Protein Family IF02176
Metagenome
Isolate
106
Members
58
Samples
98
Scaffolds
325.76
Avg Length
Representative Sequence
- ID
- 3300009784|Ga0123357_10005815|Ga0123357_100058157
- Length
- 357 aa
- Sequence
- MKFGLCNKESLSLRGVLKRIMDCCLSIRFCVMKNILVTGADGFIGSHLTEMLLHQGYYVKALSYYNSFNHWGWLDNISHPNLEVITGDVRDPHFCKHITKDVDVIFHLAALIAIPYSYVAPDSYVDTNVKGTLNICQAAKENGVKKILVTSTSEVYGTAQYVPIDENHPKQPQSPYSASKIGADMMAMSFYNAFELPVVIARPFNTYGPRQSARAIIPTIISQIAGGKKEIKLGDLTPTRDFNFVKDTCRGFIELARCDAAIGEEVNIASNYEISMRDTLELIAKIMKSDVKFIEDSQRLRPAKSEVFRLWGDNTKIKNLTGFVPEYSIEEGLKETIEWFLNPDNLKKYKADIYNV*
Sample Types
Isolate
7.5%
Metagenome
92.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
45.5%
Kalotermitidae
25.5%
Unclassified
12.7%
Rhinotermitidae
5.5%
Termopsidae
3.6%
Hodotermitidae
1.8%
Passalidae
1.8%
Armadillidiidae
1.8%
Coreidae
1.8%
Taxonomy
Archaea
0
Bacteria
103
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820951912 | Unclassified Acidobacteria Emb289P4bin26 | Isolate | Unclassified |
| 2 | 2820651690 | Unclassified Firmicutes Cu122P3bin6 | Isolate | Unclassified |
| 3 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 4 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 5 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 6 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 7 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 8 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 9 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 10 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 11 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 12 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 13 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 14 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 15 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 16 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 17 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 18 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 19 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 20 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 21 | 2820507989 | Unclassified Firmicutes Lab288P1bin41 | Isolate | Unclassified |
| 22 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 23 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 24 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 25 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 26 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 27 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 28 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 29 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 30 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 31 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 32 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 33 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 34 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 35 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 36 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 37 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 38 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 39 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 40 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 41 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 42 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 43 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 44 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 45 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 46 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 47 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 48 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 49 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 50 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 51 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 52 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 53 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 54 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 55 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 56 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 57 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 58 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123355_10576087 | 3300009826 | Bacteria | 1348 |
| 2 | Ga0466734_081285 | 3300042623 | Bacteria | 1449 |
| 3 | Ga0466730_098279 | 3300042625 | Bacteria | 1472 |
| 4 | Ga0123357_10000911 | 3300009784 | Bacteria | 30046 |
| 5 | Ga0466711_250905 | 3300042615 | Bacteria | 4486 |
| 6 | Ga0466726_191498 | 3300042619 | Bacteria | 9546 |
| 7 | Ga0466726_299856 | 3300042619 | Bacteria | 2923 |
| 8 | Ga0466722_219192 | 3300042609 | Bacteria | 9770 |
| 9 | Ga0466690_214045 | 3300042590 | Bacteria | 2342 |
| 10 | Ga0466691_220167 | 3300042593 | Bacteria | 12482 |
| 11 | Ga0466696_128969 | 3300042596 | Bacteria | 5622 |
| 12 | Ga0123354_10004037 | 3300010882 | Bacteria | 20613 |
| 13 | Ga0123354_10017377 | 3300010882 | Bacteria | 11273 |
| 14 | Ga0160464_102327 | 3300012805 | Bacteria | 3629 |
| 15 | Ga0466702_341185 | 3300042635 | Bacteria | 3236 |
| 16 | Ga0466704_175413 | 3300042643 | Bacteria | 1181 |
| 17 | JGI24698J34947_10031662 | 3300002449 | Bacteria | 2782 |
| 18 | Ga0072941_1003147 | 3300005201 | Bacteria | 83880 |
| 19 | Ga0466726_105226 | 3300042619 | Unclassified | 12482 |
| 20 | Ga0466728_387359 | 3300042620 | Bacteria | 2803 |
| 21 | Ga0466729_139501 | 3300042621 | Bacteria | 7167 |
| 22 | Ga0466713_051303 | 3300042602 | Bacteria | 14077 |
| 23 | Ga0466716_391015 | 3300042605 | Bacteria | 1559 |
| 24 | Ga0466719_530719 | 3300042606 | Bacteria | 2417 |
| 25 | Ga0466690_200422 | 3300042590 | Bacteria | 1522 |
| 26 | Ga0466705_124151 | 3300042612 | Bacteria | 2323 |
| 27 | Ga0466705_228262 | 3300042612 | Bacteria | 1730 |
| 28 | Ga0466732_092386 | 3300042656 | Bacteria | 77086 |
| 29 | Ga0466733_221141 | 3300042659 | Bacteria | 323281 |
| 30 | Ga0123357_10005815 | 3300009784 | Bacteria | 14861 |
| 31 | Ga0123353_10987235 | 3300010167 | Bacteria | 1133 |
| 32 | Ga0466735_201751 | 3300042624 | Bacteria | 1038 |
| 33 | Ga0466709_291504 | 3300042648 | Bacteria | 2695 |
| 34 | JGI24699J35502_11134126 | 3300002509 | Bacteria | 34532 |
| 35 | Ga0466711_515178 | 3300042615 | Bacteria | 1237 |
| 36 | Ga0466715_060231 | 3300042616 | Bacteria | 7818 |
| 37 | Ga0466714_101842 | 3300042603 | Bacteria | 80008 |
| 38 | Ga0466717_067959 | 3300042604 | Bacteria | 3440 |
| 39 | Ga0466716_183008 | 3300042605 | Bacteria | 2049 |
| 40 | Ga0466722_009343 | 3300042609 | Bacteria | 3786 |
| 41 | Ga0466691_114558 | 3300042593 | Bacteria | 1963 |
| 42 | Ga0123356_10000833 | 3300010049 | Bacteria | 34368 |
| 43 | Ga0123353_10351973 | 3300010167 | Bacteria | 2219 |
| 44 | Ga0466704_567869 | 3300042643 | Bacteria | 7333 |
| 45 | Ga0466709_270448 | 3300042648 | Bacteria | 5572 |
| 46 | Ga0466709_277595 | 3300042648 | Bacteria | 221236 |
| 47 | AustNasuHG_c1004642 | 3300000089 | Bacteria | 4929 |
| 48 | JGI24702J35022_10004571 | 3300002462 | Bacteria | 8209 |
| 49 | Ga0466705_495585 | 3300042612 | Bacteria | 7998 |
| 50 | Ga0466710_225924 | 3300042613 | Bacteria | 1445 |
| 51 | Ga0466722_233380 | 3300042609 | Bacteria | 4210 |
| 52 | Ga0466733_176517 | 3300042659 | Bacteria | 11565 |
| 53 | Ga0466734_138129 | 3300042623 | Bacteria | 1446 |
| 54 | Ga0466703_319648 | 3300042636 | Bacteria | 8882 |
| 55 | Ga0466709_117224 | 3300042648 | Bacteria | 13226 |
| 56 | JGI24705J35276_12225746 | 3300002504 | Bacteria | 2762 |
| 57 | Ga0466711_013012 | 3300042615 | Bacteria | 15717 |
| 58 | Ga0466697_018637 | 3300042611 | Bacteria | 1598 |
| 59 | Ga0466656_307241 | 3300042550 | Bacteria | 34645 |
| 60 | Ga0466691_157949 | 3300042593 | Bacteria | 4476 |
| 61 | Ga0466696_506406 | 3300042596 | Unclassified | 7129 |
| 62 | Ga0466705_002203 | 3300042612 | Bacteria | 2933 |
| 63 | Ga0123355_10113742 | 3300009826 | Bacteria | 4220 |
| 64 | Ga0123356_10195085 | 3300010049 | Bacteria | 2059 |
| 65 | Ga0123354_10031339 | 3300010882 | Bacteria | 8342 |
| 66 | Ga0466735_006395 | 3300042624 | Bacteria | 2583 |
| 67 | JGI24695J34938_10003715 | 3300002450 | Bacteria | 10432 |
| 68 | Ga0466715_089041 | 3300042616 | Bacteria | 25331 |
| 69 | Ga0466715_633395 | 3300042616 | Bacteria | 1599 |
| 70 | Ga0264413_155515 | 3300024493 | Bacteria | 2015 |
| 71 | Ga0466696_195261 | 3300042596 | Bacteria | 1944 |
| 72 | Ga0123357_10165683 | 3300009784 | Bacteria | 2633 |
| 73 | Ga0123356_10006265 | 3300010049 | Bacteria | 12011 |
| 74 | Ga0123353_10123498 | 3300010167 | Bacteria | 4162 |
| 75 | Ga0123354_10000165 | 3300010882 | Bacteria | 53803 |
| 76 | 2227136342 | 2225789004 | Bacteria | 37457 |
| 77 | JGI24698J34947_10041408 | 3300002449 | Bacteria | 2373 |
| 78 | JGI24695J34938_10011030 | 3300002450 | Bacteria | 4901 |
| 79 | JGI24696J40584_12946233 | 3300002834 | Bacteria | 1889 |
| 80 | Ga0072941_1053411 | 3300005201 | Bacteria | 10230 |
| 81 | Ga0466706_125334 | 3300042599 | Bacteria | 1270 |
| 82 | Ga0466716_389798 | 3300042605 | Bacteria | 8609 |
| 83 | Ga0466720_042936 | 3300042607 | Bacteria | 30548 |
| 84 | Ga0466692_058396 | 3300042591 | Bacteria | 2646 |
| 85 | Ga0466695_271211 | 3300042595 | Bacteria | 9252 |
| 86 | Ga0466734_104945 | 3300042623 | Bacteria | 4859 |
| 87 | Ga0466703_143155 | 3300042636 | Bacteria | 8136 |
| 88 | Ga0466709_140271 | 3300042648 | Bacteria | 6112 |
| 89 | Ga0466708_177970 | 3300042652 | Bacteria | 1712 |
| 90 | JGI24698J34947_10021288 | 3300002449 | Bacteria | 3490 |
| 91 | Ga0123357_10000422 | 3300009784 | Bacteria | 40488 |
| 92 | Ga0466710_304025 | 3300042613 | Bacteria | 2364 |
| 93 | Ga0466723_232137 | 3300042618 | Bacteria | 1727 |
| 94 | Ga0466726_109958 | 3300042619 | Bacteria | 1792 |
| 95 | Ga0160468_102682 | 3300012819 | Bacteria | 2859 |
| 96 | Ga0466690_398234 | 3300042590 | Bacteria | 3338 |
| 97 | Ga0466691_089142 | 3300042593 | Unclassified | 2175 |
| 98 | Ga0466701_004057 | 3300042598 | Bacteria | 3008 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300009826 | Ga0123355_10113742 | Ga0123355_101137424 | 277 |
| 2 | 3300042590 | Ga0466690_214045 | Ga0466690_214045_1419_2309 | 296 |
| 3 | 3300010167 | Ga0123353_10351973 | Ga0123353_103519732 | 303 |
| 4 | 3300042635 | Ga0466702_341185 | Ga0466702_341185_1808_2785 | 307 |
| 5 | 3300042605 | Ga0466716_183008 | Ga0466716_183008_573_1502 | 309 |
| 6 | iso_pr_bacteria | 2820651690 | 2820654089 | 317 |
| 7 | 3300009826 | Ga0123355_10576087 | Ga0123355_105760872 | 318 |
| 8 | 3300042591 | Ga0466692_058396 | Ga0466692_058396_314_1288 | 324 |
| 9 | 3300042616 | Ga0466715_089041 | Ga0466715_089041_8276_9250 | 324 |
| 10 | 3300042624 | Ga0466735_201751 | Ga0466735_201751_13_987 | 324 |
| 11 | 2225789004 | 2227136342 | 2227535498 | 325 |
| 12 | 3300000089 | AustNasuHG_c1004642 | AustNasuHG_10046425 | 325 |
| 13 | 3300002462 | JGI24702J35022_10004571 | JGI24702J35022_100045718 | 325 |
| 14 | 3300010049 | Ga0123356_10000833 | Ga0123356_1000083311 | 325 |
| 15 | 3300010882 | Ga0123354_10000165 | Ga0123354_100001652 | 325 |
| 16 | 3300010882 | Ga0123354_10017377 | Ga0123354_100173773 | 325 |
| 17 | 3300024493 | Ga0264413_155515 | Ga0264413_1555152 | 325 |
| 18 | 3300042590 | Ga0466690_200422 | Ga0466690_200422_281_1258 | 325 |
| 19 | 3300042590 | Ga0466690_398234 | Ga0466690_398234_220_1197 | 325 |
| 20 | 3300042593 | Ga0466691_114558 | Ga0466691_114558_418_1395 | 325 |
| 21 | 3300042595 | Ga0466695_271211 | Ga0466695_271211_4424_5401 | 325 |
| 22 | 3300042596 | Ga0466696_128969 | Ga0466696_128969_3702_4679 | 325 |
| 23 | 3300042603 | Ga0466714_101842 | Ga0466714_101842_75831_76808 | 325 |
| 24 | 3300042604 | Ga0466717_067959 | Ga0466717_067959_2046_3023 | 325 |
| 25 | 3300042605 | Ga0466716_389798 | Ga0466716_389798_2051_3028 | 325 |
| 26 | 3300042605 | Ga0466716_391015 | Ga0466716_391015_168_1145 | 325 |
| 27 | 3300042606 | Ga0466719_530719 | Ga0466719_530719_1164_2141 | 325 |
| 28 | 3300042607 | Ga0466720_042936 | Ga0466720_042936_14617_15594 | 325 |
| 29 | 3300042609 | Ga0466722_009343 | Ga0466722_009343_1213_2190 | 325 |
| 30 | 3300042609 | Ga0466722_233380 | Ga0466722_233380_772_1749 | 325 |
| 31 | 3300042612 | Ga0466705_124151 | Ga0466705_124151_769_1746 | 325 |
| 32 | 3300042612 | Ga0466705_228262 | Ga0466705_228262_561_1538 | 325 |
| 33 | 3300042613 | Ga0466710_225924 | Ga0466710_225924_92_1069 | 325 |
| 34 | 3300042613 | Ga0466710_304025 | Ga0466710_304025_626_1603 | 325 |
| 35 | 3300042615 | Ga0466711_013012 | Ga0466711_013012_4707_5684 | 325 |
| 36 | 3300042615 | Ga0466711_515178 | Ga0466711_515178_121_1098 | 325 |
| 37 | 3300042616 | Ga0466715_060231 | Ga0466715_060231_5292_6269 | 325 |
| 38 | 3300042616 | Ga0466715_633395 | Ga0466715_633395_544_1521 | 325 |
| 39 | 3300042618 | Ga0466723_232137 | Ga0466723_232137_634_1611 | 325 |
| 40 | 3300042619 | Ga0466726_105226 | Ga0466726_105226_11100_12077 | 325 |
| 41 | 3300042619 | Ga0466726_109958 | Ga0466726_109958_139_1116 | 325 |
| 42 | 3300042619 | Ga0466726_191498 | Ga0466726_191498_2381_3358 | 325 |
| 43 | 3300042619 | Ga0466726_299856 | Ga0466726_299856_1108_2085 | 325 |
| 44 | 3300042620 | Ga0466728_387359 | Ga0466728_387359_436_1413 | 325 |
| 45 | 3300042625 | Ga0466730_098279 | Ga0466730_098279_125_1102 | 325 |
| 46 | 3300042643 | Ga0466704_175413 | Ga0466704_175413_149_1126 | 325 |
| 47 | 3300042648 | Ga0466709_140271 | Ga0466709_140271_1712_2689 | 325 |
| 48 | 3300042648 | Ga0466709_277595 | Ga0466709_277595_172101_173078 | 325 |
| 49 | 3300042648 | Ga0466709_291504 | Ga0466709_291504_466_1443 | 325 |
| 50 | 3300042652 | Ga0466708_177970 | Ga0466708_177970_198_1175 | 325 |
| 51 | 3300042659 | Ga0466733_176517 | Ga0466733_176517_3544_4521 | 325 |
| 52 | 3300042659 | Ga0466733_221141 | Ga0466733_221141_105680_106657 | 325 |
| 53 | iso_pr_bacteria | 2695420317 | 2695483367 | 325 |
| 54 | iso_pr_bacteria | 2695420931 | 2698112156 | 325 |
| 55 | iso_pr_bacteria | 2820507989 | 2820508105 | 325 |
| 56 | iso_pr_bacteria | 2820762746 | 2820764140 | 325 |
| 57 | 3300002450 | JGI24695J34938_10003715 | JGI24695J34938_1000371511 | 326 |
| 58 | 3300002450 | JGI24695J34938_10011030 | JGI24695J34938_100110303 | 326 |
| 59 | 3300002504 | JGI24705J35276_12225746 | JGI24705J35276_122257463 | 326 |
| 60 | 3300002509 | JGI24699J35502_11134126 | JGI24699J35502_111341262 | 326 |
| 61 | 3300005201 | Ga0072941_1003147 | Ga0072941_10031473 | 326 |
| 62 | 3300005201 | Ga0072941_1053411 | Ga0072941_10534112 | 326 |
| 63 | 3300009784 | Ga0123357_10000911 | Ga0123357_1000091123 | 326 |
| 64 | 3300010167 | Ga0123353_10123498 | Ga0123353_101234984 | 326 |
| 65 | 3300010167 | Ga0123353_10987235 | Ga0123353_109872351 | 326 |
| 66 | 3300042596 | Ga0466696_506406 | Ga0466696_506406_937_1917 | 326 |
| 67 | 3300042599 | Ga0466706_125334 | Ga0466706_125334_265_1245 | 326 |
| 68 | 3300042602 | Ga0466713_051303 | Ga0466713_051303_198_1178 | 326 |
| 69 | 3300042609 | Ga0466722_219192 | Ga0466722_219192_3004_3984 | 326 |
| 70 | 3300042624 | Ga0466735_006395 | Ga0466735_006395_887_1867 | 326 |
| 71 | 3300002449 | JGI24698J34947_10021288 | JGI24698J34947_100212882 | 327 |
| 72 | 3300002449 | JGI24698J34947_10031662 | JGI24698J34947_100316622 | 327 |
| 73 | 3300002449 | JGI24698J34947_10041408 | JGI24698J34947_100414082 | 327 |
| 74 | 3300042550 | Ga0466656_307241 | Ga0466656_307241_24884_25867 | 327 |
| 75 | 3300042593 | Ga0466691_089142 | Ga0466691_089142_530_1513 | 327 |
| 76 | 3300042598 | Ga0466701_004057 | Ga0466701_004057_1226_2209 | 327 |
| 77 | 3300042611 | Ga0466697_018637 | Ga0466697_018637_286_1269 | 327 |
| 78 | 3300042621 | Ga0466729_139501 | Ga0466729_139501_6079_7062 | 327 |
| 79 | 3300042623 | Ga0466734_081285 | Ga0466734_081285_331_1314 | 327 |
| 80 | 3300042623 | Ga0466734_138129 | Ga0466734_138129_217_1200 | 327 |
| 81 | 3300042648 | Ga0466709_117224 | Ga0466709_117224_7760_8743 | 327 |
| 82 | 3300002834 | JGI24696J40584_12946233 | JGI24696J40584_129462332 | 328 |
| 83 | 3300010049 | Ga0123356_10195085 | Ga0123356_101950852 | 328 |
| 84 | 3300010882 | Ga0123354_10004037 | Ga0123354_100040377 | 328 |
| 85 | 3300042596 | Ga0466696_195261 | Ga0466696_195261_445_1431 | 328 |
| 86 | 3300042656 | Ga0466732_092386 | Ga0466732_092386_11838_12824 | 328 |
| 87 | 3300012819 | Ga0160468_102682 | Ga0160468_1026823 | 329 |
| 88 | 3300042612 | Ga0466705_495585 | Ga0466705_495585_6728_7720 | 330 |
| 89 | 3300042615 | Ga0466711_250905 | Ga0466711_250905_1366_2358 | 330 |
| 90 | 3300042636 | Ga0466703_143155 | Ga0466703_143155_1068_2060 | 330 |
| 91 | 3300042636 | Ga0466703_319648 | Ga0466703_319648_6813_7805 | 330 |
| 92 | iso_pr_bacteria | 2820951912 | 2820951917 | 330 |
| 93 | 3300010882 | Ga0123354_10031339 | Ga0123354_100313397 | 331 |
| 94 | 3300042593 | Ga0466691_157949 | Ga0466691_157949_1620_2615 | 331 |
| 95 | 3300042593 | Ga0466691_220167 | Ga0466691_220167_10569_11564 | 331 |
| 96 | 3300042612 | Ga0466705_002203 | Ga0466705_002203_129_1124 | 331 |
| 97 | 3300042643 | Ga0466704_567869 | Ga0466704_567869_5449_6444 | 331 |
| 98 | 3300042623 | Ga0466734_104945 | Ga0466734_104945_3078_4076 | 332 |
| 99 | 3300012805 | Ga0160464_102327 | Ga0160464_1023273 | 333 |
| 100 | 3300042648 | Ga0466709_270448 | Ga0466709_270448_1291_2292 | 333 |
| 101 | iso_pr_bacteria | 2820951912 | 2820954920 | 334 |
| 102 | iso_pr_bacteria | 8102081745 | 8102083967 | 334 |
| 103 | 3300009784 | Ga0123357_10165683 | Ga0123357_101656833 | 335 |
| 104 | 3300009784 | Ga0123357_10000422 | Ga0123357_100004226 | 337 |
| 105 | 3300010049 | Ga0123356_10006265 | Ga0123356_100062654 | 352 |
| 106 | 3300009784 | Ga0123357_10005815 | Ga0123357_100058157 | 357 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01370 | Epimerase | NAD dependent epimerase/dehydratase family | 35 | 269 | 0.97 |
| PF04321 | RmlD_sub_bind | RmlD substrate binding domain | 34 | 182 | 0.94 |
| PF16363 | GDP_Man_Dehyd | GDP-mannose 4,6 dehydratase | 36 | 336 | 0.92 |
| PF05368 | NmrA | NmrA-like family | 35 | 151 | 0.91 |
| PF01073 | 3Beta_HSD | 3-beta hydroxysteroid dehydrogenase/isomerase family | 36 | 245 | 0.87 |
| PF07993 | NAD_binding_4 | Male sterility protein | 37 | 208 | 0.85 |
| PF13460 | NAD_binding_10 | NAD(P)H-binding | 39 | 160 | 0.76 |
| PF00106 | adh_short | short chain dehydrogenase | 33 | 190 | 0.75 |
| PF02719 | Polysacc_synt_2 | Polysaccharide biosynthesis protein | 35 | 250 | 0.74 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.86 | 0.9 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.