Protein Family IF02210

Metagenome Isolate
126 Members
37 Samples
122 Scaffolds
214.46 Avg Length

🧬 Representative Sequence

ID
3300009784|Ga0123357_10069994|Ga0123357_100699942
Length
252 aa
Sequence
MRILIVTPMKGKRTFMFFSLAASPYYNCTYFPNDIPSVGMGILANFVVFEGLDGSGTTTQLTILDDFFQRNPERLSLPPFYKTFEPTDGSIGRLIRSALRKETVYCPETVALLFAADRREHLYGAGGIAERCGRGELVVSDRYVPSSLVYQGITCGEELPAALNRDFPAPELLLFFDIDPETAQKRMAARNLKEIYEYLDFQIQVRRRYRELLPRFSTEGVRVEIIDASMPPEDVATEAWRAIQKMPIFKK*

📊 Sample Types

Isolate 3.2%
Metagenome 96.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 37.8%
Termitidae 32.4%
Unclassified 13.5%
Termopsidae 8.1%
Rhinotermitidae 5.4%
Hodotermitidae 2.7%

🌳 Taxonomy

Archaea 0
Bacteria 123
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
2 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
3 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
4 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
5 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
6 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
7 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
8 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
9 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
10 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
11 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
12 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
13 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
14 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
15 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
16 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
17 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
18 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
19 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
20 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
21 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
22 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
23 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
24 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
25 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
26 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
27 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
28 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
29 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
30 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
31 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
32 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
33 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
34 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
35 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
36 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
37 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_014231 3300042659 Bacteria 1394
2 Ga0466694_083680 3300042594 Bacteria 1350
3 Ga0123357_10069994 3300009784 Bacteria 4662
4 Ga0466712_228547 3300042614 Bacteria 1431
5 Ga0466711_215751 3300042615 Bacteria 1706
6 Ga0466711_508141 3300042615 Bacteria 28214
7 Ga0466715_520515 3300042616 Bacteria 12928
8 Ga0466726_172358 3300042619 Bacteria 17260
9 Ga0466716_091684 3300042605 Bacteria 2726
10 Ga0466716_333462 3300042605 Bacteria 9932
11 Ga0466719_022352 3300042606 Bacteria 10477
12 Ga0466719_281495 3300042606 Bacteria 2615
13 Ga0466708_253425 3300042652 Bacteria 11269
14 Ga0466690_111654 3300042590 Bacteria 17140
15 Ga0466691_010755 3300042593 Bacteria 15654
16 Ga0466691_031623 3300042593 Bacteria 7269
17 Ga0466691_103240 3300042593 Bacteria 28955
18 Ga0466694_160066 3300042594 Bacteria 32925
19 Ga0123357_10304805 3300009784 Bacteria 1602
20 Ga0466715_297001 3300042616 Bacteria 3631
21 Ga0466723_193452 3300042618 Bacteria 1806
22 Ga0466726_126971 3300042619 Bacteria 10971
23 Ga0466728_106715 3300042620 Bacteria 15608
24 Ga0466717_037529 3300042604 Bacteria 1430
25 Ga0466716_037984 3300042605 Bacteria 7353
26 Ga0466719_118442 3300042606 Bacteria 3143
27 Ga0466719_143222 3300042606 Bacteria 16765
28 Ga0466703_061489 3300042636 Bacteria 6832
29 Ga0466703_106914 3300042636 Bacteria 14085
30 Ga0466704_251320 3300042643 Bacteria 235343
31 Ga0466708_216915 3300042652 Bacteria 2884
32 Ga0466727_057291 3300042655 Bacteria 1994
33 Ga0466705_059730 3300042612 Bacteria 2463
34 Ga0466705_119235 3300042612 Unclassified 9349
35 Ga0466705_234256 3300042612 Bacteria 9445
36 Ga0466733_034561 3300042659 Bacteria 83410
37 Ga0466733_084000 3300042659 Bacteria 2526
38 Ga0466696_212523 3300042596 Bacteria 4965
39 Ga0123353_10637096 3300010167 Bacteria 1513
40 JGI24695J34938_10178454 3300002450 Bacteria 878
41 Ga0466712_016304 3300042614 Bacteria 11968
42 Ga0466715_447524 3300042616 Bacteria 20272
43 Ga0466723_012916 3300042618 Bacteria 12842
44 Ga0466723_271155 3300042618 Bacteria 10289
45 Ga0466723_286489 3300042618 Bacteria 3816
46 Ga0466723_351578 3300042618 Bacteria 1922
47 Ga0466716_103126 3300042605 Bacteria 8629
48 Ga0466719_072769 3300042606 Bacteria 4255
49 Ga0466735_034659 3300042624 Bacteria 1339
50 Ga0466709_070696 3300042648 Bacteria 17498
51 Ga0466709_159213 3300042648 Bacteria 2175
52 Ga0466727_312409 3300042655 Bacteria 1549
53 Ga0466727_325392 3300042655 Bacteria 5786
54 Ga0466705_045543 3300042612 Bacteria 1010
55 Ga0466733_183013 3300042659 Bacteria 1816
56 Ga0466690_185002 3300042590 Bacteria 2087
57 Ga0466690_413012 3300042590 Unclassified 1016
58 Ga0466691_057544 3300042593 Bacteria 3673
59 Ga0466694_381535 3300042594 Bacteria 1264
60 Ga0466712_155352 3300042614 Bacteria 28394
61 Ga0466711_011072 3300042615 Bacteria 1968
62 Ga0466715_025483 3300042616 Bacteria 12653
63 Ga0466718_137791 3300042617 Bacteria 4476
64 Ga0466723_099704 3300042618 Bacteria 4420
65 Ga0466728_208062 3300042620 Bacteria 4629
66 Ga0466728_363269 3300042620 Bacteria 3315
67 Ga0466707_037289 3300042601 Bacteria 1719
68 Ga0466719_052725 3300042606 Bacteria 9488
69 Ga0466705_035843 3300042612 Bacteria 27929
70 Ga0466705_161281 3300042612 Bacteria 33011
71 Ga0466733_199666 3300042659 Bacteria 24852
72 Ga0466690_058375 3300042590 Bacteria 3283
73 Ga0466692_190769 3300042591 Bacteria 106111
74 Ga0466696_085375 3300042596 Bacteria 1255
75 Ga0123355_10003512 3300009826 Bacteria 22505
76 Ga0466705_510725 3300042612 Bacteria 2031
77 Ga0466711_190939 3300042615 Bacteria 3014
78 Ga0466726_300904 3300042619 Bacteria 3087
79 Ga0466706_020419 3300042599 Bacteria 1447
80 Ga0466706_049945 3300042599 Bacteria 2150
81 Ga0466716_149740 3300042605 Bacteria 1977
82 Ga0466719_294784 3300042606 Bacteria 5673
83 Ga0466733_101119 3300042659 Bacteria 4022
84 Ga0466691_105933 3300042593 Unclassified 9504
85 Ga0466696_264998 3300042596 Bacteria 25297
86 JGI24698J34947_10028936 3300002449 Bacteria 2932
87 JGI24695J34938_10000180 3300002450 Bacteria 58816
88 JGI24705J35276_12188291 3300002504 Bacteria 1439
89 Ga0466712_022893 3300042614 Bacteria 16595
90 Ga0466711_243812 3300042615 Bacteria 1748
91 Ga0466723_026938 3300042618 Bacteria 5476
92 Ga0466719_339448 3300042606 Bacteria 5971
93 Ga0466703_080147 3300042636 Bacteria 13387
94 Ga0466703_400973 3300042636 Bacteria 15271
95 Ga0466704_254092 3300042643 Bacteria 3641
96 Ga0466690_216430 3300042590 Bacteria 5007
97 JGI24702J35022_10004366 3300002462 Bacteria 8422
98 Ga0466712_222923 3300042614 Bacteria 1133
99 Ga0466712_238513 3300042614 Bacteria 4975
100 Ga0466711_083845 3300042615 Bacteria 3152
101 Ga0466716_019913 3300042605 Bacteria 15015
102 Ga0466716_158530 3300042605 Bacteria 23396
103 Ga0466719_420454 3300042606 Bacteria 7515
104 Ga0466722_223232 3300042609 Bacteria 6609
105 Ga0466703_221397 3300042636 Bacteria 13829
106 Ga0466704_062317 3300042643 Bacteria 7430
107 Ga0466704_078216 3300042643 Bacteria 3219
108 Ga0466704_160887 3300042643 Bacteria 35133
109 Ga0466709_226361 3300042648 Bacteria 19165
110 Ga0466705_315074 3300042612 Bacteria 1027
111 Ga0123357_10009256 3300009784 Bacteria 12411
112 JGI24698J34947_10031709 3300002449 Bacteria 2780
113 Ga0466715_298491 3300042616 Bacteria 13335
114 Ga0466723_230284 3300042618 Bacteria 2307
115 Ga0466707_045474 3300042601 Bacteria 1085
116 Ga0466716_239525 3300042605 Bacteria 9070
117 Ga0466719_272421 3300042606 Bacteria 3182
118 Ga0466719_306064 3300042606 Bacteria 6430
119 Ga0466722_045306 3300042609 Bacteria 1566
120 Ga0466704_037388 3300042643 Bacteria 1702
121 Ga0466704_167694 3300042643 Bacteria 1842
122 Ga0466727_309654 3300042655 Bacteria 1067

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042655 Ga0466727_312409 Ga0466727_312409_949_1512 187
2 3300042618 Ga0466723_099704 Ga0466723_099704_1152_1781 194
3 3300042616 Ga0466715_025483 Ga0466715_025483_11717_12367 196
4 3300042606 Ga0466719_052725 Ga0466719_052725_605_1249 203
5 3300042616 Ga0466715_298491 Ga0466715_298491_1004_1639 203
6 3300042619 Ga0466726_300904 Ga0466726_300904_1159_1770 203
7 3300042643 Ga0466704_160887 Ga0466704_160887_22791_23402 203
8 3300042655 Ga0466727_325392 Ga0466727_325392_4366_4977 203
9 3300042612 Ga0466705_161281 Ga0466705_161281_20696_21310 204
10 3300042599 Ga0466706_020419 Ga0466706_020419_724_1341 205
11 3300042606 Ga0466719_072769 Ga0466719_072769_923_1546 207
12 3300042659 Ga0466733_183013 Ga0466733_183013_126_749 207
13 3300042593 Ga0466691_031623 Ga0466691_031623_3845_4471 208
14 3300042601 Ga0466707_045474 Ga0466707_045474_257_883 208
15 3300042612 Ga0466705_035843 Ga0466705_035843_9376_10002 208
16 3300042615 Ga0466711_083845 Ga0466711_083845_1411_2037 208
17 3300042619 Ga0466726_172358 Ga0466726_172358_490_1116 208
18 3300042636 Ga0466703_080147 Ga0466703_080147_1274_1900 208
19 3300042643 Ga0466704_251320 Ga0466704_251320_165437_166063 208
20 3300042655 Ga0466727_057291 Ga0466727_057291_902_1528 208
21 3300042605 Ga0466716_149740 Ga0466716_149740_179_808 209
22 3300042606 Ga0466719_118442 Ga0466719_118442_947_1576 209
23 3300042606 Ga0466719_294784 Ga0466719_294784_2216_2845 209
24 3300042606 Ga0466719_306064 Ga0466719_306064_365_994 209
25 3300042616 Ga0466715_520515 Ga0466715_520515_1020_1649 209
26 3300042618 Ga0466723_286489 Ga0466723_286489_2799_3428 209
27 3300042659 Ga0466733_199666 Ga0466733_199666_14592_15221 209
28 3300002449 JGI24698J34947_10028936 JGI24698J34947_100289362 210
29 3300042594 Ga0466694_160066 Ga0466694_160066_29981_30613 210
30 3300042601 Ga0466707_037289 Ga0466707_037289_872_1537 210
31 3300042624 Ga0466735_034659 Ga0466735_034659_326_958 210
32 3300002504 JGI24705J35276_12188291 JGI24705J35276_121882912 211
33 3300009784 Ga0123357_10304805 Ga0123357_103048052 211
34 3300042590 Ga0466690_111654 Ga0466690_111654_2405_3040 211
35 3300042593 Ga0466691_103240 Ga0466691_103240_14114_14749 211
36 3300042596 Ga0466696_264998 Ga0466696_264998_1846_2481 211
37 3300042605 Ga0466716_239525 Ga0466716_239525_1047_1682 211
38 3300042612 Ga0466705_119235 Ga0466705_119235_953_1588 211
39 3300042612 Ga0466705_234256 Ga0466705_234256_7369_8004 211
40 3300042615 Ga0466711_243812 Ga0466711_243812_678_1313 211
41 3300042618 Ga0466723_012916 Ga0466723_012916_11377_12012 211
42 3300042620 Ga0466728_363269 Ga0466728_363269_2248_2883 211
43 3300042636 Ga0466703_221397 Ga0466703_221397_2357_2992 211
44 3300042643 Ga0466704_037388 Ga0466704_037388_1011_1646 211
45 3300042643 Ga0466704_167694 Ga0466704_167694_609_1244 211
46 3300042648 Ga0466709_070696 Ga0466709_070696_5343_5978 211
47 3300002450 JGI24695J34938_10178454 JGI24695J34938_101784541 212
48 3300042594 Ga0466694_083680 Ga0466694_083680_448_1086 212
49 3300042594 Ga0466694_381535 Ga0466694_381535_414_1052 212
50 3300042606 Ga0466719_339448 Ga0466719_339448_3581_4219 212
51 3300042614 Ga0466712_016304 Ga0466712_016304_2440_3078 212
52 3300042614 Ga0466712_022893 Ga0466712_022893_12435_13073 212
53 3300042614 Ga0466712_222923 Ga0466712_222923_461_1099 212
54 3300042614 Ga0466712_228547 Ga0466712_228547_389_1027 212
55 3300042616 Ga0466715_447524 Ga0466715_447524_19599_20237 212
56 3300042618 Ga0466723_193452 Ga0466723_193452_828_1466 212
57 3300042643 Ga0466704_078216 Ga0466704_078216_1176_1814 212
58 3300042652 Ga0466708_216915 Ga0466708_216915_2096_2734 212
59 iso_pr_bacteria 2781125632 2781271820 212
60 3300010167 Ga0123353_10637096 Ga0123353_106370961 213
61 3300042590 Ga0466690_058375 Ga0466690_058375_37_678 213
62 3300042590 Ga0466690_216430 Ga0466690_216430_1603_2244 213
63 3300042593 Ga0466691_105933 Ga0466691_105933_2326_2967 213
64 3300042596 Ga0466696_085375 Ga0466696_085375_583_1224 213
65 3300042615 Ga0466711_011072 Ga0466711_011072_626_1267 213
66 3300042615 Ga0466711_190939 Ga0466711_190939_386_1027 213
67 3300042615 Ga0466711_215751 Ga0466711_215751_678_1319 213
68 3300042618 Ga0466723_026938 Ga0466723_026938_2416_3057 213
69 3300042618 Ga0466723_271155 Ga0466723_271155_9017_9658 213
70 3300042620 Ga0466728_106715 Ga0466728_106715_11703_12344 213
71 iso_pr_bacteria 2781125644 2781295590 213
72 iso_pr_bacteria 650716099 650878930 213
73 3300002450 JGI24695J34938_10000180 JGI24695J34938_100001805 214
74 3300042591 Ga0466692_190769 Ga0466692_190769_76852_77496 214
75 3300042596 Ga0466696_212523 Ga0466696_212523_3894_4538 214
76 3300042606 Ga0466719_281495 Ga0466719_281495_607_1251 214
77 3300042612 Ga0466705_059730 Ga0466705_059730_1715_2359 214
78 iso_pr_bacteria 2781125655 2781318157 214
79 3300009826 Ga0123355_10003512 Ga0123355_1000351218 215
80 3300042604 Ga0466717_037529 Ga0466717_037529_182_829 215
81 3300042612 Ga0466705_045543 Ga0466705_045543_343_990 215
82 3300042636 Ga0466703_106914 Ga0466703_106914_13315_13962 215
83 3300042643 Ga0466704_062317 Ga0466704_062317_5849_6496 215
84 3300042599 Ga0466706_049945 Ga0466706_049945_775_1425 216
85 3300042605 Ga0466716_158530 Ga0466716_158530_4282_4932 216
86 3300042605 Ga0466716_333462 Ga0466716_333462_6548_7198 216
87 3300042636 Ga0466703_061489 Ga0466703_061489_5906_6556 216
88 3300042636 Ga0466703_400973 Ga0466703_400973_368_1018 216
89 3300042643 Ga0466704_254092 Ga0466704_254092_1326_1976 216
90 3300042590 Ga0466690_185002 Ga0466690_185002_1412_2065 217
91 3300042590 Ga0466690_413012 Ga0466690_413012_45_698 217
92 3300042605 Ga0466716_091684 Ga0466716_091684_1510_2163 217
93 3300042605 Ga0466716_103126 Ga0466716_103126_4774_5427 217
94 3300042606 Ga0466719_420454 Ga0466719_420454_829_1482 217
95 3300042612 Ga0466705_315074 Ga0466705_315074_202_855 217
96 3300042615 Ga0466711_508141 Ga0466711_508141_15782_16435 217
97 3300002449 JGI24698J34947_10031709 JGI24698J34947_100317091 218
98 3300009784 Ga0123357_10009256 Ga0123357_100092564 218
99 3300042606 Ga0466719_143222 Ga0466719_143222_15277_15933 218
100 3300042616 Ga0466715_297001 Ga0466715_297001_1928_2584 218
101 3300042618 Ga0466723_351578 Ga0466723_351578_743_1399 218
102 3300042593 Ga0466691_057544 Ga0466691_057544_2454_3113 219
103 3300042614 Ga0466712_155352 Ga0466712_155352_26221_26880 219
104 3300042618 Ga0466723_230284 Ga0466723_230284_1309_1968 219
105 3300042606 Ga0466719_272421 Ga0466719_272421_1555_2283 220
106 3300042620 Ga0466728_208062 Ga0466728_208062_3341_4003 220
107 3300042609 Ga0466722_045306 Ga0466722_045306_372_1037 221
108 3300042605 Ga0466716_037984 Ga0466716_037984_1597_2268 223
109 3300042652 Ga0466708_253425 Ga0466708_253425_4374_5045 223
110 3300042648 Ga0466709_226361 Ga0466709_226361_7227_7901 224
111 3300042593 Ga0466691_010755 Ga0466691_010755_2849_3526 225
112 3300042605 Ga0466716_019913 Ga0466716_019913_12515_13192 225
113 3300042606 Ga0466719_022352 Ga0466719_022352_9583_10260 225
114 3300042655 Ga0466727_309654 Ga0466727_309654_137_814 225
115 3300002462 JGI24702J35022_10004366 JGI24702J35022_100043662 226
116 3300042619 Ga0466726_126971 Ga0466726_126971_3196_3882 228
117 3300042617 Ga0466718_137791 Ga0466718_137791_3426_4115 229
118 3300042648 Ga0466709_159213 Ga0466709_159213_428_1117 229
119 3300042612 Ga0466705_510725 Ga0466705_510725_109_801 230
120 3300042609 Ga0466722_223232 Ga0466722_223232_4066_4761 231
121 3300042614 Ga0466712_238513 Ga0466712_238513_2171_2869 232
122 3300042659 Ga0466733_034561 Ga0466733_034561_58374_59072 232
123 3300042659 Ga0466733_014231 Ga0466733_014231_673_1383 236
124 3300042659 Ga0466733_084000 Ga0466733_084000_852_1562 236
125 3300042659 Ga0466733_101119 Ga0466733_101119_304_1017 237
126 3300009784 Ga0123357_10069994 Ga0123357_100699942 252

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02223 Thymidylate_kin Thymidylate kinase 49 237 0.91

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.82 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.