Protein Family IF02186

Metagenome Isolate
264 Members
82 Samples
242 Scaffolds
503.47 Avg Length

🧬 Representative Sequence

ID
3300009784|Ga0123357_10015481|Ga0123357_100154814
Length
577 aa
Sequence
LGKVIPTTIPTTFFRLKTNTRKFSCIRKIAEKAGTRLTKDFLPLEFLPDIIRVGDPPKASADMMAIEPDSQEVNYVALTTNSATIGFEQQIWAAADILRGNMDAAEYKHVVLGLIFLKYISDKFEERYHELEADDDDVEDKDAYAEANVFFVPSSARWSIIAEAAHKEKIGTVIDDAMRAIEKENKRLKDTLPKNYARDELDKRRLGNVVDLFTNIRMTEHGTDKDILGRTYEYCLAKFAEQEGKRAGEFYTPSCVVRTLVEVLQPFKGRVYDPCCGSGGMFVQSTDFVRSHSGNIGNLSIYGQDANPTTRKMALMNLAIRGIEADLGGYNADTFHNDLHPQQKMDFILANPPFNLSDWNDGSLNNDPRWKYGLPPSGNANFAWLQHMIFHLSPNGKIGMVLANGSLSSQSGGEGEIRRKIAEDDLVEGIIAMPTQLFYTTQIPVSLWFISRNKQQKGKTLFIDARKMGTMVNRRLREMTAEDIAKIASTFQAFDKGALEDVKGYCAAVTTEEIAKQDYILTPGRYVGIEEQEDDGEPFEEKMTRLTGELSGMFKRSHELEEEIRKRLGAIGYEIE*

πŸ“Š Sample Types

Isolate 8.3%
Metagenome 91.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 40.5%
Unclassified 20.3%
Kalotermitidae 16.5%
Blattidae 8.9%
Rhinotermitidae 5.1%
Termopsidae 5.1%
Passalidae 2.5%
Hodotermitidae 1.3%

🌳 Taxonomy

Archaea 5
Bacteria 247
Eukaryota 0
Viruses 0
Unclassified 12

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
2 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
3 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
4 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
5 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
6 2820854745 Unclassified Actinobacteria Lab288P3bin234 Isolate Unclassified
7 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
8 2820435670 Unclassified Firmicutes Lab288P3bin217 Isolate Unclassified
9 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
10 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
11 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
12 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
13 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
14 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
15 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
16 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
17 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
18 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
19 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
20 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
21 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
22 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
23 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
24 2940295490 Lachnospiraceae bacterium PH1-22 Isolate Blattidae
25 2228664004 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T3b, from Florida USA Metagenome Termitidae
26 2684622743 Methanobrevibacter cuticularis DSM11139 Isolate Unclassified
27 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
28 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
29 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
30 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
31 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
32 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
33 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
34 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
35 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
36 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
37 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
38 2940292506 Lachnoclostridium sp. PH5-23 Isolate Blattidae
39 2820442516 Unclassified Firmicutes Lab288P3bin200 Isolate Unclassified
40 2820584674 Unclassified Firmicutes Emb289P1bin98 Isolate Unclassified
41 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
42 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
43 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
44 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
45 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
46 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
47 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
48 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
49 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
50 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
51 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
52 2820525019 Unclassified Firmicutes Lab288P1bin2 Isolate Unclassified
53 2684622740 Methanobrevibacter filiformis DSM11501 Isolate Unclassified
54 3004672520 Bacteroides sp. 51 Isolate Blattidae
55 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
56 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
57 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
58 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
59 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
60 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
61 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
62 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
63 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
64 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
65 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
66 2820327087 Unclassified Firmicutes Nt197P3bin79 Isolate Unclassified
67 2820382897 Unclassified Firmicutes Nt197P1bin3 Isolate Unclassified
68 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
69 2940239174 Ereboglobus sp. PH5-10 Isolate Blattidae
70 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
71 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
72 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
73 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
74 2940289514 Lachnospiraceae bacterium PM6-15 Isolate Blattidae
75 2820110010 Unclassified Proteobacteria Emb289P4bin35 Isolate Unclassified
76 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
77 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
78 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
79 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
80 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
81 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
82 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_201568 3300042612 Bacteria 3269
2 AustNasuHG_c1002589 3300000089 Bacteria 6532
3 JGI24698J34947_10004431 3300002449 Bacteria 7643
4 JGI24698J34947_10020324 3300002449 Bacteria 3578
5 JGI24703J35330_11746202 3300002501 Bacteria 5051
6 Ga0264413_120063 3300024493 Unclassified 2640
7 Ga0466690_175209 3300042590 Bacteria 3504
8 Ga0466706_065373 3300042599 Bacteria 10491
9 Ga0466700_073782 3300042600 Bacteria 4638
10 Ga0466707_327975 3300042601 Bacteria 12168
11 Ga0466713_133559 3300042602 Bacteria 4680
12 Ga0466716_221525 3300042605 Bacteria 2704
13 Ga0466720_048698 3300042607 Bacteria 10626
14 Ga0466720_063031 3300042607 Bacteria 13343
15 Ga0466735_075073 3300042624 Bacteria 2108
16 Ga0466704_055972 3300042643 Bacteria 1888
17 Ga0466704_231866 3300042643 Bacteria 63702
18 Ga0466705_472145 3300042612 Bacteria 33272
19 Ga0466715_031452 3300042616 Unclassified 1918
20 Ga0466718_150133 3300042617 Bacteria 19302
21 Ga0466726_475805 3300042619 Bacteria 3512
22 Ga0123355_10065612 3300009826 Bacteria 5847
23 Ga0123355_10128271 3300009826 Bacteria 3914
24 Ga0123356_10029009 3300010049 Bacteria 5184
25 Ga0123353_10055366 3300010167 Bacteria 6345
26 Ga0123353_10222753 3300010167 Bacteria 2948
27 Ga0466732_205639 3300042656 Bacteria 13825
28 Ga0466733_032009 3300042659 Bacteria 11832
29 Ga0466733_182789 3300042659 Bacteria 10260
30 2227638790 2225789004 Bacteria 2073
31 JGI24703J35330_11748396 3300002501 Bacteria 15287
32 Ga0068302_10091631 3300005071 Bacteria 4381
33 Ga0415639_040023 3300038395 Bacteria 2783
34 Ga0466690_246190 3300042590 Bacteria 1739
35 Ga0466692_095679 3300042591 Bacteria 3798
36 Ga0466706_084161 3300042599 Unclassified 2194
37 Ga0466706_124934 3300042599 Bacteria 5450
38 Ga0466706_278888 3300042599 Archaea 40638
39 Ga0466700_414144 3300042600 Bacteria 4217
40 Ga0466713_118999 3300042602 Bacteria 3068
41 Ga0466714_127489 3300042603 Bacteria 2244
42 Ga0466720_230111 3300042607 Bacteria 2176
43 Ga0466721_179081 3300042608 Bacteria 14566
44 Ga0466722_189957 3300042609 Bacteria 25160
45 Ga0466703_067793 3300042636 Bacteria 41172
46 Ga0466704_025065 3300042643 Bacteria 12785
47 Ga0466704_048780 3300042643 Bacteria 18515
48 Ga0466708_148875 3300042652 Bacteria 14741
49 Ga0466710_099204 3300042613 Bacteria 2421
50 Ga0466712_212024 3300042614 Bacteria 18168
51 Ga0466715_623371 3300042616 Bacteria 2113
52 Ga0466728_470209 3300042620 Bacteria 3606
53 Ga0123355_10023071 3300009826 Bacteria 9987
54 Ga0123355_10207265 3300009826 Bacteria 2849
55 Ga0123356_10012086 3300010049 Bacteria 8394
56 Ga0123356_10115258 3300010049 Bacteria 2603
57 Ga0123353_10025446 3300010167 Bacteria 9019
58 Ga0123353_10111957 3300010167 Bacteria 4396
59 Ga0123353_10468259 3300010167 Bacteria 1849
60 Ga0466705_269339 3300042612 Bacteria 15313
61 Ga0466733_044560 3300042659 Bacteria 4317
62 Ga0466733_047845 3300042659 Bacteria 3376
63 2230969630 2228664004 Bacteria 8432
64 AustNasuHG_c1007694 3300000089 Bacteria 3823
65 JGI24695J34938_10024800 3300002450 Bacteria 2876
66 Ga0415639_014526 3300038395 Bacteria 7884
67 Ga0466699_029069 3300042597 Bacteria 2684
68 Ga0466714_094322 3300042603 Bacteria 2250
69 Ga0466716_223040 3300042605 Archaea 9195
70 Ga0466716_447979 3300042605 Bacteria 1762
71 Ga0466719_108189 3300042606 Bacteria 7965
72 Ga0466719_267204 3300042606 Bacteria 1781
73 Ga0466720_047860 3300042607 Bacteria 8837
74 Ga0466722_027826 3300042609 Bacteria 4602
75 Ga0466722_138220 3300042609 Bacteria 14645
76 Ga0466729_233783 3300042621 Bacteria 2117
77 Ga0466702_264004 3300042635 Bacteria 1956
78 Ga0466708_271535 3300042652 Bacteria 23806
79 Ga0466712_027439 3300042614 Bacteria 6073
80 Ga0466711_517503 3300042615 Bacteria 3739
81 Ga0466715_026093 3300042616 Bacteria 7540
82 Ga0466715_239488 3300042616 Bacteria 34655
83 Ga0466718_032062 3300042617 Bacteria 4936
84 Ga0466726_297041 3300042619 Bacteria 6709
85 Ga0466726_349157 3300042619 Bacteria 3149
86 Ga0123355_10014436 3300009826 Bacteria 12358
87 Ga0123355_10081409 3300009826 Bacteria 5167
88 Ga0123356_10000619 3300010049 Bacteria 39296
89 Ga0123356_10018930 3300010049 Bacteria 6532
90 Ga0123353_10189487 3300010167 Bacteria 3248
91 Ga0123353_10195576 3300010167 Bacteria 3188
92 Ga0123353_10197194 3300010167 Bacteria 3172
93 Ga0123354_10054856 3300010882 Bacteria 5973
94 Ga0466733_194957 3300042659 Bacteria 2357
95 2227108572 2225789004 Bacteria 39065
96 AustNasuHG_c1000351 3300000089 Bacteria 15988
97 AustNasuHG_c1003343 3300000089 Bacteria 5789
98 JGI24698J34947_10006027 3300002449 Bacteria 6657
99 JGI24695J34938_10014441 3300002450 Bacteria 4094
100 JGI24695J34938_10043196 3300002450 Unclassified 2012
101 JGI24696J40584_12959784 3300002834 Bacteria 5633
102 Ga0123357_10001023 3300009784 Bacteria 28712
103 Ga0466691_097150 3300042593 Bacteria 2267
104 Ga0466694_334680 3300042594 Bacteria 3972
105 Ga0466696_127557 3300042596 Bacteria 8509
106 Ga0466696_388913 3300042596 Bacteria 2292
107 Ga0466706_004357 3300042599 Bacteria 5121
108 Ga0466706_042493 3300042599 Bacteria 5156
109 Ga0466706_048139 3300042599 Bacteria 2415
110 Ga0466706_103844 3300042599 Bacteria 35455
111 Ga0466706_163306 3300042599 Bacteria 10413
112 Ga0466707_078166 3300042601 Archaea 12451
113 Ga0466722_011327 3300042609 Bacteria 2986
114 Ga0466722_257403 3300042609 Bacteria 4501
115 Ga0466703_004481 3300042636 Bacteria 1938
116 Ga0466704_228862 3300042643 Bacteria 4279
117 Ga0466724_08063 3300042649 Bacteria 1763
118 Ga0466705_502735 3300042612 Bacteria 2194
119 Ga0466711_339321 3300042615 Bacteria 4919
120 Ga0466715_115531 3300042616 Bacteria 7438
121 Ga0466718_064682 3300042617 Bacteria 16410
122 Ga0466718_112161 3300042617 Bacteria 5318
123 Ga0466728_321141 3300042620 Bacteria 5426
124 Ga0123355_10000706 3300009826 Bacteria 45274
125 Ga0123356_10016994 3300010049 Bacteria 6929
126 Ga0123353_10000477 3300010167 Bacteria 49516
127 Ga0123353_10010859 3300010167 Bacteria 12755
128 Ga0123353_10174449 3300010167 Bacteria 3410
129 Ga0466705_350076 3300042612 Bacteria 4768
130 Ga0466733_010123 3300042659 Bacteria 4221
131 2227520203 2225789004 Bacteria 3356
132 JGI24698J34947_10003670 3300002449 Bacteria 8341
133 JGI24695J34938_10003124 3300002450 Bacteria 11818
134 Ga0072941_1199805 3300005201 Bacteria 2329
135 Ga0466690_086078 3300042590 Bacteria 11747
136 Ga0466693_056109 3300042592 Bacteria 3329
137 Ga0466719_089691 3300042606 Bacteria 2793
138 Ga0466720_117540 3300042607 Bacteria 11507
139 Ga0466703_276473 3300042636 Bacteria 1989
140 Ga0466708_194431 3300042652 Bacteria 3121
141 Ga0466727_190694 3300042655 Bacteria 6144
142 Ga0466712_113717 3300042614 Bacteria 3270
143 Ga0466712_194284 3300042614 Bacteria 2685
144 Ga0466711_272174 3300042615 Bacteria 4354
145 Ga0466711_420532 3300042615 Bacteria 4536
146 Ga0466723_204004 3300042618 Bacteria 2400
147 Ga0466729_056413 3300042621 Bacteria 40886
148 Ga0123355_10000028 3300009826 Bacteria 144673
149 Ga0123355_10112004 3300009826 Bacteria 4260
150 Ga0123354_10201805 3300010882 Bacteria 2183
151 Ga0466733_056067 3300042659 Bacteria 1962
152 JGI24695J34938_10018414 3300002450 Bacteria 3492
153 JGI24702J35022_10005862 3300002462 Bacteria 7145
154 JGI24703J35330_11748016 3300002501 Bacteria 9908
155 Ga0415639_031806 3300038395 Bacteria 3149
156 Ga0415639_062254 3300038395 Bacteria 4675
157 Ga0466691_210063 3300042593 Bacteria 4661
158 Ga0466694_371828 3300042594 Bacteria 14731
159 Ga0466701_016351 3300042598 Bacteria 2525
160 Ga0466701_075634 3300042598 Bacteria 3771
161 Ga0466706_081182 3300042599 Unclassified 3630
162 Ga0466706_202406 3300042599 Bacteria 15021
163 Ga0466717_003470 3300042604 Bacteria 5389
164 Ga0466717_215833 3300042604 Bacteria 2246
165 Ga0466702_391511 3300042635 Bacteria 2337
166 Ga0466702_408855 3300042635 Bacteria 2058
167 Ga0466708_207554 3300042652 Bacteria 3934
168 Ga0466708_211714 3300042652 Bacteria 12381
169 Ga0466712_043604 3300042614 Bacteria 10968
170 Ga0466715_336397 3300042616 Bacteria 25535
171 Ga0123355_10054222 3300009826 Bacteria 6497
172 Ga0123355_10213642 3300009826 Bacteria 2790
173 Ga0123356_10052778 3300010049 Unclassified 3782
174 Ga0123353_10026071 3300010167 Bacteria 8918
175 Ga0123353_10036400 3300010167 Bacteria 7709
176 Ga0466705_172006 3300042612 Unclassified 6250
177 Ga0466733_106507 3300042659 Bacteria 5396
178 IMNBL1DRAFT_c0006785 3300000062 Bacteria 6175
179 IMNBL1DRAFT_c0008830 3300000062 Bacteria 5077
180 JGI24698J34947_10013247 3300002449 Bacteria 4505
181 JGI24698J34947_10017256 3300002449 Unclassified 3914
182 JGI24698J34947_10020950 3300002449 Bacteria 3520
183 JGI24698J34947_10062853 3300002449 Bacteria 1822
184 Ga0265387_1003151 3300024582 Bacteria 2302
185 Ga0415639_006610 3300038395 Bacteria 24388
186 Ga0415639_006801 3300038395 Bacteria 4415
187 Ga0415639_015065 3300038395 Bacteria 8876
188 Ga0466696_440469 3300042596 Bacteria 9086
189 Ga0466699_301188 3300042597 Bacteria 2141
190 Ga0466706_001644 3300042599 Bacteria 23740
191 Ga0466720_091327 3300042607 Unclassified 3869
192 Ga0466720_109394 3300042607 Bacteria 2496
193 Ga0466721_320012 3300042608 Bacteria 35455
194 Ga0466722_040517 3300042609 Bacteria 23977
195 Ga0466698_127988 3300042610 Bacteria 8444
196 Ga0466730_070089 3300042625 Bacteria 5895
197 Ga0466703_248198 3300042636 Bacteria 10890
198 Ga0466712_016345 3300042614 Bacteria 12564
199 Ga0466712_307103 3300042614 Bacteria 7340
200 Ga0466711_097899 3300042615 Unclassified 2981
201 Ga0466715_084455 3300042616 Bacteria 2390
202 Ga0466715_133942 3300042616 Bacteria 16228
203 Ga0466715_153792 3300042616 Bacteria 13336
204 Ga0466715_642064 3300042616 Bacteria 3210
205 Ga0466718_020702 3300042617 Bacteria 14077
206 Ga0466723_236858 3300042618 Bacteria 7845
207 Ga0466723_364923 3300042618 Bacteria 2757
208 Ga0123357_10011127 3300009784 Bacteria 11511
209 Ga0123357_10011455 3300009784 Bacteria 11377
210 Ga0123355_10261843 3300009826 Bacteria 2417
211 Ga0123356_10001944 3300010049 Bacteria 22372
212 Ga0123356_10137085 3300010049 Bacteria 2408
213 Ga0123353_10000119 3300010167 Bacteria 93234
214 Ga0123353_10027858 3300010167 Bacteria 8666
215 Ga0123353_10235353 3300010167 Bacteria 2851
216 Ga0466705_083298 3300042612 Bacteria 2344
217 Ga0466705_285296 3300042612 Bacteria 6405
218 2227482997 2225789004 Bacteria 4367
219 JGI24702J35022_10004024 3300002462 Bacteria 8805
220 Ga0068302_10392765 3300005071 Bacteria 1748
221 Ga0072940_1074284 3300005200 Bacteria 8551
222 Ga0415639_045259 3300038395 Unclassified 3014
223 Ga0466690_053253 3300042590 Bacteria 2191
224 Ga0466693_013664 3300042592 Bacteria 1686
225 Ga0466706_021858 3300042599 Unclassified 2477
226 Ga0466706_103138 3300042599 Bacteria 8447
227 Ga0466700_374269 3300042600 Bacteria 2756
228 Ga0466716_331385 3300042605 Bacteria 4962
229 Ga0466721_135084 3300042608 Bacteria 1888
230 Ga0466722_053061 3300042609 Bacteria 1917
231 Ga0466735_041342 3300042624 Bacteria 17971
232 Ga0466708_190707 3300042652 Bacteria 20881
233 Ga0466710_335016 3300042613 Bacteria 7762
234 Ga0466711_157616 3300042615 Bacteria 4433
235 Ga0466718_017638 3300042617 Bacteria 2979
236 Ga0466723_069763 3300042618 Bacteria 3119
237 Ga0466726_061346 3300042619 Bacteria 3513
238 Ga0123357_10015481 3300009784 Bacteria 10001
239 Ga0123355_10005481 3300009826 Bacteria 18598
240 Ga0123355_10142364 3300009826 Bacteria 3665
241 Ga0123356_10068243 3300010049 Bacteria 3330
242 Ga0123353_10038126 3300010167 Bacteria 7549

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010167 Ga0123353_10026071 Ga0123353_100260712 450
2 3300042615 Ga0466711_272174 Ga0466711_272174_185_1582 465
3 3300042617 Ga0466718_020702 Ga0466718_020702_4719_6119 466
4 3300002449 JGI24698J34947_10003670 JGI24698J34947_100036705 469
5 3300042604 Ga0466717_215833 Ga0466717_215833_666_2168 470
6 3300042609 Ga0466722_053061 Ga0466722_053061_154_1659 473
7 3300042594 Ga0466694_371828 Ga0466694_371828_629_2146 476
8 3300038395 Ga0415639_040023 Ga0415639_040023_185_1627 480
9 3300042613 Ga0466710_335016 Ga0466710_335016_338_1879 484
10 3300042601 Ga0466707_078166 Ga0466707_078166_1408_2907 485
11 3300042605 Ga0466716_223040 Ga0466716_223040_6348_7850 489
12 3300042616 Ga0466715_642064 Ga0466715_642064_127_1623 490
13 3300042612 Ga0466705_269339 Ga0466705_269339_1176_2681 491
14 3300042643 Ga0466704_228862 Ga0466704_228862_1135_2637 492
15 3300042636 Ga0466703_276473 Ga0466703_276473_237_1718 493
16 3300042590 Ga0466690_175209 Ga0466690_175209_1247_2731 494
17 3300042618 Ga0466723_204004 Ga0466723_204004_734_2221 495
18 3300010167 Ga0123353_10195576 Ga0123353_101955762 497
19 3300042596 Ga0466696_127557 Ga0466696_127557_610_2103 497
20 3300042619 Ga0466726_475805 Ga0466726_475805_972_2504 497
21 3300042616 Ga0466715_031452 Ga0466715_031452_162_1658 498
22 3300042593 Ga0466691_097150 Ga0466691_097150_279_1778 499
23 3300042601 Ga0466707_327975 Ga0466707_327975_2887_4386 499
24 3300042609 Ga0466722_040517 Ga0466722_040517_1157_2656 499
25 3300042612 Ga0466705_472145 Ga0466705_472145_10781_12280 499
26 3300042616 Ga0466715_084455 Ga0466715_084455_543_2042 499
27 3300042616 Ga0466715_115531 Ga0466715_115531_5249_6763 499
28 3300042617 Ga0466718_032062 Ga0466718_032062_712_2211 499
29 3300042617 Ga0466718_064682 Ga0466718_064682_13233_14732 499
30 3300042619 Ga0466726_349157 Ga0466726_349157_1548_3047 499
31 3300042652 Ga0466708_194431 Ga0466708_194431_1552_3051 499
32 3300042655 Ga0466727_190694 Ga0466727_190694_4598_6097 499
33 2225789004 2227482997 2227945942 500
34 3300009826 Ga0123355_10112004 Ga0123355_101120044 500
35 3300009826 Ga0123355_10261843 Ga0123355_102618432 500
36 3300010167 Ga0123353_10027858 Ga0123353_100278587 500
37 3300010167 Ga0123353_10111957 Ga0123353_101119574 500
38 3300010882 Ga0123354_10054856 Ga0123354_100548564 500
39 3300024582 Ga0265387_1003151 Ga0265387_10031511 500
40 3300038395 Ga0415639_031806 Ga0415639_031806_495_1997 500
41 3300042590 Ga0466690_246190 Ga0466690_246190_212_1714 500
42 3300042596 Ga0466696_440469 Ga0466696_440469_3790_5292 500
43 3300042599 Ga0466706_001644 Ga0466706_001644_635_2137 500
44 3300042599 Ga0466706_048139 Ga0466706_048139_871_2373 500
45 3300042599 Ga0466706_084161 Ga0466706_084161_650_2152 500
46 3300042599 Ga0466706_103844 Ga0466706_103844_2638_4140 500
47 3300042599 Ga0466706_124934 Ga0466706_124934_2973_4475 500
48 3300042599 Ga0466706_278888 Ga0466706_278888_36606_38108 500
49 3300042600 Ga0466700_414144 Ga0466700_414144_2063_3565 500
50 3300042602 Ga0466713_133559 Ga0466713_133559_358_1860 500
51 3300042606 Ga0466719_267204 Ga0466719_267204_69_1571 500
52 3300042609 Ga0466722_011327 Ga0466722_011327_563_2065 500
53 3300042612 Ga0466705_172006 Ga0466705_172006_160_1662 500
54 3300042612 Ga0466705_201568 Ga0466705_201568_591_2093 500
55 3300042615 Ga0466711_339321 Ga0466711_339321_2000_3502 500
56 3300042615 Ga0466711_420532 Ga0466711_420532_1517_3019 500
57 3300042616 Ga0466715_026093 Ga0466715_026093_2222_3724 500
58 3300042616 Ga0466715_239488 Ga0466715_239488_3450_4952 500
59 3300042616 Ga0466715_623371 Ga0466715_623371_154_1656 500
60 3300042617 Ga0466718_112161 Ga0466718_112161_3486_4988 500
61 3300042618 Ga0466723_236858 Ga0466723_236858_863_2365 500
62 3300042619 Ga0466726_297041 Ga0466726_297041_1782_3284 500
63 3300042636 Ga0466703_004481 Ga0466703_004481_354_1856 500
64 3300042636 Ga0466703_248198 Ga0466703_248198_2199_3701 500
65 3300042643 Ga0466704_055972 Ga0466704_055972_246_1748 500
66 3300042643 Ga0466704_231866 Ga0466704_231866_58339_59841 500
67 3300042652 Ga0466708_190707 Ga0466708_190707_8705_10207 500
68 3300042652 Ga0466708_271535 Ga0466708_271535_11498_13000 500
69 3300042659 Ga0466733_056067 Ga0466733_056067_146_1648 500
70 3300042659 Ga0466733_194957 Ga0466733_194957_683_2185 500
71 iso_pr_bacteria 2781125659 2781328560 500
72 iso_pr_bacteria 2820854745 2820856417 500
73 iso_pu_archaea 2684622740 2685517286 500
74 iso_pu_archaea 2684622743 2685524709 500
75 2225789004 2227108572 2227495546 501
76 2225789004 2227520203 2228022814 501
77 2225789004 2227638790 2228227215 501
78 3300000062 IMNBL1DRAFT_c0008830 IMNBL1DRAFT_00088306 501
79 3300002501 JGI24703J35330_11748396 JGI24703J35330_117483969 501
80 3300005071 Ga0068302_10091631 Ga0068302_100916312 501
81 3300005071 Ga0068302_10392765 Ga0068302_103927651 501
82 3300005200 Ga0072940_1074284 Ga0072940_10742842 501
83 3300009826 Ga0123355_10005481 Ga0123355_1000548111 501
84 3300009826 Ga0123355_10054222 Ga0123355_100542223 501
85 3300009826 Ga0123355_10081409 Ga0123355_100814096 501
86 3300009826 Ga0123355_10213642 Ga0123355_102136422 501
87 3300010049 Ga0123356_10000619 Ga0123356_1000061938 501
88 3300010049 Ga0123356_10001944 Ga0123356_1000194421 501
89 3300010049 Ga0123356_10016994 Ga0123356_100169947 501
90 3300010049 Ga0123356_10052778 Ga0123356_100527783 501
91 3300010167 Ga0123353_10036400 Ga0123353_100364002 501
92 3300010167 Ga0123353_10174449 Ga0123353_101744493 501
93 3300010167 Ga0123353_10222753 Ga0123353_102227532 501
94 3300024493 Ga0264413_120063 Ga0264413_1200632 501
95 3300042590 Ga0466690_086078 Ga0466690_086078_6993_8498 501
96 3300042597 Ga0466699_029069 Ga0466699_029069_873_2378 501
97 3300042599 Ga0466706_042493 Ga0466706_042493_1672_3177 501
98 3300042599 Ga0466706_202406 Ga0466706_202406_7167_8672 501
99 3300042606 Ga0466719_089691 Ga0466719_089691_1172_2677 501
100 3300042607 Ga0466720_048698 Ga0466720_048698_7542_9047 501
101 3300042607 Ga0466720_091327 Ga0466720_091327_169_1674 501
102 3300042607 Ga0466720_230111 Ga0466720_230111_253_1758 501
103 3300042608 Ga0466721_179081 Ga0466721_179081_2032_3537 501
104 3300042609 Ga0466722_257403 Ga0466722_257403_197_1735 501
105 3300042612 Ga0466705_083298 Ga0466705_083298_242_1747 501
106 3300042618 Ga0466723_069763 Ga0466723_069763_926_2431 501
107 3300042619 Ga0466726_061346 Ga0466726_061346_1420_2925 501
108 3300042620 Ga0466728_321141 Ga0466728_321141_2779_4284 501
109 3300042635 Ga0466702_264004 Ga0466702_264004_317_1822 501
110 3300042635 Ga0466702_408855 Ga0466702_408855_290_1795 501
111 3300042652 Ga0466708_211714 Ga0466708_211714_4577_6082 501
112 3300042659 Ga0466733_047845 Ga0466733_047845_245_1750 501
113 3300042659 Ga0466733_106507 Ga0466733_106507_665_2170 501
114 3300042659 Ga0466733_182789 Ga0466733_182789_453_1958 501
115 iso_pr_bacteria 2820110010 2820111164 501
116 iso_pr_bacteria 2820382897 2820383274 501
117 iso_pr_bacteria 2820584674 2820584967 501
118 iso_pr_bacteria 2910959314 2910960423 501
119 iso_pr_bacteria 2940209341 2940210785 501
120 iso_pr_bacteria 3004672520 3004675148 501
121 2228664004 2230969630 2230683205 502
122 3300000089 AustNasuHG_c1007694 AustNasuHG_10076944 502
123 3300002450 JGI24695J34938_10014441 JGI24695J34938_100144413 502
124 3300002450 JGI24695J34938_10043196 JGI24695J34938_100431962 502
125 3300002462 JGI24702J35022_10004024 JGI24702J35022_100040243 502
126 3300002501 JGI24703J35330_11748016 JGI24703J35330_1174801610 502
127 3300005201 Ga0072941_1199805 Ga0072941_11998052 502
128 3300009784 Ga0123357_10011455 Ga0123357_100114552 502
129 3300009826 Ga0123355_10000028 Ga0123355_1000002862 502
130 3300009826 Ga0123355_10000706 Ga0123355_1000070611 502
131 3300009826 Ga0123355_10207265 Ga0123355_102072652 502
132 3300010167 Ga0123353_10197194 Ga0123353_101971942 502
133 3300042593 Ga0466691_210063 Ga0466691_210063_358_1866 502
134 3300042597 Ga0466699_301188 Ga0466699_301188_101_1609 502
135 3300042599 Ga0466706_103138 Ga0466706_103138_2249_3757 502
136 3300042600 Ga0466700_073782 Ga0466700_073782_224_1732 502
137 3300042602 Ga0466713_118999 Ga0466713_118999_74_1582 502
138 3300042603 Ga0466714_127489 Ga0466714_127489_676_2184 502
139 3300042606 Ga0466719_108189 Ga0466719_108189_846_2354 502
140 3300042607 Ga0466720_047860 Ga0466720_047860_509_2017 502
141 3300042607 Ga0466720_063031 Ga0466720_063031_10615_12123 502
142 3300042607 Ga0466720_109394 Ga0466720_109394_769_2277 502
143 3300042607 Ga0466720_117540 Ga0466720_117540_8787_10295 502
144 3300042609 Ga0466722_138220 Ga0466722_138220_6830_8338 502
145 3300042612 Ga0466705_350076 Ga0466705_350076_2239_3747 502
146 3300042612 Ga0466705_502735 Ga0466705_502735_563_2071 502
147 3300042614 Ga0466712_016345 Ga0466712_016345_4369_5877 502
148 3300042614 Ga0466712_027439 Ga0466712_027439_620_2128 502
149 3300042614 Ga0466712_113717 Ga0466712_113717_582_2090 502
150 3300042614 Ga0466712_212024 Ga0466712_212024_14455_15963 502
151 3300042614 Ga0466712_307103 Ga0466712_307103_1953_3461 502
152 3300042615 Ga0466711_097899 Ga0466711_097899_637_2145 502
153 3300042618 Ga0466723_364923 Ga0466723_364923_1178_2686 502
154 3300042620 Ga0466728_470209 Ga0466728_470209_1613_3121 502
155 3300042625 Ga0466730_070089 Ga0466730_070089_180_1688 502
156 3300042656 Ga0466732_205639 Ga0466732_205639_11015_12523 502
157 3300042659 Ga0466733_044560 Ga0466733_044560_2661_4169 502
158 iso_pr_bacteria 2820267566 2820268125 502
159 iso_pr_bacteria 2820327087 2820328370 502
160 iso_pr_bacteria 2940295490 2940296390 502
161 3300000089 AustNasuHG_c1000351 AustNasuHG_10003516 503
162 3300000089 AustNasuHG_c1002589 AustNasuHG_10025896 503
163 3300002449 JGI24698J34947_10004431 JGI24698J34947_100044315 503
164 3300002449 JGI24698J34947_10006027 JGI24698J34947_100060276 503
165 3300002449 JGI24698J34947_10013247 JGI24698J34947_100132473 503
166 3300002449 JGI24698J34947_10017256 JGI24698J34947_100172564 503
167 3300002450 JGI24695J34938_10003124 JGI24695J34938_100031243 503
168 3300002462 JGI24702J35022_10005862 JGI24702J35022_100058628 503
169 3300009826 Ga0123355_10014436 Ga0123355_100144366 503
170 3300009826 Ga0123355_10142364 Ga0123355_101423643 503
171 3300010167 Ga0123353_10055366 Ga0123353_100553665 503
172 3300042594 Ga0466694_334680 Ga0466694_334680_2041_3552 503
173 3300042599 Ga0466706_065373 Ga0466706_065373_8434_9945 503
174 3300042599 Ga0466706_081182 Ga0466706_081182_1231_2742 503
175 3300042599 Ga0466706_163306 Ga0466706_163306_977_2488 503
176 3300042614 Ga0466712_194284 Ga0466712_194284_556_2067 503
177 3300042617 Ga0466718_017638 Ga0466718_017638_1107_2618 503
178 3300042624 Ga0466735_075073 Ga0466735_075073_164_1675 503
179 3300042643 Ga0466704_025065 Ga0466704_025065_5247_6758 503
180 3300010049 Ga0123356_10029009 Ga0123356_100290095 504
181 3300010049 Ga0123356_10115258 Ga0123356_101152583 504
182 3300010049 Ga0123356_10137085 Ga0123356_101370852 504
183 3300010167 Ga0123353_10038126 Ga0123353_100381263 504
184 3300038395 Ga0415639_006801 Ga0415639_006801_1742_3256 504
185 3300038395 Ga0415639_014526 Ga0415639_014526_3318_4832 504
186 3300038395 Ga0415639_045259 Ga0415639_045259_1248_2762 504
187 3300038395 Ga0415639_062254 Ga0415639_062254_2959_4473 504
188 3300042605 Ga0466716_331385 Ga0466716_331385_157_1671 504
189 3300042608 Ga0466721_135084 Ga0466721_135084_223_1737 504
190 3300042609 Ga0466722_189957 Ga0466722_189957_17848_19362 504
191 3300042616 Ga0466715_153792 Ga0466715_153792_2458_3972 504
192 3300002834 JGI24696J40584_12959784 JGI24696J40584_129597841 505
193 3300009826 Ga0123355_10065612 Ga0123355_100656122 505
194 3300010167 Ga0123353_10468259 Ga0123353_104682592 505
195 3300042596 Ga0466696_388913 Ga0466696_388913_504_2021 505
196 3300042600 Ga0466700_374269 Ga0466700_374269_973_2490 505
197 iso_pr_bacteria 2820442516 2820442970 505
198 3300002501 JGI24703J35330_11746202 JGI24703J35330_117462022 506
199 3300010167 Ga0123353_10000119 Ga0123353_1000011931 506
200 3300010167 Ga0123353_10025446 Ga0123353_100254466 506
201 3300042614 Ga0466712_043604 Ga0466712_043604_539_2059 506
202 3300042621 Ga0466729_056413 Ga0466729_056413_14195_15715 506
203 3300042624 Ga0466735_041342 Ga0466735_041342_5196_6716 506
204 3300042636 Ga0466703_067793 Ga0466703_067793_14823_16343 506
205 3300042643 Ga0466704_048780 Ga0466704_048780_246_1766 506
206 3300010167 Ga0123353_10235353 Ga0123353_102353532 507
207 3300042591 Ga0466692_095679 Ga0466692_095679_2052_3617 507
208 3300042605 Ga0466716_221525 Ga0466716_221525_949_2472 507
209 3300042616 Ga0466715_133942 Ga0466715_133942_10857_12380 507
210 3300042635 Ga0466702_391511 Ga0466702_391511_535_2058 507
211 iso_pr_bacteria 2781125692 2781431121 507
212 iso_pr_bacteria 2820435670 2820437452 507
213 iso_pr_bacteria 2820525019 2820525547 507
214 3300002449 JGI24698J34947_10062853 JGI24698J34947_100628532 508
215 3300002450 JGI24695J34938_10024800 JGI24695J34938_100248002 508
216 3300010167 Ga0123353_10000477 Ga0123353_1000047725 508
217 3300042592 Ga0466693_013664 Ga0466693_013664_72_1598 508
218 3300042599 Ga0466706_004357 Ga0466706_004357_2456_3982 508
219 3300042608 Ga0466721_320012 Ga0466721_320012_20843_22369 508
220 3300042613 Ga0466710_099204 Ga0466710_099204_649_2175 508
221 3300002450 JGI24695J34938_10018414 JGI24695J34938_100184142 509
222 3300009826 Ga0123355_10128271 Ga0123355_101282713 509
223 3300010049 Ga0123356_10068243 Ga0123356_100682432 509
224 3300010167 Ga0123353_10010859 Ga0123353_100108599 509
225 3300042605 Ga0466716_447979 Ga0466716_447979_135_1664 509
226 3300042616 Ga0466715_336397 Ga0466715_336397_390_1919 509
227 3300042621 Ga0466729_233783 Ga0466729_233783_520_2049 509
228 3300042659 Ga0466733_010123 Ga0466733_010123_1198_2727 509
229 iso_pr_bacteria 2695420931 2698109691 509
230 3300000062 IMNBL1DRAFT_c0006785 IMNBL1DRAFT_00067857 510
231 3300000089 AustNasuHG_c1003343 AustNasuHG_10033432 510
232 3300042604 Ga0466717_003470 Ga0466717_003470_3534_5066 510
233 3300042615 Ga0466711_517503 Ga0466711_517503_84_1616 510
234 3300042592 Ga0466693_056109 Ga0466693_056109_474_2009 511
235 3300042598 Ga0466701_016351 Ga0466701_016351_37_1572 511
236 3300042652 Ga0466708_148875 Ga0466708_148875_925_2460 511
237 3300010049 Ga0123356_10012086 Ga0123356_100120864 513
238 3300042598 Ga0466701_075634 Ga0466701_075634_1672_3216 514
239 3300042599 Ga0466706_021858 Ga0466706_021858_194_1738 514
240 3300042649 Ga0466724_08063 Ga0466724_08063_103_1647 514
241 3300042610 Ga0466698_127988 Ga0466698_127988_6542_8089 515
242 iso_pr_bacteria 2940289514 2940290568 515
243 iso_pr_bacteria 2940292506 2940293407 515
244 3300002449 JGI24698J34947_10020324 JGI24698J34947_100203244 516
245 3300009784 Ga0123357_10001023 Ga0123357_100010236 516
246 3300010882 Ga0123354_10201805 Ga0123354_102018052 516
247 3300042590 Ga0466690_053253 Ga0466690_053253_49_1602 517
248 3300042612 Ga0466705_285296 Ga0466705_285296_1476_3029 517
249 3300042615 Ga0466711_157616 Ga0466711_157616_123_1676 517
250 3300010049 Ga0123356_10018930 Ga0123356_100189307 518
251 3300042603 Ga0466714_094322 Ga0466714_094322_137_1693 518
252 3300042659 Ga0466733_032009 Ga0466733_032009_9844_11400 518
253 3300009784 Ga0123357_10011127 Ga0123357_100111271 519
254 3300042652 Ga0466708_207554 Ga0466708_207554_2096_3661 521
255 iso_pr_bacteria 8100157865 8100160449 524
256 3300042609 Ga0466722_027826 Ga0466722_027826_2425_4008 527
257 3300038395 Ga0415639_015065 Ga0415639_015065_6672_8258 528
258 3300038395 Ga0415639_006610 Ga0415639_006610_3530_5143 537
259 iso_pr_bacteria 2940239174 2940241223 537
260 3300010167 Ga0123353_10189487 Ga0123353_101894873 541
261 3300042617 Ga0466718_150133 Ga0466718_150133_7420_9045 541
262 3300002449 JGI24698J34947_10020950 JGI24698J34947_100209503 543
263 3300009826 Ga0123355_10023071 Ga0123355_100230713 553
264 3300009784 Ga0123357_10015481 Ga0123357_100154814 577

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02384 N6_Mtase N-6 DNA Methylase 224 535 0.98
PF12161 HsdM_N HsdM N-terminal domain 88 213 0.87

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.74 0.83 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.