123354_10001987 | Ga0123354_1000198711 | 253 |
| 74 | 3300010882 | Ga0123354_10010075 | Ga0123354_1001007511 | 253 |
| 75 | 3300010882 | Ga0123354_10020386 | Ga0123354_100203869 | 253 |
| 76 | 3300010882 | Ga0123354_10059523 | Ga0123354_100595233 | 253 |
| 77 | 3300010882 | Ga0123354_10072340 | Ga0123354_100723403 | 253 |
| 78 | 3300010882 | Ga0123354_10255994 | Ga0123354_102559942 | 253 |
| 79 | 3300042590 | Ga0466690_177838 | Ga0466690_177838_837_1598 | 253 |
| 80 | 3300042590 | Ga0466690_408627 | Ga0466690_408627_46133_46894 | 253 |
| 81 | 3300042591 | Ga0466692_039401 | Ga0466692_039401_1763_2524 | 253 |
| 82 | 3300042600 | Ga0466700_006872 | Ga0466700_006872_9139_9900 | 253 |
| 83 | 3300042601 | Ga0466707_197832 | Ga0466707_197832_3493_4254 | 253 |
| 84 | 3300042601 | Ga0466707_255418 | Ga0466707_255418_2938_3699 | 253 |
| 85 | 3300042602 | Ga0466713_077669 | Ga0466713_077669_59717_60478 | 253 |
| 86 | 3300042602 | Ga0466713_080452 | Ga0466713_080452_4912_5673 | 253 |
| 87 | 3300042605 | Ga0466716_188273 | Ga0466716_188273_4077_4838 | 253 |
| 88 | 3300042615 | Ga0466711_007932 | Ga0466711_007932_5416_6177 | 253 |
| 89 | 3300042616 | Ga0466715_220088 | Ga0466715_220088_14867_15628 | 253 |
| 90 | 3300042616 | Ga0466715_370780 | Ga0466715_370780_5387_6148 | 253 |
| 91 | 3300042618 | Ga0466723_149228 | Ga0466723_149228_4964_5725 | 253 |
| 92 | 3300042618 | Ga0466723_193771 | Ga0466723_193771_3243_4004 | 253 |
| 93 | 3300042619 | Ga0466726_064262 | Ga0466726_064262_274_1035 | 253 |
| 94 | 3300042619 | Ga0466726_243932 | Ga0466726_243932_560_1321 | 253 |
| 95 | 3300042621 | Ga0466729_022809 | Ga0466729_022809_1670_2431 | 253 |
| 96 | 3300042624 | Ga0466735_067715 | Ga0466735_067715_7962_8723 | 253 |
| 97 | 3300042624 | Ga0466735_196574 | Ga0466735_196574_653_1414 | 253 |
| 98 | 3300042636 | Ga0466703_003368 | Ga0466703_003368_4128_4889 | 253 |
| 99 | 3300042636 | Ga0466703_317345 | Ga0466703_317345_3031_3792 | 253 |
| 100 | 3300042643 | Ga0466704_550063 | Ga0466704_550063_971_1732 | 253 |
| 101 | 3300042648 | Ga0466709_216670 | Ga0466709_216670_27097_27858 | 253 |
| 102 | 3300042648 | Ga0466709_340454 | Ga0466709_340454_1879_2640 | 253 |
| 103 | 3300042655 | Ga0466727_164704 | Ga0466727_164704_700_1461 | 253 |
| 104 | 3300042655 | Ga0466727_211677 | Ga0466727_211677_2580_3341 | 253 |
| 105 | 3300005201 | Ga0072941_1176446 | Ga0072941_11764462 | 254 |
| 106 | 3300009784 | Ga0123357_10182683 | Ga0123357_101826832 | 254 |
| 107 | 3300042602 | Ga0466713_074755 | Ga0466713_074755_1841_2605 | 254 |
| 108 | 3300042616 | Ga0466715_613439 | Ga0466715_613439_1099_1863 | 254 |
| 109 | 3300042624 | Ga0466735_146630 | Ga0466735_146630_898_1662 | 254 |
| 110 | 3300042624 | Ga0466735_159700 | Ga0466735_159700_3737_4501 | 254 |
| 111 | 3300042624 | Ga0466735_197620 | Ga0466735_197620_265_1029 | 254 |
| 112 | 3300005083 | Ga0068305_10274057 | Ga0068305_102740573 | 255 |
| 113 | 3300009784 | Ga0123357_10001046 | Ga0123357_100010463 | 255 |
| 114 | 3300042594 | Ga0466694_177139 | Ga0466694_177139_1014_1781 | 255 |
| 115 | 3300042606 | Ga0466719_359523 | Ga0466719_359523_4770_5537 | 255 |
| 116 | 3300042609 | Ga0466722_033284 | Ga0466722_033284_2061_2828 | 255 |
| 117 | 3300042655 | Ga0466727_219349 | Ga0466727_219349_2708_3475 | 255 |
| 118 | 3300042601 | Ga0466707_084096 | Ga0466707_084096_610_1380 | 256 |
| 119 | 3300042601 | Ga0466707_084520 | Ga0466707_084520_1208_1978 | 256 |
| 120 | 3300042593 | Ga0466691_088105 | Ga0466691_088105_648_1427 | 259 |
| 121 | 3300042616 | Ga0466715_281118 | Ga0466715_281118_8200_8979 | 259 |
| 122 | 3300042616 | Ga0466715_390650 | Ga0466715_390650_5010_5789 | 259 |
| 123 | 3300042636 | Ga0466703_287753 | Ga0466703_287753_18847_19626 | 259 |
| 124 | 3300042596 | Ga0466696_464019 | Ga0466696_464019_2436_3218 | 260 |
| 125 | 3300042601 | Ga0466707_271688 | Ga0466707_271688_16_798 | 260 |
| 126 | 3300042582 | Ga0466657_331339 | Ga0466657_331339_98_886 | 262 |
| 127 | 3300042621 | Ga0466729_182112 | Ga0466729_182112_375_1163 | 262 |
| 128 | 3300042601 | Ga0466707_039538 | Ga0466707_039538_2127_2918 | 263 |
| 129 | 3300042619 | Ga0466726_392059 | Ga0466726_392059_2880_3680 | 266 |
| 130 | 3300042609 | Ga0466722_225610 | Ga0466722_225610_79_888 | 269 |
| 131 | 3300042594 | Ga0466694_010196 | Ga0466694_010196_441_1253 | 270 |
| 132 | 3300009784 | Ga0123357_10125568 | Ga0123357_101255682 | 274 |
| 133 | 3300009784 | Ga0123357_10070838 | Ga0123357_100708382 | 298 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.82 | 0.89 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.