Protein Family IF02198

Metagenome Isolate
165 Members
42 Samples
153 Scaffolds
751.64 Avg Length

🧬 Representative Sequence

ID
3300009784|Ga0123357_10049215|Ga0123357_100492156
Length
814 aa
Sequence
MKIKNKNRRSISCFFPVVLFIVFSSFPVSGGIFFSGLDLSGDNQLLFHAGSGYSSVQEALFVTRLPAAAPEQGSAGFPAQQLTAFPEKMDLLENGRVLQIRNIFGAARLSLPAGLPMPIPGLPSFSGGTTGVSXRSGEMASSADGRWLLYLEPTSAAFGDLVMVDMHSGVKTQVASRLERPEKFFPASWSPDSRMFVYERDGKLYYYMAGTQAVPENEKIRFIGDGAINSIFWGRAGDFYYLSGSTLFRVRSAELITRALYADFLAIGTSVGTIPFEFDPGFDSFWVAPDGRSLLVSKGHRSLFYYPFDTEGQGGTSELPYLLLPRSCSGINVLWSNGGIVTVLVSIPGQTGTDARAWRLDLSGGKGAAFEPLPPPGTGSFALGSLSPDGSLALLWGDGGILLCDYANWKPLETLGSRPGTACLWAADDVIITGDDEKIEQIRLSLPRVNTVLHGAGPLGSTGSPVAGKNDQSGTPLAVVAQRDLVCLSRAPQAGFEEDSFRILAKSGDSWFVTDGKTPWTQINNPRLRSASLVSAQYRVFIERQGSGPYMNLPMIRNTASVGTFPLFPPPPGPRTSASVPAAESDVPYTPGTVFNRGQRNGAKEAALCFDLYDNDEGLPETLDALNRRGIKATFFLNGEFIRRHPLAVQNINAAGHEAASMFFVPLDFSDARYRVDSDFITRGLARNEDEFYRVTGKELALIWHSPWYMVTQDIVTAAAGAGYITTGRDVDPMDWVSRDDEKRLGRPQRSPSEMVDLIMGAVKPGSIIPVRLGFLPGGRKDYLFNRVNVLIDALLGEGYTLTTVSALVQHAK*

📊 Sample Types

Isolate 7.3%
Metagenome 92.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 33.3%
Unclassified 31.0%
Termitidae 23.8%
Rhinotermitidae 4.8%
Termopsidae 4.8%
Blaberidae 2.4%

🌳 Taxonomy

Archaea 2
Bacteria 158
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
2 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
3 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
4 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
5 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
6 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
7 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
8 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
9 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
10 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
11 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
12 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
13 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
14 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
15 2772190975 Treponema sp. RmG30 Isolate Blaberidae
16 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
17 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
18 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
19 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
20 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
21 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
22 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
23 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
24 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
25 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
26 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
27 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
28 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
29 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
30 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
31 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
32 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
33 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
34 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
35 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
36 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
37 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
38 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
39 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
40 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
41 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
42 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_124233 3300042612 Bacteria 14569
2 Ga0466733_180521 3300042659 Bacteria 17102
3 Ga0466711_210537 3300042615 Bacteria 5603
4 Ga0466715_314541 3300042616 Bacteria 9915
5 Ga0466723_110263 3300042618 Bacteria 9880
6 Ga0466723_218636 3300042618 Bacteria 16915
7 Ga0466726_427243 3300042619 Bacteria 17847
8 Ga0466703_031242 3300042636 Bacteria 12127
9 Ga0466704_316403 3300042643 Bacteria 3959
10 Ga0466704_325940 3300042643 Bacteria 3473
11 Ga0466704_424769 3300042643 Unclassified 12841
12 Ga0466708_138975 3300042652 Bacteria 14835
13 Ga0466708_365166 3300042652 Bacteria 2804
14 Ga0466716_120450 3300042605 Bacteria 5060
15 Ga0466719_459331 3300042606 Bacteria 11143
16 Ga0123356_10007683 3300010049 Bacteria 10741
17 Ga0415639_193781 3300038395 Bacteria 3778
18 Ga0466690_098314 3300042590 Bacteria 5178
19 Ga0466696_306420 3300042596 Bacteria 15892
20 JGI24695J34938_10000272 3300002450 Bacteria 50568
21 JGI24695J34938_10007004 3300002450 Unclassified 6683
22 Ga0466705_177886 3300042612 Bacteria 7538
23 Ga0466715_257997 3300042616 Bacteria 3020
24 Ga0466715_353993 3300042616 Bacteria 14235
25 Ga0466723_159008 3300042618 Bacteria 56322
26 Ga0466723_229569 3300042618 Bacteria 135891
27 Ga0466728_005733 3300042620 Bacteria 20067
28 Ga0466704_183325 3300042643 Bacteria 8654
29 Ga0466704_363154 3300042643 Bacteria 5542
30 Ga0466704_416354 3300042643 Bacteria 10281
31 Ga0466704_454619 3300042643 Bacteria 9895
32 Ga0466719_173747 3300042606 Bacteria 10027
33 Ga0123356_10000249 3300010049 Bacteria 61743
34 Ga0466690_199836 3300042590 Bacteria 13330
35 Ga0466691_137710 3300042593 Bacteria 3791
36 Ga0466691_199481 3300042593 Bacteria 5027
37 Ga0466696_337617 3300042596 Bacteria 6086
38 Ga0466705_012664 3300042612 Bacteria 7018
39 Ga0466705_074124 3300042612 Bacteria 9332
40 Ga0466705_114540 3300042612 Bacteria 11488
41 Ga0466705_253523 3300042612 Bacteria 5188
42 Ga0466715_468111 3300042616 Bacteria 3079
43 Ga0466715_519970 3300042616 Bacteria 5132
44 Ga0466723_362992 3300042618 Bacteria 2934
45 Ga0466728_008920 3300042620 Bacteria 17810
46 Ga0466704_397018 3300042643 Bacteria 2624
47 Ga0466709_104527 3300042648 Bacteria 11970
48 Ga0466708_250233 3300042652 Bacteria 19558
49 Ga0123356_10001369 3300010049 Bacteria 26973
50 Ga0123356_10034791 3300010049 Bacteria 4708
51 Ga0466690_043190 3300042590 Bacteria 8945
52 Ga0466696_187020 3300042596 Bacteria 14587
53 AustNasuHG_c1005573 3300000089 Bacteria 4501
54 JGI24695J34938_10010028 3300002450 Bacteria 5224
55 JGI24702J35022_10003976 3300002462 Bacteria 8869
56 Ga0466705_165490 3300042612 Bacteria 12899
57 Ga0466723_233609 3300042618 Bacteria 9424
58 Ga0466723_272035 3300042618 Bacteria 8294
59 Ga0466728_011996 3300042620 Bacteria 16221
60 Ga0466728_141569 3300042620 Bacteria 4786
61 Ga0466703_114043 3300042636 Bacteria 12568
62 Ga0466703_133260 3300042636 Bacteria 3720
63 Ga0466704_545871 3300042643 Bacteria 30505
64 Ga0466709_167461 3300042648 Bacteria 3036
65 Ga0466709_363239 3300042648 Bacteria 7027
66 Ga0466708_209929 3300042652 Bacteria 22287
67 Ga0466719_037026 3300042606 Bacteria 14008
68 Ga0466719_099736 3300042606 Bacteria 10098
69 Ga0466719_110383 3300042606 Bacteria 2662
70 Ga0123356_10003414 3300010049 Bacteria 16656
71 Ga0466691_002215 3300042593 Bacteria 9830
72 Ga0466696_270369 3300042596 Bacteria 5985
73 JGI24695J34938_10000277 3300002450 Bacteria 50322
74 Ga0466705_022616 3300042612 Bacteria 11176
75 Ga0466705_110411 3300042612 Bacteria 3496
76 Ga0466733_003904 3300042659 Bacteria 41210
77 Ga0466705_421001 3300042612 Bacteria 2448
78 Ga0466711_158660 3300042615 Bacteria 36971
79 Ga0466715_121320 3300042616 Bacteria 10399
80 Ga0466726_145246 3300042619 Bacteria 3173
81 Ga0466728_255243 3300042620 Bacteria 7656
82 Ga0466703_095476 3300042636 Bacteria 13766
83 Ga0466704_033267 3300042643 Bacteria 8914
84 Ga0466704_134411 3300042643 Bacteria 12309
85 Ga0466704_354677 3300042643 Bacteria 30303
86 Ga0466704_364093 3300042643 Bacteria 4196
87 Ga0466704_494170 3300042643 Bacteria 24558
88 Ga0466713_059059 3300042602 Bacteria 7675
89 Ga0466716_240279 3300042605 Bacteria 3412
90 Ga0466716_302156 3300042605 Unclassified 4163
91 Ga0466722_060397 3300042609 Bacteria 28397
92 Ga0123357_10018779 3300009784 Bacteria 9199
93 Ga0466691_008415 3300042593 Bacteria 11601
94 Ga0466691_051422 3300042593 Bacteria 10521
95 Ga0466691_190053 3300042593 Bacteria 5924
96 Ga0466696_142470 3300042596 Bacteria 16471
97 Ga0466696_262293 3300042596 Bacteria 8918
98 Ga0068305_10428648 3300005083 Bacteria 7880
99 Ga0466733_171726 3300042659 Bacteria 10855
100 Ga0466711_230197 3300042615 Bacteria 15717
101 Ga0466715_100302 3300042616 Bacteria 14901
102 Ga0466723_162917 3300042618 Bacteria 35021
103 Ga0466703_220691 3300042636 Bacteria 4229
104 Ga0466703_391920 3300042636 Bacteria 11108
105 Ga0466704_311857 3300042643 Bacteria 3037
106 Ga0466719_019334 3300042606 Archaea 6698
107 Ga0466719_100250 3300042606 Bacteria 17752
108 Ga0466719_576750 3300042606 Bacteria 5261
109 Ga0466722_079374 3300042609 Bacteria 11583
110 Ga0123357_10049215 3300009784 Bacteria 5707
111 Ga0466692_016118 3300042591 Bacteria 25451
112 Ga0466696_154370 3300042596 Bacteria 10748
113 JGI24695J34938_10003658 3300002450 Bacteria 10539
114 Ga0466715_189446 3300042616 Bacteria 6264
115 Ga0466715_243993 3300042616 Bacteria 4276
116 Ga0466715_411550 3300042616 Bacteria 11651
117 Ga0466726_242939 3300042619 Bacteria 4534
118 Ga0466726_467127 3300042619 Bacteria 8094
119 Ga0466728_323303 3300042620 Bacteria 6319
120 Ga0466728_424593 3300042620 Bacteria 6196
121 Ga0466703_161668 3300042636 Bacteria 18051
122 Ga0466703_327129 3300042636 Bacteria 12648
123 Ga0466704_042695 3300042643 Bacteria 12252
124 Ga0466704_244372 3300042643 Bacteria 14155
125 Ga0466709_063936 3300042648 Bacteria 7273
126 Ga0466709_121339 3300042648 Bacteria 19510
127 Ga0466708_114055 3300042652 Bacteria 7766
128 Ga0466716_052145 3300042605 Bacteria 22754
129 Ga0466719_162484 3300042606 Bacteria 10183
130 Ga0466719_367100 3300042606 Bacteria 10557
131 Ga0466722_030168 3300042609 Bacteria 24541
132 Ga0123356_10000281 3300010049 Bacteria 58777
133 Ga0466694_073495 3300042594 Bacteria 22298
134 Ga0466696_080074 3300042596 Bacteria 8789
135 Ga0466696_150561 3300042596 Bacteria 3284
136 JGI24695J34938_10006984 3300002450 Bacteria 6692
137 Ga0466705_224657 3300042612 Unclassified 7076
138 Ga0466705_402895 3300042612 Bacteria 3782
139 Ga0466705_463989 3300042612 Bacteria 17419
140 Ga0466711_366238 3300042615 Bacteria 31686
141 Ga0466715_397878 3300042616 Bacteria 19682
142 Ga0466723_056100 3300042618 Bacteria 7564
143 Ga0466703_342974 3300042636 Bacteria 17496
144 Ga0466708_051561 3300042652 Bacteria 14045
145 Ga0466727_061194 3300042655 Bacteria 25961
146 Ga0466716_147276 3300042605 Bacteria 16953
147 Ga0466719_051077 3300042606 Bacteria 6998
148 Ga0123355_10040252 3300009826 Unclassified 7607
149 Ga0123356_10005007 3300010049 Bacteria 13589
150 Ga0123356_10122064 3300010049 Bacteria 2536
151 Ga0123353_10074398 3300010167 Bacteria 5461
152 Ga0466696_218799 3300042596 Bacteria 9303
153 AustNasuHG_c1006816 3300000089 Archaea 4071

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042606 Ga0466719_576750 Ga0466719_576750_40_1938 632
2 3300042590 Ga0466690_098314 Ga0466690_098314_69_2042 652
3 3300042618 Ga0466723_362992 Ga0466723_362992_126_2129 667
4 3300038395 Ga0415639_193781 Ga0415639_193781_1278_3392 680
5 3300010049 Ga0123356_10122064 Ga0123356_101220642 703
6 3300010049 Ga0123356_10000281 Ga0123356_1000028133 709
7 3300010049 Ga0123356_10001369 Ga0123356_1000136910 710
8 3300042612 Ga0466705_402895 Ga0466705_402895_51_2237 710
9 3300010049 Ga0123356_10000249 Ga0123356_1000024938 714
10 3300002450 JGI24695J34938_10003658 JGI24695J34938_100036584 718
11 3300010049 Ga0123356_10007683 Ga0123356_100076836 719
12 3300042593 Ga0466691_051422 Ga0466691_051422_7994_10234 723
13 3300042643 Ga0466704_316403 Ga0466704_316403_277_2508 724
14 3300042618 Ga0466723_272035 Ga0466723_272035_2327_4573 725
15 3300042652 Ga0466708_365166 Ga0466708_365166_302_2527 725
16 3300042612 Ga0466705_124233 Ga0466705_124233_313_2586 728
17 3300042615 Ga0466711_158660 Ga0466711_158660_12115_14427 729
18 3300042606 Ga0466719_051077 Ga0466719_051077_2413_4668 730
19 3300042612 Ga0466705_110411 Ga0466705_110411_958_3219 730
20 3300042616 Ga0466715_243993 Ga0466715_243993_1679_3940 730
21 3300042605 Ga0466716_240279 Ga0466716_240279_1176_3371 731
22 iso_pr_bacteria 2781125648 2781304832 731
23 3300002450 JGI24695J34938_10000277 JGI24695J34938_1000027722 732
24 3300010167 Ga0123353_10074398 Ga0123353_100743982 732
25 3300042616 Ga0466715_314541 Ga0466715_314541_7429_9738 733
26 iso_pr_bacteria 2781125657 2781323331 733
27 iso_pr_bacteria 2781125659 2781327451 733
28 3300010049 Ga0123356_10003414 Ga0123356_100034146 734
29 3300010049 Ga0123356_10005007 Ga0123356_100050076 734
30 iso_pr_bacteria 2781125637 2781281945 735
31 iso_pr_bacteria 2781125649 2781307359 735
32 3300002450 JGI24695J34938_10000272 JGI24695J34938_100002728 736
33 3300002450 JGI24695J34938_10006984 JGI24695J34938_100069842 736
34 3300002450 JGI24695J34938_10007004 JGI24695J34938_100070047 736
35 3300009826 Ga0123355_10040252 Ga0123355_100402526 736
36 3300042606 Ga0466719_459331 Ga0466719_459331_7264_9534 736
37 iso_pr_bacteria 2781125664 2781340043 736
38 3300042648 Ga0466709_063936 Ga0466709_063936_4520_6781 737
39 iso_pr_bacteria 2781125662 2781335796 738
40 3300042609 Ga0466722_079374 Ga0466722_079374_1574_3796 740
41 3300042643 Ga0466704_325940 Ga0466704_325940_195_2435 740
42 3300042591 Ga0466692_016118 Ga0466692_016118_15994_18219 741
43 3300042594 Ga0466694_073495 Ga0466694_073495_16168_18438 742
44 3300042620 Ga0466728_424593 Ga0466728_424593_1541_3817 742
45 3300042612 Ga0466705_224657 Ga0466705_224657_4605_6914 743
46 3300042619 Ga0466726_467127 Ga0466726_467127_1920_4151 743
47 3300042648 Ga0466709_167461 Ga0466709_167461_247_2529 743
48 iso_pr_bacteria 2781125661 2781333495 743
49 3300002450 JGI24695J34938_10010028 JGI24695J34938_100100284 744
50 3300042616 Ga0466715_257997 Ga0466715_257997_446_2698 744
51 3300042596 Ga0466696_262293 Ga0466696_262293_4711_6987 745
52 3300042618 Ga0466723_159008 Ga0466723_159008_16055_18352 745
53 3300042612 Ga0466705_463989 Ga0466705_463989_4419_6740 747
54 3300042636 Ga0466703_031242 Ga0466703_031242_7168_9435 747
55 3300042606 Ga0466719_110383 Ga0466719_110383_227_2533 748
56 3300042636 Ga0466703_095476 Ga0466703_095476_5865_8153 748
57 3300042643 Ga0466704_244372 Ga0466704_244372_11608_13902 748
58 3300042593 Ga0466691_137710 Ga0466691_137710_977_3265 749
59 3300042593 Ga0466691_190053 Ga0466691_190053_2498_4765 749
60 3300042616 Ga0466715_121320 Ga0466715_121320_606_2873 749
61 3300042643 Ga0466704_354677 Ga0466704_354677_20852_23119 749
62 3300042643 Ga0466704_363154 Ga0466704_363154_2959_5241 749
63 3300042615 Ga0466711_210537 Ga0466711_210537_2446_4698 750
64 3300042616 Ga0466715_468111 Ga0466715_468111_428_2719 750
65 3300042616 Ga0466715_411550 Ga0466715_411550_8711_10966 751
66 3300042636 Ga0466703_161668 Ga0466703_161668_1527_3824 751
67 3300042643 Ga0466704_545871 Ga0466704_545871_6735_9071 752
68 3300042648 Ga0466709_121339 Ga0466709_121339_8213_10522 752
69 3300042652 Ga0466708_114055 Ga0466708_114055_350_2662 752
70 3300005083 Ga0068305_10428648 Ga0068305_104286486 753
71 3300042612 Ga0466705_421001 Ga0466705_421001_40_2364 754
72 3300042593 Ga0466691_199481 Ga0466691_199481_2657_4924 755
73 3300042596 Ga0466696_337617 Ga0466696_337617_2910_5228 755
74 3300042606 Ga0466719_037026 Ga0466719_037026_5215_7482 755
75 3300042612 Ga0466705_022616 Ga0466705_022616_7205_9472 755
76 3300042618 Ga0466723_229569 Ga0466723_229569_34626_36893 755
77 3300042619 Ga0466726_145246 Ga0466726_145246_162_2429 755
78 3300042648 Ga0466709_104527 Ga0466709_104527_2489_4804 755
79 3300042618 Ga0466723_218636 Ga0466723_218636_9606_11876 756
80 iso_pr_bacteria 2781125632 2781269551 756
81 3300042606 Ga0466719_099736 Ga0466719_099736_5346_7619 757
82 3300042616 Ga0466715_353993 Ga0466715_353993_8099_10372 757
83 3300042616 Ga0466715_397878 Ga0466715_397878_6158_8431 757
84 3300010049 Ga0123356_10034791 Ga0123356_100347912 758
85 3300042590 Ga0466690_199836 Ga0466690_199836_10799_13075 758
86 3300042606 Ga0466719_162484 Ga0466719_162484_3404_5680 758
87 3300042606 Ga0466719_173747 Ga0466719_173747_4350_6626 758
88 3300042618 Ga0466723_056100 Ga0466723_056100_1870_4146 758
89 3300042652 Ga0466708_138975 Ga0466708_138975_6172_8448 758
90 3300042606 Ga0466719_019334 Ga0466719_019334_1164_3443 759
91 3300042616 Ga0466715_519970 Ga0466715_519970_2372_4714 759
92 3300042618 Ga0466723_162917 Ga0466723_162917_26523_28802 759
93 3300042643 Ga0466704_311857 Ga0466704_311857_276_2597 759
94 3300000089 AustNasuHG_c1005573 AustNasuHG_10055732 760
95 3300042596 Ga0466696_306420 Ga0466696_306420_1020_3302 760
96 3300042620 Ga0466728_011996 Ga0466728_011996_2544_4826 760
97 3300042643 Ga0466704_397018 Ga0466704_397018_101_2431 760
98 3300042652 Ga0466708_209929 Ga0466708_209929_13365_15668 760
99 3300042659 Ga0466733_180521 Ga0466733_180521_14408_16774 760
100 3300042596 Ga0466696_142470 Ga0466696_142470_4899_7184 761
101 3300042596 Ga0466696_187020 Ga0466696_187020_3813_6098 761
102 3300042612 Ga0466705_165490 Ga0466705_165490_287_2572 761
103 3300042615 Ga0466711_230197 Ga0466711_230197_6257_8542 761
104 3300042636 Ga0466703_133260 Ga0466703_133260_352_2637 761
105 3300000089 AustNasuHG_c1006816 AustNasuHG_10068164 762
106 3300042612 Ga0466705_012664 Ga0466705_012664_4010_6298 762
107 3300042648 Ga0466709_363239 Ga0466709_363239_3939_6227 762
108 3300042655 Ga0466727_061194 Ga0466727_061194_17174_19486 762
109 3300042593 Ga0466691_002215 Ga0466691_002215_6964_9255 763
110 3300042602 Ga0466713_059059 Ga0466713_059059_4387_6726 763
111 3300042605 Ga0466716_302156 Ga0466716_302156_711_3002 763
112 3300042606 Ga0466719_100250 Ga0466719_100250_6202_8493 763
113 3300042612 Ga0466705_177886 Ga0466705_177886_1342_3633 763
114 3300042618 Ga0466723_110263 Ga0466723_110263_6731_9022 763
115 3300042620 Ga0466728_141569 Ga0466728_141569_1042_3333 763
116 3300042643 Ga0466704_033267 Ga0466704_033267_2101_4392 763
117 3300042659 Ga0466733_171726 Ga0466733_171726_2814_5108 764
118 iso_pr_bacteria 2772190975 2773722729 764
119 3300042593 Ga0466691_008415 Ga0466691_008415_1759_4056 765
120 3300042605 Ga0466716_052145 Ga0466716_052145_19684_21981 765
121 3300042616 Ga0466715_100302 Ga0466715_100302_4980_7277 765
122 3300042616 Ga0466715_189446 Ga0466715_189446_3372_5669 765
123 3300042620 Ga0466728_008920 Ga0466728_008920_10537_12834 765
124 3300042636 Ga0466703_220691 Ga0466703_220691_1214_3529 765
125 3300042636 Ga0466703_327129 Ga0466703_327129_7509_9806 765
126 3300042643 Ga0466704_042695 Ga0466704_042695_3715_6012 765
127 3300042643 Ga0466704_494170 Ga0466704_494170_15269_17566 765
128 3300042659 Ga0466733_003904 Ga0466733_003904_24569_26866 765
129 3300042590 Ga0466690_043190 Ga0466690_043190_351_2651 766
130 3300042605 Ga0466716_120450 Ga0466716_120450_1093_3393 766
131 3300042609 Ga0466722_060397 Ga0466722_060397_12400_14724 766
132 3300042612 Ga0466705_114540 Ga0466705_114540_3098_5479 766
133 3300042619 Ga0466726_427243 Ga0466726_427243_8774_11074 766
134 iso_pr_bacteria 2781125656 2781320951 766
135 3300042596 Ga0466696_154370 Ga0466696_154370_1774_4077 767
136 3300042612 Ga0466705_074124 Ga0466705_074124_2097_4400 767
137 3300042636 Ga0466703_114043 Ga0466703_114043_4088_6391 767
138 3300042643 Ga0466704_416354 Ga0466704_416354_7684_9987 767
139 3300042643 Ga0466704_424769 Ga0466704_424769_6772_9075 767
140 3300042643 Ga0466704_454619 Ga0466704_454619_3796_6099 767
141 3300042596 Ga0466696_218799 Ga0466696_218799_2015_4321 768
142 3300042652 Ga0466708_250233 Ga0466708_250233_7875_10184 769
143 3300042596 Ga0466696_270369 Ga0466696_270369_3423_5735 770
144 3300042615 Ga0466711_366238 Ga0466711_366238_17091_19403 770
145 3300042620 Ga0466728_005733 Ga0466728_005733_2902_5214 770
146 3300042643 Ga0466704_134411 Ga0466704_134411_3813_6125 770
147 3300042605 Ga0466716_147276 Ga0466716_147276_2311_4626 771
148 3300042620 Ga0466728_255243 Ga0466728_255243_3812_6127 771
149 3300042620 Ga0466728_323303 Ga0466728_323303_593_2908 771
150 3300042636 Ga0466703_342974 Ga0466703_342974_6919_9234 771
151 3300042643 Ga0466704_183325 Ga0466704_183325_6299_8614 771
152 3300042596 Ga0466696_080074 Ga0466696_080074_5963_8281 772
153 3300042636 Ga0466703_391920 Ga0466703_391920_3039_5357 772
154 3300042606 Ga0466719_367100 Ga0466719_367100_1258_3579 773
155 3300042619 Ga0466726_242939 Ga0466726_242939_1712_4036 774
156 3300042609 Ga0466722_030168 Ga0466722_030168_13120_15459 779
157 iso_pr_bacteria 2781125697 2781442567 779
158 3300002462 JGI24702J35022_10003976 JGI24702J35022_100039763 780
159 3300042618 Ga0466723_233609 Ga0466723_233609_6785_9136 783
160 3300042652 Ga0466708_051561 Ga0466708_051561_10049_12400 783
161 3300042612 Ga0466705_253523 Ga0466705_253523_767_3223 787
162 3300042643 Ga0466704_364093 Ga0466704_364093_1336_3741 789
163 3300042596 Ga0466696_150561 Ga0466696_150561_542_2914 790
164 3300009784 Ga0123357_10018779 Ga0123357_100187793 813
165 3300009784 Ga0123357_10049215 Ga0123357_100492156 814

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01522 Polysacc_deac_1 Polysaccharide deacetylase 600 724 0.84

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.87 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.