Protein Family IF02202

Metagenome Isolate
154 Members
69 Samples
127 Scaffolds
237.17 Avg Length

🧬 Representative Sequence

ID
3300009784|Ga0123357_10058319|Ga0123357_100583193
Length
280 aa
Sequence
MLLFYAPDIATNRQLPETEAHHCVKVLRMQEGDALWLTDGKGFFYRAEIAEISYQGIAGQARNDKKSNYCMVNLLETIPQPPLWKGTIEIALAPTKNTDRIEWFAEKATEIGIDTISFFRCRFSERKEMSTERILKIMISAMKQSEKARLPVVNAITDFKDFIRQDFDGQKFIAHCHPDEKMLLAQAYHVDENVRILIGPEGDFSEDEISLSKKHGFIPVSLGASRLRTETAALTACQTFHIVNQIVCTPKSTKGDLPQYNIQNHFANSPFRELEGNEL*

📊 Sample Types

Isolate 17.5%
Metagenome 82.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 23.5%
Termitidae 23.5%
Kalotermitidae 19.1%
Unclassified 13.2%
Rhinotermitidae 7.4%
Passalidae 4.4%
Termopsidae 2.9%
Hydrophilidae 2.9%
Tenebrionidae 1.5%
Hodotermitidae 1.5%

🌳 Taxonomy

Archaea 0
Bacteria 151
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
2 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
3 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
4 3004667792 Bacteroides sp. 519 Isolate Blattidae
5 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
6 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
7 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
8 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
9 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
10 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
11 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
12 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
13 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
14 3004677695 Bacteroides sp. 214 Isolate Blattidae
15 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
16 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
17 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
18 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
19 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
20 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
21 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
22 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
23 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
24 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
25 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
26 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
27 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
28 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
29 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
30 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
31 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
32 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
33 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
34 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
35 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
36 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
37 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
38 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
39 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
40 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
41 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
42 3004672520 Bacteroides sp. 51 Isolate Blattidae
43 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
44 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
45 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
46 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
47 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
48 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
49 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
50 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
51 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
52 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
53 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
54 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
55 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
56 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
57 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
58 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
59 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
60 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
61 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
62 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
63 2922326829 Bacteroides sp. 224 Isolate Blattidae
64 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
65 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
66 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
67 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
68 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
69 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466716_441348 3300042605 Bacteria 12409
2 Ga0466698_391706 3300042610 Bacteria 3687
3 Ga0466710_312237 3300042613 Bacteria 6688
4 Ga0466715_332133 3300042616 Bacteria 83480
5 Ga0123356_10577058 3300010049 Bacteria 1288
6 Ga0466734_136439 3300042623 Bacteria 1114
7 Ga0466704_047237 3300042643 Bacteria 3043
8 Ga0466704_144742 3300042643 Bacteria 4128
9 Ga0466727_237302 3300042655 Bacteria 10168
10 Ga0466692_175726 3300042591 Bacteria 1180
11 IMNBL1DRAFT_c0000965 3300000062 Bacteria 22212
12 Ga0072941_1042687 3300005201 Bacteria 4764
13 Ga0123357_10000752 3300009784 Bacteria 32677
14 Ga0466697_175217 3300042611 Bacteria 24944
15 Ga0466705_323042 3300042612 Bacteria 4912
16 Ga0466705_349592 3300042612 Bacteria 3165
17 Ga0466733_074294 3300042659 Bacteria 93274
18 Ga0466706_242401 3300042599 Bacteria 7115
19 Ga0466707_096581 3300042601 Bacteria 1082
20 Ga0466707_096776 3300042601 Unclassified 1759
21 Ga0466707_232641 3300042601 Bacteria 41634
22 Ga0466711_015866 3300042615 Bacteria 1157
23 Ga0466715_164258 3300042616 Bacteria 10014
24 Ga0123357_10006182 3300009784 Bacteria 14525
25 Ga0466735_135242 3300042624 Bacteria 1844
26 Ga0466735_224687 3300042624 Bacteria 7662
27 Ga0466730_068888 3300042625 Bacteria 3292
28 Ga0466703_262959 3300042636 Bacteria 29096
29 Ga0466704_181421 3300042643 Bacteria 11545
30 Ga0466708_084131 3300042652 Bacteria 6382
31 Ga0466691_124508 3300042593 Bacteria 35460
32 2227079941 2225789003 Unclassified 2023
33 IMNBL1DRAFT_c0019303 3300000062 Bacteria 2798
34 Ga0466733_220888 3300042659 Bacteria 25948
35 Ga0562377_0004 3300056842 Bacteria 3525959
36 Ga0466706_109717 3300042599 Bacteria 38259
37 Ga0466706_249816 3300042599 Bacteria 12942
38 Ga0466707_046218 3300042601 Bacteria 6341
39 Ga0466713_130991 3300042602 Bacteria 214088
40 Ga0466719_341919 3300042606 Bacteria 1506
41 Ga0466711_006830 3300042615 Bacteria 29316
42 Ga0466729_176443 3300042621 Bacteria 21516
43 Ga0123357_10005407 3300009784 Bacteria 15290
44 Ga0466735_073816 3300042624 Bacteria 2112
45 Ga0466735_139907 3300042624 Bacteria 1947
46 Ga0466735_181415 3300042624 Bacteria 3634
47 Ga0466690_355258 3300042590 Bacteria 7700
48 Ga0466705_376098 3300042612 Unclassified 1711
49 Ga0466733_028288 3300042659 Bacteria 11210
50 Ga0466733_094779 3300042659 Bacteria 1906
51 Ga0466706_121012 3300042599 Bacteria 39559
52 Ga0466713_096596 3300042602 Bacteria 406546
53 Ga0466719_343976 3300042606 Bacteria 3739
54 Ga0466705_471727 3300042612 Bacteria 3420
55 Ga0466735_048585 3300042624 Bacteria 7043
56 Ga0466735_054717 3300042624 Bacteria 2562
57 Ga0466703_352236 3300042636 Bacteria 13812
58 Ga0466705_183444 3300042612 Bacteria 1691
59 Ga0466705_281432 3300042612 Bacteria 24457
60 Ga0466701_072055 3300042598 Bacteria 39896
61 Ga0466706_009507 3300042599 Bacteria 49149
62 Ga0466706_166563 3300042599 Bacteria 29380
63 Ga0466700_366097 3300042600 Bacteria 2630
64 Ga0466707_138118 3300042601 Bacteria 2345
65 Ga0466707_295623 3300042601 Bacteria 1115
66 Ga0466713_125888 3300042602 Bacteria 191726
67 Ga0466713_134411 3300042602 Bacteria 55260
68 Ga0466715_130401 3300042616 Bacteria 3774
69 Ga0466715_320642 3300042616 Bacteria 27497
70 Ga0123357_10004606 3300009784 Bacteria 16255
71 Ga0123357_10371846 3300009784 Bacteria 1339
72 Ga0123354_10051129 3300010882 Bacteria 6243
73 Ga0466735_015687 3300042624 Bacteria 4198
74 Ga0466702_107576 3300042635 Bacteria 1993
75 Ga0466703_202653 3300042636 Bacteria 3738
76 Ga0466708_140172 3300042652 Bacteria 30570
77 JGI24699J35502_11133282 3300002509 Bacteria 9610
78 JGI24699J35502_11134081 3300002509 Bacteria 28828
79 Ga0072941_1169568 3300005201 Bacteria 868
80 Ga0466733_202134 3300042659 Bacteria 48711
81 Ga0466706_107962 3300042599 Bacteria 3768
82 Ga0466706_224673 3300042599 Bacteria 38412
83 Ga0466713_132298 3300042602 Bacteria 14712
84 Ga0466710_275465 3300042613 Bacteria 2623
85 Ga0466711_045620 3300042615 Bacteria 22798
86 Ga0466711_392107 3300042615 Bacteria 21134
87 Ga0123357_10058319 3300009784 Bacteria 5184
88 Ga0123357_10086522 3300009784 Bacteria 4100
89 Ga0123353_10613520 3300010167 Bacteria 1551
90 Ga0123354_10029273 3300010882 Bacteria 8667
91 Ga0123354_10052241 3300010882 Bacteria 6159
92 Ga0123354_10431483 3300010882 Bacteria 1085
93 Ga0466729_276655 3300042621 Bacteria 1602
94 Ga0466735_024444 3300042624 Bacteria 1764
95 Ga0466704_125688 3300042643 Bacteria 12394
96 Ga0466709_077519 3300042648 Bacteria 9059
97 Ga0466690_250711 3300042590 Bacteria 19853
98 2227538524 2225789004 Bacteria 15833
99 IMNBL1DRAFT_c0010237 3300000062 Bacteria 4521
100 JGI24702J35022_10040358 3300002462 Bacteria 2489
101 JGI24699J35502_11134060 3300002509 Bacteria 27589
102 Ga0466701_089428 3300042598 Bacteria 9441
103 Ga0466707_374545 3300042601 Bacteria 11431
104 Ga0466716_085926 3300042605 Bacteria 4722
105 Ga0466716_410963 3300042605 Bacteria 3557
106 Ga0466719_047405 3300042606 Bacteria 4133
107 Ga0466698_052603 3300042610 Bacteria 1580
108 Ga0466711_471547 3300042615 Bacteria 15822
109 Ga0466715_609492 3300042616 Bacteria 9096
110 Ga0123354_10138266 3300010882 Bacteria 3031
111 Ga0466735_006600 3300042624 Bacteria 3088
112 Ga0466735_152891 3300042624 Bacteria 1920
113 Ga0466690_373583 3300042590 Bacteria 20133
114 Ga0466696_454722 3300042596 Bacteria 41485
115 2227008134 2225789003 Bacteria 27277
116 Ga0068305_10003714 3300005083 Bacteria 240854
117 Ga0466706_051411 3300042599 Bacteria 14066
118 Ga0466728_331236 3300042620 Bacteria 43818
119 Ga0123356_10687311 3300010049 Bacteria 1192
120 Ga0123354_10015532 3300010882 Bacteria 11896
121 Ga0123354_10040937 3300010882 Bacteria 7163
122 Ga0466735_086464 3300042624 Bacteria 5544
123 Ga0466735_199641 3300042624 Bacteria 1682
124 Ga0466704_397114 3300042643 Bacteria 24756
125 Ga0466708_200901 3300042652 Bacteria 4214
126 Ga0466692_199363 3300042591 Bacteria 30623
127 Ga0466695_044334 3300042595 Bacteria 3068

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042616 Ga0466715_332133 Ga0466715_332133_31954_32664 225
2 iso_pr_bacteria 3004677695 3004677944 229
3 3300042643 Ga0466704_181421 Ga0466704_181421_135_827 230
4 3300042624 Ga0466735_086464 Ga0466735_086464_2787_3482 231
5 iso_pr_bacteria 2820757377 2820758637 231
6 2225789003 2227008134 2227364996 232
7 2225789004 2227538524 2228058118 232
8 3300002509 JGI24699J35502_11134081 JGI24699J35502_1113408116 232
9 3300042590 Ga0466690_355258 Ga0466690_355258_6117_6815 232
10 3300042593 Ga0466691_124508 Ga0466691_124508_13761_14459 232
11 3300042596 Ga0466696_454722 Ga0466696_454722_18145_18843 232
12 3300042599 Ga0466706_107962 Ga0466706_107962_3032_3730 232
13 3300042599 Ga0466706_121012 Ga0466706_121012_882_1580 232
14 3300042599 Ga0466706_224673 Ga0466706_224673_21009_21707 232
15 3300042601 Ga0466707_295623 Ga0466707_295623_393_1091 232
16 3300042605 Ga0466716_410963 Ga0466716_410963_748_1446 232
17 3300042615 Ga0466711_471547 Ga0466711_471547_10020_10718 232
18 3300042616 Ga0466715_164258 Ga0466715_164258_5032_5730 232
19 3300042620 Ga0466728_331236 Ga0466728_331236_42282_42980 232
20 3300042624 Ga0466735_024444 Ga0466735_024444_186_884 232
21 3300042648 Ga0466709_077519 Ga0466709_077519_1296_1994 232
22 3300042652 Ga0466708_084131 Ga0466708_084131_2326_3024 232
23 3300042652 Ga0466708_200901 Ga0466708_200901_1942_2640 232
24 3300042659 Ga0466733_074294 Ga0466733_074294_81581_82279 232
25 iso_pr_bacteria 2609459943 2610740453 232
26 iso_pr_bacteria 2830041218 2830043599 232
27 iso_pr_bacteria 2922326829 2922327284 232
28 iso_pr_bacteria 2940202316 2940204810 232
29 2225789003 2227079941 2227447657 233
30 3300005083 Ga0068305_10003714 Ga0068305_1000371487 233
31 3300042591 Ga0466692_175726 Ga0466692_175726_64_765 233
32 3300042591 Ga0466692_199363 Ga0466692_199363_7236_7937 233
33 3300042599 Ga0466706_009507 Ga0466706_009507_4819_5520 233
34 3300042599 Ga0466706_109717 Ga0466706_109717_34377_35078 233
35 3300042599 Ga0466706_242401 Ga0466706_242401_1986_2687 233
36 3300042599 Ga0466706_249816 Ga0466706_249816_9379_10080 233
37 3300042602 Ga0466713_096596 Ga0466713_096596_83733_84434 233
38 3300042602 Ga0466713_125888 Ga0466713_125888_150699_151400 233
39 3300042606 Ga0466719_343976 Ga0466719_343976_2103_2804 233
40 3300042612 Ga0466705_281432 Ga0466705_281432_18191_18892 233
41 3300042612 Ga0466705_323042 Ga0466705_323042_1998_2699 233
42 3300042612 Ga0466705_349592 Ga0466705_349592_1925_2626 233
43 3300042612 Ga0466705_376098 Ga0466705_376098_540_1241 233
44 3300042616 Ga0466715_320642 Ga0466715_320642_15820_16521 233
45 3300042624 Ga0466735_073816 Ga0466735_073816_378_1079 233
46 3300042636 Ga0466703_262959 Ga0466703_262959_27135_27836 233
47 3300042659 Ga0466733_094779 Ga0466733_094779_1154_1855 233
48 3300042659 Ga0466733_202134 Ga0466733_202134_25120_25821 233
49 iso_pr_bacteria 3004667792 3004668031 233
50 iso_pr_bacteria 3004672520 3004675387 233
51 iso_pr_bacteria 8100166142 8100169220 233
52 3300000062 IMNBL1DRAFT_c0019303 IMNBL1DRAFT_00193032 234
53 3300042590 Ga0466690_250711 Ga0466690_250711_6709_7413 234
54 3300042595 Ga0466695_044334 Ga0466695_044334_2153_2857 234
55 3300042598 Ga0466701_089428 Ga0466701_089428_4348_5052 234
56 3300042599 Ga0466706_166563 Ga0466706_166563_7423_8127 234
57 3300042601 Ga0466707_046218 Ga0466707_046218_1919_2623 234
58 3300042601 Ga0466707_096581 Ga0466707_096581_235_939 234
59 3300042601 Ga0466707_096776 Ga0466707_096776_235_939 234
60 3300042602 Ga0466713_130991 Ga0466713_130991_15807_16511 234
61 3300042602 Ga0466713_132298 Ga0466713_132298_13150_13854 234
62 3300042602 Ga0466713_134411 Ga0466713_134411_25706_26410 234
63 3300042605 Ga0466716_085926 Ga0466716_085926_2930_3634 234
64 3300042606 Ga0466719_047405 Ga0466719_047405_2348_3052 234
65 3300042610 Ga0466698_391706 Ga0466698_391706_1799_2503 234
66 3300042612 Ga0466705_183444 Ga0466705_183444_501_1205 234
67 3300042612 Ga0466705_471727 Ga0466705_471727_120_824 234
68 3300042615 Ga0466711_006830 Ga0466711_006830_14381_15085 234
69 3300042615 Ga0466711_015866 Ga0466711_015866_108_812 234
70 3300042616 Ga0466715_609492 Ga0466715_609492_2274_2978 234
71 3300042621 Ga0466729_176443 Ga0466729_176443_5933_6637 234
72 3300042624 Ga0466735_199641 Ga0466735_199641_545_1249 234
73 3300042625 Ga0466730_068888 Ga0466730_068888_1145_1849 234
74 3300042636 Ga0466703_202653 Ga0466703_202653_2890_3594 234
75 3300042643 Ga0466704_397114 Ga0466704_397114_12119_12823 234
76 3300042655 Ga0466727_237302 Ga0466727_237302_1754_2458 234
77 3300042659 Ga0466733_028288 Ga0466733_028288_9143_9847 234
78 3300042659 Ga0466733_220888 Ga0466733_220888_21112_21816 234
79 3300056842 Ga0562377_0004 Ga0562377_0004_2143636_2144340 234
80 iso_pr_bacteria 2695420314 2695471503 234
81 iso_pr_bacteria 2695420317 2695484253 234
82 iso_pr_bacteria 2695420931 2698109081 234
83 iso_pr_bacteria 2873600114 2873600751 234
84 iso_pr_bacteria 2873610414 2873611073 234
85 iso_pr_bacteria 2910926975 2910927024 234
86 iso_pr_bacteria 2910930387 2910931222 234
87 iso_pr_bacteria 2910942425 2910943181 234
88 iso_pr_bacteria 2910949487 2910951032 234
89 iso_pr_bacteria 2910959314 2910962493 234
90 iso_pr_bacteria 2940193328 2940193954 234
91 iso_pr_bacteria 2940336608 2940337232 234
92 iso_pr_bacteria 8100157865 8100160896 234
93 3300042600 Ga0466700_366097 Ga0466700_366097_974_1681 235
94 3300042606 Ga0466719_341919 Ga0466719_341919_578_1285 235
95 3300042611 Ga0466697_175217 Ga0466697_175217_20916_21623 235
96 3300042613 Ga0466710_275465 Ga0466710_275465_600_1307 235
97 3300042643 Ga0466704_125688 Ga0466704_125688_5049_5756 235
98 3300042615 Ga0466711_045620 Ga0466711_045620_10739_11449 236
99 3300042616 Ga0466715_130401 Ga0466715_130401_1797_2507 236
100 3300042636 Ga0466703_352236 Ga0466703_352236_7925_8635 236
101 3300042643 Ga0466704_144742 Ga0466704_144742_2543_3253 236
102 3300000062 IMNBL1DRAFT_c0010237 IMNBL1DRAFT_00102373 237
103 3300002462 JGI24702J35022_10040358 JGI24702J35022_100403584 237
104 3300002509 JGI24699J35502_11133282 JGI24699J35502_111332823 237
105 3300009784 Ga0123357_10000752 Ga0123357_1000075213 237
106 3300042590 Ga0466690_373583 Ga0466690_373583_9267_9980 237
107 3300042601 Ga0466707_374545 Ga0466707_374545_4205_4918 237
108 3300042610 Ga0466698_052603 Ga0466698_052603_549_1262 237
109 3300042621 Ga0466729_276655 Ga0466729_276655_608_1321 237
110 3300042635 Ga0466702_107576 Ga0466702_107576_40_753 237
111 3300005201 Ga0072941_1042687 Ga0072941_10426874 238
112 3300005201 Ga0072941_1169568 Ga0072941_11695681 238
113 3300009784 Ga0123357_10004606 Ga0123357_100046067 238
114 3300009784 Ga0123357_10086522 Ga0123357_100865224 238
115 3300042615 Ga0466711_392107 Ga0466711_392107_3267_3983 238
116 3300002509 JGI24699J35502_11134060 JGI24699J35502_1113406014 239
117 3300010882 Ga0123354_10138266 Ga0123354_101382662 239
118 3300010882 Ga0123354_10431483 Ga0123354_104314832 239
119 3300042624 Ga0466735_006600 Ga0466735_006600_1025_1744 239
120 3300042624 Ga0466735_015687 Ga0466735_015687_2305_3024 239
121 3300042624 Ga0466735_135242 Ga0466735_135242_494_1213 239
122 3300042624 Ga0466735_181415 Ga0466735_181415_1072_1791 239
123 3300042624 Ga0466735_224687 Ga0466735_224687_572_1291 239
124 3300042643 Ga0466704_047237 Ga0466704_047237_875_1594 239
125 3300042652 Ga0466708_140172 Ga0466708_140172_16720_17439 239
126 iso_pr_bacteria 2820762746 2820763926 239
127 3300042624 Ga0466735_054717 Ga0466735_054717_343_1065 240
128 3300042605 Ga0466716_441348 Ga0466716_441348_2313_3038 241
129 3300042624 Ga0466735_048585 Ga0466735_048585_631_1365 244
130 3300042624 Ga0466735_139907 Ga0466735_139907_210_944 244
131 3300042624 Ga0466735_152891 Ga0466735_152891_262_996 244
132 3300000062 IMNBL1DRAFT_c0000965 IMNBL1DRAFT_000096513 247
133 3300010049 Ga0123356_10687311 Ga0123356_106873112 247
134 3300010167 Ga0123353_10613520 Ga0123353_106135202 247
135 3300042601 Ga0466707_138118 Ga0466707_138118_381_1127 248
136 3300010049 Ga0123356_10577058 Ga0123356_105770582 249
137 3300042598 Ga0466701_072055 Ga0466701_072055_30025_30774 249
138 3300042623 Ga0466734_136439 Ga0466734_136439_162_911 249
139 3300010882 Ga0123354_10015532 Ga0123354_100155328 250
140 3300010882 Ga0123354_10029273 Ga0123354_100292738 250
141 iso_pr_bacteria 2940244548 2940244609 250
142 iso_pr_bacteria 2940248789 2940248850 250
143 iso_pr_bacteria 2940253009 2940253421 250
144 iso_pr_bacteria 2940257232 2940259616 250
145 3300009784 Ga0123357_10371846 Ga0123357_103718462 251
146 3300010882 Ga0123354_10051129 Ga0123354_100511296 251
147 3300010882 Ga0123354_10052241 Ga0123354_100522415 251
148 3300042613 Ga0466710_312237 Ga0466710_312237_3012_3773 253
149 3300009784 Ga0123357_10005407 Ga0123357_1000540710 254
150 3300042599 Ga0466706_051411 Ga0466706_051411_10067_10831 254
151 3300042601 Ga0466707_232641 Ga0466707_232641_11068_11841 257
152 3300010882 Ga0123354_10040937 Ga0123354_100409379 258
153 3300009784 Ga0123357_10006182 Ga0123357_100061829 260
154 3300009784 Ga0123357_10058319 Ga0123357_100583193 280

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF20260 PUA_4 RNA methyltransferase PUA domain 15 53 0.94
PF04452 Methyltrans_RNA RNA methyltransferase domain 87 239 0.89

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.86 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.