Protein Family IF02154

Metagenome Isolate
117 Members
67 Samples
93 Scaffolds
144.68 Avg Length

🧬 Representative Sequence

ID
3300009784|Ga0123357_10000738|Ga0123357_100007387
Length
165 aa
Sequence
MVVQRASAARVVVDGVVVGSLPSPGLVVLVGVTHTDTPEIAAKLAAKLWQMRILAGEECPASDTTGTDADMAPRPWSSTAVSASDINAPILVISQFTLYADTRKGRRPSWSDAAPGPVAEPLVAAVVEALQALGAHVEQGVFGAHMTVELTNDGPVTIVLDSER*

📊 Sample Types

Isolate 20.5%
Metagenome 79.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 25.4%
Unclassified 25.4%
Culicidae 10.2%
Kalotermitidae 8.5%
Tenebrionidae 6.8%
Rhinotermitidae 5.1%
Cambaridae 3.4%
Hydrophilidae 3.4%
Pyralidae 1.7%
Apidae 1.7%
Armadillidiidae 1.7%
Thomisidae 1.7%
Hodotermitidae 1.7%
Termopsidae 1.7%
Elmidae 1.7%

🌳 Taxonomy

Archaea 0
Bacteria 106
Eukaryota 0
Viruses 0
Unclassified 11

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2884351759 Cellulosimicrobium sp. BI34T Isolate Pyralidae
2 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
3 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
4 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
5 2518645556 Nocardiopsis alba ATCC BAA-2165 Isolate Apidae
6 2820838073 Unclassified Actinobacteria Lab288P4bin27 Isolate Unclassified
7 2931425734 Nocardioides sp. J2M5 Isolate
8 2931430189 Tessaracoccus palaemonis J1M15 Isolate
9 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
10 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
11 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
12 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
13 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
14 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
15 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
16 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
17 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
18 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
19 2820829137 Unclassified Actinobacteria Nc150P5bin2 Isolate Unclassified
20 2820911766 Unclassified Actinobacteria Emb289P3bin96 Isolate Unclassified
21 2915160415 Leucobacter sp. cx-328 Isolate Cambaridae
22 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
23 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
24 2505679068 Isoptericola variabilis 225 Isolate Unclassified
25 2675903013 Rhodococcus triatomae DSM 44892 Isolate Unclassified
26 2820889385 Unclassified Actinobacteria Lab288P1bin133 Isolate Unclassified
27 2820926697 Unclassified Actinobacteria Emb289P3bin125 Isolate Unclassified
28 2873586004 Sanguibacter sp. HDW7 Isolate Hydrophilidae
29 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
30 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
31 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
32 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
33 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
34 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
35 2504756063 Isoptericola variabilis J5 Isolate Unclassified
36 2630969010 Friedmanniella luteola DSM 21741 Isolate Thomisidae
37 2820814774 Unclassified Actinobacteria Nt197P3bin39 Isolate Unclassified
38 2873589062 Phycicoccus sp. HDW14 Isolate Hydrophilidae
39 2915157839 Leucobacter sp. cx-42 Isolate Cambaridae
40 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
41 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
42 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
43 8109397740 Rhodococcus triatomae DSM 44892 Isolate Unclassified
44 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
45 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
46 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
47 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
48 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
49 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
50 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
51 2820863028 Unclassified Actinobacteria Lab288P3bin164 Isolate Unclassified
52 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
53 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
54 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
55 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
56 2681812870 Oerskovia enterophila DFA-19 Isolate Unclassified
57 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
58 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
59 2820897376 Unclassified Actinobacteria Lab288P1bin101 Isolate Unclassified
60 2864899338 Mycobacteroides chelonae S00154 Isolate Elmidae
61 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
62 8030347546 Propionimicrobium sp. PCR01-08-3 Isolate Tenebrionidae
63 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
64 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
65 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
66 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
67 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562379_0342 3300056790 Bacteria 113659
2 Ga0123356_10000053 3300010049 Bacteria 124084
3 Ga0123356_11180306 3300010049 Bacteria 932
4 Ga0123354_10502052 3300010882 Bacteria 945
5 Ga0466703_255574 3300042636 Bacteria 12668
6 Ga0466727_131860 3300042655 Bacteria 2176
7 Ga0072940_1071517 3300005200 Bacteria 5157
8 Ga0466713_030641 3300042602 Bacteria 3581
9 Ga0160447_104080 3300012849 Bacteria 4436
10 Ga0160434_100021 3300012850 Bacteria 183425
11 Ga0415639_027402 3300038395 Bacteria 1284
12 Ga0466705_259401 3300042612 Bacteria 13556
13 Ga0562379_0440 3300056790 Bacteria 87979
14 Ga0123356_10006972 3300010049 Bacteria 11342
15 Ga0123354_10365318 3300010882 Bacteria 1266
16 Ga0123354_10595100 3300010882 Bacteria 813
17 Ga0160442_100094 3300012806 Bacteria 103917
18 Ga0466713_011819 3300042602 Bacteria 6512
19 Ga0160469_100347 3300012824 Bacteria 26130
20 Ga0415639_019902 3300038395 Bacteria 4082
21 Ga0123357_10299239 3300009784 Bacteria 1628
22 Ga0123357_10317239 3300009784 Bacteria 1546
23 Ga0123357_10404553 3300009784 Bacteria 1238
24 Ga0123356_10002336 3300010049 Bacteria 20375
25 Ga0123356_10465155 3300010049 Bacteria 1415
26 Ga0123356_11939846 3300010049 Unclassified 734
27 Ga0123354_10009942 3300010882 Bacteria 14621
28 Ga0123354_10039457 3300010882 Bacteria 7319
29 AustNasuHG_c1022526 3300000089 Bacteria 2022
30 JGI24699J35502_11060554 3300002509 Bacteria 1736
31 Ga0123357_10000137 3300009784 Bacteria 64068
32 Ga0466713_055644 3300042602 Bacteria 58992
33 Ga0466720_094766 3300042607 Bacteria 1063
34 Ga0160452_100003 3300012834 Bacteria 748778
35 Ga0160434_108974 3300012850 Unclassified 1639
36 Ga0160430_115297 3300012852 Bacteria 1164
37 Ga0160448_105988 3300012854 Unclassified 3099
38 Ga0466696_039670 3300042596 Bacteria 4394
39 Ga0466718_126529 3300042617 Bacteria 6465
40 Ga0123357_10015108 3300009784 Bacteria 10110
41 Ga0123357_10554165 3300009784 Bacteria 914
42 Ga0123354_10145839 3300010882 Bacteria 2897
43 Ga0123354_10441224 3300010882 Bacteria 1063
44 Ga0123354_10737930 3300010882 Unclassified 678
45 Ga0160466_100017 3300012809 Bacteria 340691
46 Ga0466730_098086 3300042625 Bacteria 4171
47 Ga0466725_235042 3300042654 Bacteria 2124
48 Ga0466727_254824 3300042655 Bacteria 1144
49 AustNasuHG_c1000071 3300000089 Bacteria 28345
50 Ga0072940_1365508 3300005200 Bacteria 2200
51 Ga0123357_10000738 3300009784 Bacteria 32853
52 Ga0466719_179140 3300042606 Bacteria 8188
53 Ga0160436_1011562 3300012861 Unclassified 1891
54 Ga0562377_1756 3300056842 Bacteria 20139
55 Ga0466723_289764 3300042618 Bacteria 1027
56 Ga0123356_10067302 3300010049 Bacteria 3355
57 Ga0123356_10191950 3300010049 Bacteria 2074
58 Ga0123353_10545498 3300010167 Bacteria 1674
59 Ga0123354_10303503 3300010882 Bacteria 1505
60 Ga0466729_204070 3300042621 Bacteria 1196
61 Ga0466706_151806 3300042599 Bacteria 1559
62 Ga0466722_061584 3300042609 Bacteria 1724
63 Ga0466698_232554 3300042610 Bacteria 1828
64 Ga0160453_104083 3300012814 Bacteria 2794
65 Ga0160446_102781 3300012835 Unclassified 2941
66 Ga0160447_132583 3300012849 Unclassified 668
67 Ga0466692_114549 3300042591 Bacteria 6083
68 Ga0123353_10000327 3300010167 Bacteria 58829
69 Ga0123353_10402361 3300010167 Bacteria 2037
70 Ga0123353_10449575 3300010167 Bacteria 1897
71 Ga0123353_10459285 3300010167 Unclassified 1872
72 Ga0123354_10019766 3300010882 Unclassified 10577
73 Ga0123354_10372177 3300010882 Unclassified 1245
74 Ga0466713_121044 3300042602 Bacteria 17000
75 Ga0160432_100175 3300012818 Bacteria 57245
76 Ga0466693_243721 3300042592 Bacteria 130981
77 Ga0123356_10312269 3300010049 Unclassified 1682
78 Ga0123356_10851333 3300010049 Bacteria 1083
79 Ga0123354_10341396 3300010882 Bacteria 1349
80 JGI24705J35276_12107014 3300002504 Bacteria 1033
81 JGI24699J35502_11133672 3300002509 Bacteria 13352
82 Ga0160446_103657 3300012835 Bacteria 2392
83 Ga0466696_284240 3300042596 Bacteria 11400
84 Ga0562379_0336 3300056790 Bacteria 114827
85 Ga0562376_0002 3300056857 Bacteria 3502070
86 Ga0123357_10371580 3300009784 Bacteria 1340
87 Ga0123356_10081407 3300010049 Bacteria 3063
88 Ga0123354_10638814 3300010882 Bacteria 765
89 Ga0072940_1472660 3300005200 Bacteria 2768
90 Ga0466707_136067 3300042601 Bacteria 1253
91 Ga0466698_184347 3300042610 Bacteria 1912
92 Ga0160459_102168 3300012831 Bacteria 3365
93 Ga0160436_1033598 3300012861 Bacteria 857

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010882 Ga0123354_10372177 Ga0123354_103721773 121
2 3300010882 Ga0123354_10341396 Ga0123354_103413962 126
3 3300042609 Ga0466722_061584 Ga0466722_061584_26_412 128
4 iso_pr_bacteria 2820814774 2820815714 129
5 3300012824 Ga0160469_100347 Ga0160469_10034713 130
6 3300010049 Ga0123356_10465155 Ga0123356_104651552 138
7 iso_pr_bacteria 2820897376 2820899219 138
8 3300010049 Ga0123356_10000053 Ga0123356_1000005348 139
9 3300042592 Ga0466693_243721 Ga0466693_243721_65737_66156 139
10 3300009784 Ga0123357_10317239 Ga0123357_103172392 140
11 3300042596 Ga0466696_039670 Ga0466696_039670_805_1230 141
12 3300042599 Ga0466706_151806 Ga0466706_151806_867_1292 141
13 3300042612 Ga0466705_259401 Ga0466705_259401_10524_10949 141
14 3300042618 Ga0466723_289764 Ga0466723_289764_529_954 141
15 3300042621 Ga0466729_204070 Ga0466729_204070_519_944 141
16 3300042655 Ga0466727_254824 Ga0466727_254824_148_573 141
17 3300056842 Ga0562377_1756 Ga0562377_1756_11525_11950 141
18 3300056857 Ga0562376_0002 Ga0562376_0002_3275078_3275503 141
19 iso_pr_bacteria 2504756063 2504978473 141
20 iso_pr_bacteria 2505679068 2505953822 141
21 iso_pr_bacteria 2518645556 2518830748 141
22 iso_pr_bacteria 2630969010 2634122910 141
23 iso_pr_bacteria 2681812870 2682013084 141
24 iso_pr_bacteria 2820863028 2820863973 141
25 iso_pr_bacteria 2820889385 2820889887 141
26 iso_pr_bacteria 2820911766 2820912536 141
27 iso_pr_bacteria 2873589062 2873592062 141
28 3300000089 AustNasuHG_c1000071 AustNasuHG_100007120 142
29 3300000089 AustNasuHG_c1022526 AustNasuHG_10225261 142
30 3300010049 Ga0123356_10002336 Ga0123356_100023363 142
31 3300010049 Ga0123356_10067302 Ga0123356_100673022 142
32 3300010049 Ga0123356_10081407 Ga0123356_100814075 142
33 3300010049 Ga0123356_10851333 Ga0123356_108513332 142
34 3300010167 Ga0123353_10000327 Ga0123353_1000032731 142
35 3300010882 Ga0123354_10145839 Ga0123354_101458392 142
36 3300010882 Ga0123354_10365318 Ga0123354_103653182 142
37 3300012806 Ga0160442_100094 Ga0160442_10009440 142
38 3300012814 Ga0160453_104083 Ga0160453_1040832 142
39 3300012831 Ga0160459_102168 Ga0160459_1021683 142
40 3300012834 Ga0160452_100003 Ga0160452_100003562 142
41 3300042591 Ga0466692_114549 Ga0466692_114549_1618_2046 142
42 3300042601 Ga0466707_136067 Ga0466707_136067_694_1122 142
43 iso_pr_bacteria 2931425734 2931426038 142
44 3300002504 JGI24705J35276_12107014 JGI24705J35276_121070142 143
45 3300005200 Ga0072940_1365508 Ga0072940_13655082 143
46 3300005200 Ga0072940_1472660 Ga0072940_14726602 143
47 3300042607 Ga0466720_094766 Ga0466720_094766_128_559 143
48 3300042610 Ga0466698_184347 Ga0466698_184347_1036_1467 143
49 3300042610 Ga0466698_232554 Ga0466698_232554_180_611 143
50 iso_pr_bacteria 2820829137 2820830570 143
51 3300002509 JGI24699J35502_11133672 JGI24699J35502_111336727 144
52 3300005200 Ga0072940_1071517 Ga0072940_10715172 144
53 3300009784 Ga0123357_10000137 Ga0123357_1000013753 144
54 3300009784 Ga0123357_10371580 Ga0123357_103715802 144
55 3300009784 Ga0123357_10404553 Ga0123357_104045532 144
56 3300009784 Ga0123357_10554165 Ga0123357_105541652 144
57 3300010882 Ga0123354_10595100 Ga0123354_105951002 144
58 3300012809 Ga0160466_100017 Ga0160466_10001729 144
59 3300042602 Ga0466713_011819 Ga0466713_011819_941_1375 144
60 3300042636 Ga0466703_255574 Ga0466703_255574_1076_1510 144
61 iso_pr_bacteria 2864899338 2864899368 144
62 3300009784 Ga0123357_10299239 Ga0123357_102992392 145
63 3300010882 Ga0123354_10009942 Ga0123354_100099422 145
64 3300010882 Ga0123354_10039457 Ga0123354_100394574 145
65 3300010882 Ga0123354_10303503 Ga0123354_103035033 145
66 3300010882 Ga0123354_10441224 Ga0123354_104412243 145
67 3300010882 Ga0123354_10737930 Ga0123354_107379301 145
68 3300012835 Ga0160446_102781 Ga0160446_1027814 145
69 3300012835 Ga0160446_103657 Ga0160446_1036571 145
70 3300012849 Ga0160447_104080 Ga0160447_1040806 145
71 3300012849 Ga0160447_132583 Ga0160447_1325832 145
72 3300012850 Ga0160434_108974 Ga0160434_1089742 145
73 3300012854 Ga0160448_105988 Ga0160448_1059884 145
74 3300012861 Ga0160436_1011562 Ga0160436_10115624 145
75 3300042596 Ga0466696_284240 Ga0466696_284240_2900_3337 145
76 3300042655 Ga0466727_131860 Ga0466727_131860_84_521 145
77 3300056790 Ga0562379_0440 Ga0562379_0440_992_1429 145
78 3300002509 JGI24699J35502_11060554 JGI24699J35502_110605541 146
79 3300010049 Ga0123356_10006972 Ga0123356_1000697213 146
80 3300010049 Ga0123356_10191950 Ga0123356_101919502 146
81 3300012818 Ga0160432_100175 Ga0160432_10017546 146
82 3300012852 Ga0160430_115297 Ga0160430_1152972 146
83 iso_pr_bacteria 2884351759 2884352887 146
84 iso_pr_bacteria 2915160415 2915161068 146
85 iso_pr_bacteria 8030347546 8030349766 146
86 3300010167 Ga0123353_10449575 Ga0123353_104495752 147
87 3300010167 Ga0123353_10459285 Ga0123353_104592852 147
88 3300010167 Ga0123353_10545498 Ga0123353_105454982 147
89 3300010882 Ga0123354_10502052 Ga0123354_105020522 147
90 3300012850 Ga0160434_100021 Ga0160434_100021115 147
91 3300042617 Ga0466718_126529 Ga0466718_126529_5534_5977 147
92 iso_pr_bacteria 2675903013 2676275713 147
93 iso_pr_bacteria 8109397740 8109401177 147
94 3300010882 Ga0123354_10019766 Ga0123354_100197668 148
95 3300038395 Ga0415639_019902 Ga0415639_019902_2571_3017 148
96 3300042654 Ga0466725_235042 Ga0466725_235042_15_461 148
97 iso_pr_bacteria 2931430189 2931432531 148
98 3300012861 Ga0160436_1033598 Ga0160436_10335981 149
99 3300042606 Ga0466719_179140 Ga0466719_179140_3958_4407 149
100 iso_pr_bacteria 2873586004 2873586370 149
101 iso_pr_bacteria 2915157839 2915157994 149
102 iso_pr_bacteria 2820838073 2820838107 150
103 iso_pr_bacteria 2820926697 2820927530 150
104 3300010167 Ga0123353_10402361 Ga0123353_104023612 151
105 3300009784 Ga0123357_10015108 Ga0123357_100151082 152
106 3300056790 Ga0562379_0336 Ga0562379_0336_63495_63953 152
107 3300056790 Ga0562379_0342 Ga0562379_0342_62310_62768 152
108 3300010049 Ga0123356_11939846 Ga0123356_119398462 154
109 3300010882 Ga0123354_10638814 Ga0123354_106388141 155
110 3300042602 Ga0466713_030641 Ga0466713_030641_3067_3534 155
111 3300042602 Ga0466713_055644 Ga0466713_055644_26471_26944 157
112 3300042602 Ga0466713_121044 Ga0466713_121044_2028_2501 157
113 3300010049 Ga0123356_10312269 Ga0123356_103122693 158
114 3300038395 Ga0415639_027402 Ga0415639_027402_569_1045 158
115 3300010049 Ga0123356_11180306 Ga0123356_111803061 163
116 3300009784 Ga0123357_10000738 Ga0123357_100007387 165
117 3300042625 Ga0466730_098086 Ga0466730_098086_2644_3141 165

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02580 Tyr_Deacylase D-Tyr-tRNA(Tyr) deacylase 1 161 0.95

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.84 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.