Protein Family IF02038
Metagenome
Isolate
183
Members
79
Samples
165
Scaffolds
209.83
Avg Length
Representative Sequence
- ID
- 3300007767|Ga0105553_1005549|Ga0105553_10055494
- Length
- 252 aa
- Sequence
- LIAHLFAILMELITKGNYYISINPCYLLFINKKKPTFVKIYDMEEILKYFPDLTPEQIAQFEKLEEVYTDWNAKINVISRKDIHELYTKHVLHSLGIAKVMEFLPGASILDVGTGGGFPGVPLAILYPETNFYLIDIIAKKIRVVNEVVNALGLKNVKAEQKRAETINEKFDFIVSRAVTNMPDFVEWIRHKTKKENIHEFENGILYLKGGDLTEELKDFPKAVQFDLANIFSDEFFETKKVVYLPLKYKG*
Sample Types
Isolate
9.8%
Metagenome
90.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
27.3%
Kalotermitidae
18.2%
Blattidae
11.7%
Unclassified
9.1%
Formicidae
7.8%
Drosophilidae
7.8%
Termopsidae
5.2%
Rhinotermitidae
3.9%
Passalidae
2.6%
Cambaridae
1.3%
Nephropidae
1.3%
Daphniidae
1.3%
Hodotermitidae
1.3%
Tenebrionidae
1.3%
Taxonomy
Archaea
1
Bacteria
176
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 2 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 3 | 2958471994 | Flavobacterium sp. xlx-221 | Isolate | Cambaridae |
| 4 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 5 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 6 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 7 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 8 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 9 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 10 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 11 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 12 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 13 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 14 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 15 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 16 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 17 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 18 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 19 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 20 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 21 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 22 | 2904728850 | Flavobacterium sp. xlx-214 | Isolate | |
| 23 | 2811995047 | Flavobacterium succinicans DD5b | Isolate | Daphniidae |
| 24 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 25 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 26 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 27 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 28 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 29 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 30 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 31 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 32 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 33 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 34 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 35 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 36 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 37 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 38 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 39 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 40 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 41 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 42 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 43 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 44 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 45 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 46 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 47 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 48 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 49 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 50 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 51 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 52 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 53 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 54 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 55 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 56 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 57 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 58 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 59 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 60 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 61 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 62 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 63 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 64 | 3300005307 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 1 gut | Metagenome | Drosophilidae |
| 65 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 66 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 67 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 68 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 69 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 70 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 71 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 72 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 73 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 74 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 75 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 76 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 77 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 78 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 79 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_100268 | 3300042612 | Bacteria | 14782 |
| 2 | Ga0466733_044409 | 3300042659 | Archaea | 1019 |
| 3 | Ga0466733_078139 | 3300042659 | Bacteria | 1146 |
| 4 | Ga0466711_114294 | 3300042615 | Bacteria | 16823 |
| 5 | Ga0466723_180016 | 3300042618 | Bacteria | 15184 |
| 6 | Ga0466726_207929 | 3300042619 | Bacteria | 8181 |
| 7 | Ga0466696_236321 | 3300042596 | Bacteria | 9172 |
| 8 | Ga0466701_020661 | 3300042598 | Bacteria | 53461 |
| 9 | Ga0466701_036999 | 3300042598 | Bacteria | 203039 |
| 10 | Ga0466701_060216 | 3300042598 | Bacteria | 4084 |
| 11 | Ga0466707_371169 | 3300042601 | Bacteria | 2360 |
| 12 | Ga0466713_035886 | 3300042602 | Bacteria | 236629 |
| 13 | Ga0466719_043632 | 3300042606 | Bacteria | 9611 |
| 14 | Ga0466719_311507 | 3300042606 | Bacteria | 11845 |
| 15 | JGI24699J35502_11134130 | 3300002509 | Bacteria | 34690 |
| 16 | Ga0072941_1274611 | 3300005201 | Bacteria | 2713 |
| 17 | Ga0123357_10000477 | 3300009784 | Bacteria | 39043 |
| 18 | Ga0466733_195509 | 3300042659 | Bacteria | 83582 |
| 19 | Ga0466710_169195 | 3300042613 | Bacteria | 14656 |
| 20 | Ga0466715_406328 | 3300042616 | Bacteria | 39935 |
| 21 | Ga0466723_033742 | 3300042618 | Bacteria | 108590 |
| 22 | Ga0466657_109403 | 3300042582 | Bacteria | 3175 |
| 23 | Ga0466693_438675 | 3300042592 | Bacteria | 1659 |
| 24 | Ga0466691_113066 | 3300042593 | Bacteria | 9717 |
| 25 | Ga0466704_293340 | 3300042643 | Bacteria | 21702 |
| 26 | Ga0466727_113759 | 3300042655 | Bacteria | 15347 |
| 27 | Ga0466707_280256 | 3300042601 | Bacteria | 8588 |
| 28 | Ga0466713_096596 | 3300042602 | Bacteria | 406546 |
| 29 | Ga0466716_119658 | 3300042605 | Bacteria | 2328 |
| 30 | Ga0466716_363242 | 3300042605 | Bacteria | 12973 |
| 31 | Ga0466722_157799 | 3300042609 | Bacteria | 1451 |
| 32 | Ga0068305_10042886 | 3300005083 | Bacteria | 6888 |
| 33 | Ga0102739_1000015 | 3300007095 | Bacteria | 59348 |
| 34 | Ga0102737_1000410 | 3300007142 | Bacteria | 14311 |
| 35 | Ga0466697_164988 | 3300042611 | Bacteria | 1372 |
| 36 | Ga0466697_175217 | 3300042611 | Bacteria | 24944 |
| 37 | Ga0466715_007956 | 3300042616 | Bacteria | 40920 |
| 38 | Ga0466715_263403 | 3300042616 | Bacteria | 1025 |
| 39 | Ga0466715_619005 | 3300042616 | Bacteria | 49282 |
| 40 | Ga0466723_006640 | 3300042618 | Bacteria | 26078 |
| 41 | Ga0466691_113384 | 3300042593 | Bacteria | 3580 |
| 42 | Ga0466691_199900 | 3300042593 | Bacteria | 20837 |
| 43 | Ga0466696_117864 | 3300042596 | Bacteria | 5918 |
| 44 | Ga0466696_124171 | 3300042596 | Bacteria | 8996 |
| 45 | Ga0466731_214305 | 3300042622 | Bacteria | 3865 |
| 46 | Ga0466703_123817 | 3300042636 | Bacteria | 10381 |
| 47 | Ga0466704_551282 | 3300042643 | Bacteria | 3028 |
| 48 | Ga0466704_573103 | 3300042643 | Bacteria | 6609 |
| 49 | Ga0466709_269068 | 3300042648 | Bacteria | 7495 |
| 50 | Ga0123353_10000136 | 3300010167 | Bacteria | 89026 |
| 51 | Ga0466707_014229 | 3300042601 | Bacteria | 20609 |
| 52 | Ga0466707_111724 | 3300042601 | Bacteria | 1606 |
| 53 | Ga0466713_043123 | 3300042602 | Bacteria | 81226 |
| 54 | Ga0466719_395744 | 3300042606 | Bacteria | 1673 |
| 55 | Ga0466722_191013 | 3300042609 | Bacteria | 3312 |
| 56 | Ga0466698_228406 | 3300042610 | Bacteria | 2517 |
| 57 | Ga0104019_1030524 | 3300007150 | Bacteria | 6342 |
| 58 | Ga0105553_1001258 | 3300007767 | Unclassified | 3179 |
| 59 | Ga0105553_1096301 | 3300007767 | Unclassified | 4059 |
| 60 | Ga0466733_065146 | 3300042659 | Bacteria | 3337 |
| 61 | Ga0466710_009732 | 3300042613 | Unclassified | 4706 |
| 62 | Ga0466715_094373 | 3300042616 | Bacteria | 10890 |
| 63 | Ga0466718_160318 | 3300042617 | Bacteria | 2960 |
| 64 | Ga0466726_237889 | 3300042619 | Bacteria | 4827 |
| 65 | Ga0466728_270400 | 3300042620 | Bacteria | 35265 |
| 66 | Ga0466690_132253 | 3300042590 | Bacteria | 7282 |
| 67 | Ga0466692_016465 | 3300042591 | Bacteria | 61232 |
| 68 | Ga0123353_10561024 | 3300010167 | Bacteria | 1644 |
| 69 | Ga0466716_217304 | 3300042605 | Bacteria | 5857 |
| 70 | Ga0104048_1028572 | 3300007143 | Unclassified | 3512 |
| 71 | Ga0105553_1106725 | 3300007767 | Unclassified | 3166 |
| 72 | Ga0466733_025416 | 3300042659 | Bacteria | 189255 |
| 73 | Ga0466711_389983 | 3300042615 | Bacteria | 28531 |
| 74 | Ga0466711_471547 | 3300042615 | Bacteria | 15822 |
| 75 | Ga0466726_182135 | 3300042619 | Bacteria | 2550 |
| 76 | Ga0466703_338718 | 3300042636 | Bacteria | 2160 |
| 77 | Ga0466703_414575 | 3300042636 | Bacteria | 31524 |
| 78 | Ga0466704_036177 | 3300042643 | Bacteria | 5279 |
| 79 | Ga0466704_063074 | 3300042643 | Bacteria | 10856 |
| 80 | Ga0466709_156301 | 3300042648 | Bacteria | 1857 |
| 81 | Ga0466724_23916 | 3300042649 | Bacteria | 557842 |
| 82 | Ga0466724_65955 | 3300042649 | Bacteria | 2951 |
| 83 | Ga0466708_057045 | 3300042652 | Bacteria | 16815 |
| 84 | Ga0466727_123703 | 3300042655 | Bacteria | 13736 |
| 85 | Ga0466727_192779 | 3300042655 | Bacteria | 40853 |
| 86 | Ga0123356_10845580 | 3300010049 | Bacteria | 1086 |
| 87 | Ga0466701_046420 | 3300042598 | Bacteria | 20498 |
| 88 | Ga0466706_056695 | 3300042599 | Bacteria | 15388 |
| 89 | Ga0466707_205352 | 3300042601 | Bacteria | 12166 |
| 90 | Ga0466713_115337 | 3300042602 | Bacteria | 64305 |
| 91 | Ga0466714_001434 | 3300042603 | Bacteria | 1213 |
| 92 | Ga0466717_021672 | 3300042604 | Bacteria | 1102 |
| 93 | 2227122483 | 2225789004 | Bacteria | 9127 |
| 94 | 2227647707 | 2225789004 | Bacteria | 2020 |
| 95 | JGI24705J35276_12237316 | 3300002504 | Bacteria | 10651 |
| 96 | Ga0103265_1000368 | 3300007068 | Unclassified | 7571 |
| 97 | Ga0466733_015565 | 3300042659 | Bacteria | 17314 |
| 98 | Ga0466715_573942 | 3300042616 | Bacteria | 7653 |
| 99 | Ga0466723_300061 | 3300042618 | Bacteria | 2387 |
| 100 | Ga0466728_013139 | 3300042620 | Bacteria | 55903 |
| 101 | Ga0466728_023032 | 3300042620 | Bacteria | 36227 |
| 102 | Ga0466690_104588 | 3300042590 | Bacteria | 10613 |
| 103 | Ga0466690_122525 | 3300042590 | Bacteria | 3807 |
| 104 | Ga0466691_081714 | 3300042593 | Bacteria | 10210 |
| 105 | Ga0466696_051573 | 3300042596 | Bacteria | 10685 |
| 106 | Ga0466696_057705 | 3300042596 | Bacteria | 4885 |
| 107 | Ga0466704_479213 | 3300042643 | Bacteria | 10932 |
| 108 | Ga0466704_534735 | 3300042643 | Bacteria | 7273 |
| 109 | Ga0123356_10068737 | 3300010049 | Bacteria | 3320 |
| 110 | Ga0466706_004061 | 3300042599 | Bacteria | 37101 |
| 111 | Ga0466707_133127 | 3300042601 | Bacteria | 4418 |
| 112 | Ga0466719_263239 | 3300042606 | Bacteria | 18951 |
| 113 | Ga0068302_10144474 | 3300005071 | Bacteria | 5624 |
| 114 | Ga0068305_10166380 | 3300005083 | Bacteria | 9289 |
| 115 | Ga0068305_10310418 | 3300005083 | Bacteria | 7027 |
| 116 | Ga0104050_1004742 | 3300007153 | Bacteria | 3453 |
| 117 | Ga0466733_210904 | 3300042659 | Bacteria | 42489 |
| 118 | Ga0466715_190114 | 3300042616 | Bacteria | 4304 |
| 119 | Ga0466715_208000 | 3300042616 | Bacteria | 5910 |
| 120 | Ga0466728_301000 | 3300042620 | Bacteria | 15979 |
| 121 | Ga0466656_221286 | 3300042550 | Bacteria | 8667 |
| 122 | Ga0466692_167706 | 3300042591 | Bacteria | 2576 |
| 123 | Ga0466696_036064 | 3300042596 | Bacteria | 108856 |
| 124 | Ga0466696_204542 | 3300042596 | Bacteria | 4996 |
| 125 | Ga0466735_144926 | 3300042624 | Bacteria | 2206 |
| 126 | Ga0466703_277710 | 3300042636 | Bacteria | 8547 |
| 127 | Ga0123356_10514129 | 3300010049 | Bacteria | 1355 |
| 128 | Ga0123353_11794465 | 3300010167 | Bacteria | 763 |
| 129 | Ga0466713_073116 | 3300042602 | Bacteria | 2194 |
| 130 | Ga0466713_149376 | 3300042602 | Bacteria | 31653 |
| 131 | 2227669912 | 2225789004 | Bacteria | 1903 |
| 132 | IMNBL1DRAFT_c0063804 | 3300000062 | Bacteria | 1094 |
| 133 | JGI24698J34947_10135727 | 3300002449 | Bacteria | 1044 |
| 134 | JGI24702J35022_10008957 | 3300002462 | Bacteria | 5640 |
| 135 | Ga0068305_10003997 | 3300005083 | Bacteria | 66958 |
| 136 | Ga0104045_1023200 | 3300007085 | Bacteria | 2330 |
| 137 | Ga0102734_1000063 | 3300007129 | Bacteria | 59508 |
| 138 | Ga0466705_261705 | 3300042612 | Bacteria | 1434 |
| 139 | Ga0466705_297106 | 3300042612 | Bacteria | 9562 |
| 140 | Ga0466733_064172 | 3300042659 | Bacteria | 8043 |
| 141 | Ga0466733_154408 | 3300042659 | Bacteria | 1208 |
| 142 | Ga0466715_279259 | 3300042616 | Bacteria | 15035 |
| 143 | Ga0466723_042738 | 3300042618 | Bacteria | 46355 |
| 144 | Ga0466690_204641 | 3300042590 | Bacteria | 6323 |
| 145 | Ga0466694_164810 | 3300042594 | Bacteria | 1037 |
| 146 | Ga0466696_256065 | 3300042596 | Bacteria | 9502 |
| 147 | Ga0466696_345561 | 3300042596 | Bacteria | 8211 |
| 148 | Ga0466729_241579 | 3300042621 | Bacteria | 1998 |
| 149 | Ga0466735_098131 | 3300042624 | Bacteria | 1135 |
| 150 | Ga0466703_071903 | 3300042636 | Bacteria | 7598 |
| 151 | Ga0466703_231350 | 3300042636 | Bacteria | 2246 |
| 152 | Ga0466708_371014 | 3300042652 | Bacteria | 33751 |
| 153 | Ga0466727_318099 | 3300042655 | Bacteria | 12384 |
| 154 | Ga0123353_10000035 | 3300010167 | Bacteria | 147488 |
| 155 | Ga0466707_084833 | 3300042601 | Bacteria | 2227 |
| 156 | Ga0466707_405332 | 3300042601 | Bacteria | 8121 |
| 157 | Ga0466713_024194 | 3300042602 | Bacteria | 6215 |
| 158 | Ga0466719_454420 | 3300042606 | Bacteria | 2700 |
| 159 | IMNBL1DRAFT_c0003022 | 3300000062 | Bacteria | 11133 |
| 160 | CVPL010W_10000055 | 3300002931 | Bacteria | 71523 |
| 161 | Ga0068302_10150637 | 3300005071 | Bacteria | 1003 |
| 162 | Ga0074308_1114280 | 3300005307 | Bacteria | 1936 |
| 163 | Ga0104050_1207330 | 3300007153 | Bacteria | 1130 |
| 164 | Ga0103268_1000080 | 3300007192 | Bacteria | 31127 |
| 165 | Ga0105553_1005549 | 3300007767 | Bacteria | 5315 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300005083 | Ga0068305_10003997 | Ga0068305_100039973 | 185 |
| 2 | 3300005083 | Ga0068305_10042886 | Ga0068305_100428866 | 192 |
| 3 | 3300042609 | Ga0466722_191013 | Ga0466722_191013_86_706 | 193 |
| 4 | 3300042622 | Ga0466731_214305 | Ga0466731_214305_3174_3794 | 193 |
| 5 | 3300042582 | Ga0466657_109403 | Ga0466657_109403_1395_1985 | 196 |
| 6 | 3300042606 | Ga0466719_263239 | Ga0466719_263239_14724_15314 | 196 |
| 7 | 3300010049 | Ga0123356_10845580 | Ga0123356_108455802 | 199 |
| 8 | 3300007767 | Ga0105553_1106725 | Ga0105553_11067252 | 202 |
| 9 | 3300042621 | Ga0466729_241579 | Ga0466729_241579_1255_1869 | 204 |
| 10 | 2225789004 | 2227647707 | 2228241661 | 206 |
| 11 | 3300002931 | CVPL010W_10000055 | CVPL010W_1000005540 | 206 |
| 12 | 3300007095 | Ga0102739_1000015 | Ga0102739_100001552 | 206 |
| 13 | 3300007192 | Ga0103268_1000080 | Ga0103268_100008017 | 206 |
| 14 | 3300042550 | Ga0466656_221286 | Ga0466656_221286_2280_2900 | 206 |
| 15 | 3300042590 | Ga0466690_132253 | Ga0466690_132253_673_1293 | 206 |
| 16 | 3300042596 | Ga0466696_124171 | Ga0466696_124171_5584_6204 | 206 |
| 17 | 3300042599 | Ga0466706_056695 | Ga0466706_056695_2389_3009 | 206 |
| 18 | 3300042601 | Ga0466707_084833 | Ga0466707_084833_1114_1734 | 206 |
| 19 | 3300042601 | Ga0466707_111724 | Ga0466707_111724_858_1478 | 206 |
| 20 | 3300042601 | Ga0466707_133127 | Ga0466707_133127_2047_2667 | 206 |
| 21 | 3300042601 | Ga0466707_205352 | Ga0466707_205352_1648_2268 | 206 |
| 22 | 3300042601 | Ga0466707_280256 | Ga0466707_280256_827_1447 | 206 |
| 23 | 3300042601 | Ga0466707_371169 | Ga0466707_371169_875_1495 | 206 |
| 24 | 3300042601 | Ga0466707_405332 | Ga0466707_405332_340_960 | 206 |
| 25 | 3300042602 | Ga0466713_035886 | Ga0466713_035886_7062_7682 | 206 |
| 26 | 3300042602 | Ga0466713_043123 | Ga0466713_043123_73659_74279 | 206 |
| 27 | 3300042602 | Ga0466713_096596 | Ga0466713_096596_281755_282375 | 206 |
| 28 | 3300042602 | Ga0466713_115337 | Ga0466713_115337_27075_27695 | 206 |
| 29 | 3300042602 | Ga0466713_149376 | Ga0466713_149376_8908_9528 | 206 |
| 30 | 3300042603 | Ga0466714_001434 | Ga0466714_001434_76_696 | 206 |
| 31 | 3300042604 | Ga0466717_021672 | Ga0466717_021672_259_879 | 206 |
| 32 | 3300042605 | Ga0466716_363242 | Ga0466716_363242_5773_6393 | 206 |
| 33 | 3300042606 | Ga0466719_395744 | Ga0466719_395744_417_1037 | 206 |
| 34 | 3300042606 | Ga0466719_454420 | Ga0466719_454420_78_698 | 206 |
| 35 | 3300042611 | Ga0466697_164988 | Ga0466697_164988_711_1331 | 206 |
| 36 | 3300042612 | Ga0466705_297106 | Ga0466705_297106_4254_4874 | 206 |
| 37 | 3300042615 | Ga0466711_389983 | Ga0466711_389983_17857_18477 | 206 |
| 38 | 3300042616 | Ga0466715_094373 | Ga0466715_094373_9034_9654 | 206 |
| 39 | 3300042616 | Ga0466715_190114 | Ga0466715_190114_2894_3514 | 206 |
| 40 | 3300042616 | Ga0466715_208000 | Ga0466715_208000_3319_3939 | 206 |
| 41 | 3300042616 | Ga0466715_619005 | Ga0466715_619005_40931_41551 | 206 |
| 42 | 3300042617 | Ga0466718_160318 | Ga0466718_160318_229_849 | 206 |
| 43 | 3300042618 | Ga0466723_006640 | Ga0466723_006640_6445_7065 | 206 |
| 44 | 3300042618 | Ga0466723_300061 | Ga0466723_300061_668_1288 | 206 |
| 45 | 3300042619 | Ga0466726_182135 | Ga0466726_182135_1766_2386 | 206 |
| 46 | 3300042619 | Ga0466726_207929 | Ga0466726_207929_6667_7287 | 206 |
| 47 | 3300042619 | Ga0466726_237889 | Ga0466726_237889_911_1531 | 206 |
| 48 | 3300042624 | Ga0466735_098131 | Ga0466735_098131_356_976 | 206 |
| 49 | 3300042636 | Ga0466703_071903 | Ga0466703_071903_2257_2877 | 206 |
| 50 | 3300042636 | Ga0466703_277710 | Ga0466703_277710_7156_7776 | 206 |
| 51 | 3300042636 | Ga0466703_414575 | Ga0466703_414575_6923_7543 | 206 |
| 52 | 3300042643 | Ga0466704_551282 | Ga0466704_551282_1903_2523 | 206 |
| 53 | 3300042643 | Ga0466704_573103 | Ga0466704_573103_617_1237 | 206 |
| 54 | 3300042648 | Ga0466709_269068 | Ga0466709_269068_2297_2917 | 206 |
| 55 | 3300042655 | Ga0466727_123703 | Ga0466727_123703_7196_7816 | 206 |
| 56 | 3300042655 | Ga0466727_192779 | Ga0466727_192779_36306_36926 | 206 |
| 57 | 3300042655 | Ga0466727_318099 | Ga0466727_318099_5858_6478 | 206 |
| 58 | 3300042659 | Ga0466733_025416 | Ga0466733_025416_126868_127488 | 206 |
| 59 | 3300042659 | Ga0466733_195509 | Ga0466733_195509_23015_23635 | 206 |
| 60 | 3300042659 | Ga0466733_210904 | Ga0466733_210904_8385_9005 | 206 |
| 61 | iso_pr_bacteria | 2820751898 | 2820753109 | 206 |
| 62 | iso_pr_bacteria | 2910930387 | 2910931436 | 206 |
| 63 | iso_pr_bacteria | 2910942425 | 2910942705 | 206 |
| 64 | iso_pr_bacteria | 2940193328 | 2940194471 | 206 |
| 65 | iso_pr_bacteria | 2940336608 | 2940337747 | 206 |
| 66 | 2225789004 | 2227122483 | 2227516092 | 207 |
| 67 | 2225789004 | 2227669912 | 2228274781 | 207 |
| 68 | 3300002449 | JGI24698J34947_10135727 | JGI24698J34947_101357272 | 207 |
| 69 | 3300002504 | JGI24705J35276_12237316 | JGI24705J35276_122373168 | 207 |
| 70 | 3300005071 | Ga0068302_10144474 | Ga0068302_101444745 | 207 |
| 71 | 3300005083 | Ga0068305_10166380 | Ga0068305_101663808 | 207 |
| 72 | 3300005083 | Ga0068305_10310418 | Ga0068305_103104186 | 207 |
| 73 | 3300005201 | Ga0072941_1274611 | Ga0072941_12746112 | 207 |
| 74 | 3300007068 | Ga0103265_1000368 | Ga0103265_10003689 | 207 |
| 75 | 3300007129 | Ga0102734_1000063 | Ga0102734_100006340 | 207 |
| 76 | 3300007142 | Ga0102737_1000410 | Ga0102737_10004107 | 207 |
| 77 | 3300010049 | Ga0123356_10068737 | Ga0123356_100687372 | 207 |
| 78 | 3300042590 | Ga0466690_104588 | Ga0466690_104588_1913_2536 | 207 |
| 79 | 3300042593 | Ga0466691_081714 | Ga0466691_081714_6840_7463 | 207 |
| 80 | 3300042596 | Ga0466696_051573 | Ga0466696_051573_2238_2861 | 207 |
| 81 | 3300042596 | Ga0466696_057705 | Ga0466696_057705_3941_4564 | 207 |
| 82 | 3300042596 | Ga0466696_117864 | Ga0466696_117864_4977_5600 | 207 |
| 83 | 3300042596 | Ga0466696_204542 | Ga0466696_204542_105_728 | 207 |
| 84 | 3300042596 | Ga0466696_236321 | Ga0466696_236321_4947_5570 | 207 |
| 85 | 3300042596 | Ga0466696_256065 | Ga0466696_256065_4672_5295 | 207 |
| 86 | 3300042596 | Ga0466696_345561 | Ga0466696_345561_6039_6662 | 207 |
| 87 | 3300042598 | Ga0466701_060216 | Ga0466701_060216_2544_3167 | 207 |
| 88 | 3300042599 | Ga0466706_004061 | Ga0466706_004061_27241_27864 | 207 |
| 89 | 3300042601 | Ga0466707_014229 | Ga0466707_014229_19786_20409 | 207 |
| 90 | 3300042605 | Ga0466716_119658 | Ga0466716_119658_496_1119 | 207 |
| 91 | 3300042605 | Ga0466716_217304 | Ga0466716_217304_5073_5696 | 207 |
| 92 | 3300042606 | Ga0466719_043632 | Ga0466719_043632_1180_1803 | 207 |
| 93 | 3300042606 | Ga0466719_311507 | Ga0466719_311507_1058_1681 | 207 |
| 94 | 3300042609 | Ga0466722_157799 | Ga0466722_157799_784_1407 | 207 |
| 95 | 3300042611 | Ga0466697_175217 | Ga0466697_175217_7401_8024 | 207 |
| 96 | 3300042612 | Ga0466705_100268 | Ga0466705_100268_3737_4360 | 207 |
| 97 | 3300042613 | Ga0466710_009732 | Ga0466710_009732_3098_3721 | 207 |
| 98 | 3300042613 | Ga0466710_169195 | Ga0466710_169195_6792_7415 | 207 |
| 99 | 3300042616 | Ga0466715_263403 | Ga0466715_263403_271_894 | 207 |
| 100 | 3300042618 | Ga0466723_033742 | Ga0466723_033742_18505_19128 | 207 |
| 101 | 3300042618 | Ga0466723_042738 | Ga0466723_042738_41449_42072 | 207 |
| 102 | 3300042636 | Ga0466703_231350 | Ga0466703_231350_746_1369 | 207 |
| 103 | 3300042636 | Ga0466703_338718 | Ga0466703_338718_156_779 | 207 |
| 104 | 3300042643 | Ga0466704_036177 | Ga0466704_036177_3850_4473 | 207 |
| 105 | 3300042643 | Ga0466704_063074 | Ga0466704_063074_1173_1796 | 207 |
| 106 | 3300042643 | Ga0466704_479213 | Ga0466704_479213_4938_5561 | 207 |
| 107 | 3300042643 | Ga0466704_534735 | Ga0466704_534735_1077_1700 | 207 |
| 108 | 3300042648 | Ga0466709_156301 | Ga0466709_156301_177_800 | 207 |
| 109 | 3300042649 | Ga0466724_65955 | Ga0466724_65955_1007_1630 | 207 |
| 110 | iso_pr_bacteria | 2820757377 | 2820758827 | 207 |
| 111 | iso_pr_bacteria | 2820768849 | 2820770053 | 207 |
| 112 | 3300000062 | IMNBL1DRAFT_c0003022 | IMNBL1DRAFT_00030223 | 208 |
| 113 | 3300002509 | JGI24699J35502_11134130 | JGI24699J35502_111341308 | 208 |
| 114 | 3300010049 | Ga0123356_10514129 | Ga0123356_105141291 | 208 |
| 115 | 3300010167 | Ga0123353_10000035 | Ga0123353_1000003569 | 208 |
| 116 | 3300010167 | Ga0123353_10000136 | Ga0123353_100001364 | 208 |
| 117 | 3300042610 | Ga0466698_228406 | Ga0466698_228406_875_1501 | 208 |
| 118 | 3300042636 | Ga0466703_123817 | Ga0466703_123817_3718_4344 | 208 |
| 119 | 3300042659 | Ga0466733_015565 | Ga0466733_015565_9405_10031 | 208 |
| 120 | 3300042659 | Ga0466733_065146 | Ga0466733_065146_579_1205 | 208 |
| 121 | 3300042659 | Ga0466733_154408 | Ga0466733_154408_487_1113 | 208 |
| 122 | iso_pr_bacteria | 2940244548 | 2940245634 | 208 |
| 123 | iso_pr_bacteria | 2940248789 | 2940250212 | 208 |
| 124 | iso_pr_bacteria | 2940253009 | 2940254061 | 208 |
| 125 | iso_pr_bacteria | 2940257232 | 2940258454 | 208 |
| 126 | 3300002462 | JGI24702J35022_10008957 | JGI24702J35022_100089574 | 209 |
| 127 | 3300010167 | Ga0123353_11794465 | Ga0123353_117944651 | 209 |
| 128 | 3300042594 | Ga0466694_164810 | Ga0466694_164810_75_704 | 209 |
| 129 | 3300042598 | Ga0466701_020661 | Ga0466701_020661_52672_53301 | 209 |
| 130 | 3300042598 | Ga0466701_036999 | Ga0466701_036999_15433_16062 | 209 |
| 131 | 3300042615 | Ga0466711_114294 | Ga0466711_114294_6695_7324 | 209 |
| 132 | 3300042616 | Ga0466715_007956 | Ga0466715_007956_33872_34501 | 209 |
| 133 | 3300042616 | Ga0466715_279259 | Ga0466715_279259_11471_12100 | 209 |
| 134 | 3300042649 | Ga0466724_23916 | Ga0466724_23916_190505_191134 | 209 |
| 135 | iso_pr_bacteria | 2811995047 | 2812947693 | 209 |
| 136 | iso_pr_bacteria | 2838772460 | 2838773411 | 209 |
| 137 | iso_pr_bacteria | 2899132286 | 2899133529 | 209 |
| 138 | iso_pr_bacteria | 2904728850 | 2904729009 | 209 |
| 139 | iso_pr_bacteria | 2910926975 | 2910929247 | 209 |
| 140 | iso_pr_bacteria | 2958471994 | 2958472214 | 209 |
| 141 | 3300005307 | Ga0074308_1114280 | Ga0074308_11142802 | 210 |
| 142 | 3300007085 | Ga0104045_1023200 | Ga0104045_10232003 | 210 |
| 143 | 3300007153 | Ga0104050_1004742 | Ga0104050_10047422 | 210 |
| 144 | 3300007153 | Ga0104050_1207330 | Ga0104050_12073302 | 210 |
| 145 | 3300042592 | Ga0466693_438675 | Ga0466693_438675_49_681 | 210 |
| 146 | 3300042652 | Ga0466708_371014 | Ga0466708_371014_20273_20905 | 210 |
| 147 | iso_pr_bacteria | 2820776227 | 2820776559 | 210 |
| 148 | 3300005071 | Ga0068302_10150637 | Ga0068302_101506372 | 211 |
| 149 | 3300009784 | Ga0123357_10000477 | Ga0123357_1000047712 | 211 |
| 150 | 3300042593 | Ga0466691_199900 | Ga0466691_199900_4428_5063 | 211 |
| 151 | 3300042602 | Ga0466713_024194 | Ga0466713_024194_2535_3173 | 212 |
| 152 | 3300042602 | Ga0466713_073116 | Ga0466713_073116_103_741 | 212 |
| 153 | 3300042615 | Ga0466711_471547 | Ga0466711_471547_14246_14884 | 212 |
| 154 | 3300042591 | Ga0466692_016465 | Ga0466692_016465_37251_37892 | 213 |
| 155 | 3300042591 | Ga0466692_167706 | Ga0466692_167706_1028_1672 | 214 |
| 156 | 3300042655 | Ga0466727_113759 | Ga0466727_113759_5167_5814 | 215 |
| 157 | 3300042590 | Ga0466690_122525 | Ga0466690_122525_1538_2188 | 216 |
| 158 | 3300042612 | Ga0466705_261705 | Ga0466705_261705_663_1313 | 216 |
| 159 | 3300042616 | Ga0466715_406328 | Ga0466715_406328_20171_20821 | 216 |
| 160 | 3300042620 | Ga0466728_270400 | Ga0466728_270400_21775_22425 | 216 |
| 161 | 3300042643 | Ga0466704_293340 | Ga0466704_293340_16080_16733 | 217 |
| 162 | 3300010167 | Ga0123353_10561024 | Ga0123353_105610242 | 218 |
| 163 | 3300042590 | Ga0466690_204641 | Ga0466690_204641_1398_2054 | 218 |
| 164 | 3300042618 | Ga0466723_180016 | Ga0466723_180016_7901_8557 | 218 |
| 165 | 3300042593 | Ga0466691_113384 | Ga0466691_113384_441_1100 | 219 |
| 166 | 3300000062 | IMNBL1DRAFT_c0063804 | IMNBL1DRAFT_00638041 | 220 |
| 167 | 3300042620 | Ga0466728_301000 | Ga0466728_301000_6126_6788 | 220 |
| 168 | 3300042659 | Ga0466733_044409 | Ga0466733_044409_118_807 | 221 |
| 169 | 3300042593 | Ga0466691_113066 | Ga0466691_113066_1282_1950 | 222 |
| 170 | 3300042620 | Ga0466728_023032 | Ga0466728_023032_31427_32095 | 222 |
| 171 | 3300042652 | Ga0466708_057045 | Ga0466708_057045_15325_15993 | 222 |
| 172 | 3300042616 | Ga0466715_573942 | Ga0466715_573942_1525_2199 | 224 |
| 173 | 3300042624 | Ga0466735_144926 | Ga0466735_144926_153_827 | 224 |
| 174 | 3300042659 | Ga0466733_064172 | Ga0466733_064172_4218_4898 | 226 |
| 175 | 3300042659 | Ga0466733_078139 | Ga0466733_078139_210_890 | 226 |
| 176 | 3300007143 | Ga0104048_1028572 | Ga0104048_10285721 | 229 |
| 177 | 3300042620 | Ga0466728_013139 | Ga0466728_013139_31220_31921 | 233 |
| 178 | 3300042596 | Ga0466696_036064 | Ga0466696_036064_54290_55015 | 241 |
| 179 | 3300042598 | Ga0466701_046420 | Ga0466701_046420_16652_17380 | 242 |
| 180 | 3300007150 | Ga0104019_1030524 | Ga0104019_10305243 | 243 |
| 181 | 3300007767 | Ga0105553_1001258 | Ga0105553_10012582 | 245 |
| 182 | 3300007767 | Ga0105553_1005549 | Ga0105553_10055494 | 252 |
| 183 | 3300007767 | Ga0105553_1096301 | Ga0105553_10963012 | 286 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.8 | 0.82 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.