Protein Family IF02013

Metagenome Metatranscriptome Isolate
201 Members
83 Samples
175 Scaffolds
92.45 Avg Length

🧬 Representative Sequence

ID
3300007505|Ga0105005_1302262|Ga0105005_13022622
Length
103 aa
Sequence
VARSLKKGPYCSPKLLKKVIKLRKEAGGRGRVVVQVWSRSSVIMPEFVGATLMVHNGKIFVPVLVNENMVGHKVGEFSMTRTFRGHSGDKKTAAPAAKQSDK*

📊 Sample Types

Isolate 12.9%
Metagenome 86.6%
MAG 0.0%
Metatranscriptome 0.5%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 39.5%
Unclassified 33.3%
Kalotermitidae 13.6%
Termopsidae 3.7%
Rhinotermitidae 2.5%
Passalidae 2.5%
Drosophilidae 1.2%
Lamproblattidae 1.2%
Blaberidae 1.2%
Hodotermitidae 1.2%

🌳 Taxonomy

Archaea 0
Bacteria 180
Eukaryota 0
Viruses 0
Unclassified 21

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2778260936 Unclassified Fibrobacteres Co191P3bin13 Isolate Unclassified
2 2820211246 Unclassified Kiritimatiellaeota Nt197P3bin96 Isolate Unclassified
3 2820316744 Unclassified Firmicutes Nt197P3bin99 Isolate Unclassified
4 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
5 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
6 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
7 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
8 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
9 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
10 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
11 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
12 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
13 2740892547 Fibrobacteria bacterium GUT77 MC_77 Isolate Unclassified
14 2772190895 Unclassified Elusimicrobia Emb289P1_bin39 Isolate Unclassified
15 2820360414 Unclassified Firmicutes Nt197P3bin121 Isolate Unclassified
16 2820094617 Unclassified Proteobacteria Lab288P3bin216 Isolate Unclassified
17 2820497731 Unclassified Firmicutes Lab288P1bin55 Isolate Unclassified
18 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
19 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
20 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
21 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
22 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
23 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
24 3002028123 Blattabacterium cuenoti LAMPROsp Isolate Lamproblattidae
25 2820768849 Unclassified Bacteroidetes Lab288P3bin194 Isolate Unclassified
26 2820774381 Unclassified Bacteroidetes Lab288P1bin37 Isolate Unclassified
27 2820451402 Unclassified Firmicutes Lab288P3bin174 Isolate Unclassified
28 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
29 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
30 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
31 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
32 2772190893 Unclassified Elusimicrobia Nt197P4_bin29 Isolate Unclassified
33 2820570671 Unclassified Firmicutes Emb289P3bin19 Isolate Unclassified
34 2820580397 Unclassified Firmicutes Emb289P3bin133 Isolate Unclassified
35 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
36 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
37 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
38 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
39 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
40 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
41 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
42 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
43 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
44 3300022232 Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA Metatranscriptome Termitidae
45 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
46 2820647881 Unclassified Firmicutes Cu122P5bin16 Isolate Unclassified
47 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
48 2778260935 Unclassified Fibrobacteres Co191P1bin79 Isolate Unclassified
49 2778260938 Unclassified Fibrobacteres Co191P3bin71 Isolate Unclassified
50 2820280018 Unclassified Firmicutes Th196P3bin149 Isolate Unclassified
51 2820549969 Unclassified Firmicutes Emb289P4bin66 Isolate Unclassified
52 2518645548 Blattabacterium sp. (Blaberus giganteus) Isolate Blaberidae
53 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
54 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
55 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
56 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
57 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
58 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
59 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
60 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
61 2820854745 Unclassified Actinobacteria Lab288P3bin234 Isolate Unclassified
62 2820873081 Unclassified Actinobacteria Lab288P1bin96 Isolate Unclassified
63 2820721785 Unclassified Fibrobacteres Lab288P1bin58 Isolate Unclassified
64 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
65 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
66 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
67 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
68 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
69 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
70 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
71 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
72 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
73 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
74 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
75 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
76 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
77 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
78 2773857778 Unclassified Fibrobacteres Co191P1bin56 Isolate Unclassified
79 2820711732 Unclassified Firmicutes Co191P1bin26 Isolate Unclassified
80 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
81 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
82 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
83 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466702_046380 3300042635 Bacteria 1461
2 Ga0466702_141512 3300042635 Unclassified 1045
3 Ga0415639_012074 3300038395 Bacteria 26131
4 Ga0415639_078078 3300038395 Bacteria 1974
5 Ga0415639_117686 3300038395 Bacteria 2129
6 Ga0466656_194335 3300042550 Bacteria 1186
7 Ga0466699_210793 3300042597 Bacteria 2801
8 JGI24695J34938_10000424 3300002450 Bacteria 40819
9 JGI24695J34938_10078886 3300002450 Unclassified 1363
10 JGI24702J35022_10925828 3300002462 Bacteria 543
11 Ga0466706_067758 3300042599 Bacteria 37640
12 Ga0466706_262595 3300042599 Bacteria 4406
13 Ga0466713_003867 3300042602 Bacteria 2180
14 Ga0466714_101031 3300042603 Bacteria 79046
15 Ga0466717_219725 3300042604 Unclassified 1046
16 Ga0466716_157301 3300042605 Bacteria 6875
17 Ga0466698_105271 3300042610 Bacteria 33608
18 Ga0466698_279801 3300042610 Bacteria 1322
19 Ga0123357_10054524 3300009784 Bacteria 5389
20 Ga0123357_10088730 3300009784 Bacteria 4039
21 Ga0123356_10698086 3300010049 Bacteria 1184
22 Ga0123353_10286056 3300010167 Bacteria 2528
23 Ga0466726_125853 3300042619 Bacteria 7815
24 2227191891 2225789004 Bacteria 35154
25 AustNasuHG_c1000697 3300000089 Bacteria 11949
26 JGI24695J34938_10381861 3300002450 Unclassified 625
27 Ga0072941_1015695 3300005201 Bacteria 23628
28 Ga0105005_1302262 3300007505 Bacteria 1012
29 Ga0466713_092327 3300042602 Bacteria 48279
30 Ga0466714_035770 3300042603 Unclassified 1895
31 Ga0466714_052822 3300042603 Bacteria 4615
32 Ga0466714_088948 3300042603 Bacteria 1271
33 Ga0466714_092590 3300042603 Bacteria 4148
34 Ga0466719_322558 3300042606 Bacteria 4524
35 Ga0123356_10195163 3300010049 Unclassified 2059
36 Ga0123356_11165207 3300010049 Bacteria 938
37 Ga0123356_12953395 3300010049 Bacteria 594
38 Ga0123353_10003138 3300010167 Bacteria 20743
39 Ga0123353_12421873 3300010167 Bacteria 627
40 Ga0123353_13255754 3300010167 Bacteria 519
41 Ga0466734_061713 3300042623 Bacteria 7989
42 Ga0466702_129145 3300042635 Bacteria 18302
43 Ga0466704_525120 3300042643 Bacteria 8699
44 Ga0466733_041624 3300042659 Bacteria 3986
45 Ga0233288_1002398 3300022232 Bacteria 1432
46 Ga0265387_1000159 3300024582 Bacteria 12397
47 Ga0466694_237102 3300042594 Bacteria 1216
48 Ga0466694_401170 3300042594 Bacteria 1016
49 Ga0466696_053065 3300042596 Bacteria 22769
50 Ga0466699_409111 3300042597 Bacteria 2759
51 IMNBL1DRAFT_c0001685 3300000062 Bacteria 16309
52 Ga0072940_1219897 3300005200 Unclassified 1394
53 Ga0072940_1484112 3300005200 Bacteria 561
54 Ga0105005_1036411 3300007505 Bacteria 3130
55 Ga0466700_260085 3300042600 Bacteria 4561
56 Ga0466713_104587 3300042602 Bacteria 60209
57 Ga0123357_10989576 3300009784 Unclassified 525
58 Ga0123355_10924432 3300009826 Unclassified 942
59 Ga0123356_10367062 3300010049 Bacteria 1568
60 Ga0123353_10000803 3300010167 Bacteria 38182
61 Ga0123353_10137894 3300010167 Bacteria 3911
62 Ga0123353_11510414 3300010167 Bacteria 855
63 Ga0466711_268245 3300042615 Bacteria 15728
64 Ga0466731_384826 3300042622 Bacteria 2225
65 Ga0466708_079679 3300042652 Bacteria 41277
66 Ga0466733_013347 3300042659 Bacteria 6976
67 Ga0466733_028639 3300042659 Unclassified 1303
68 Ga0466733_048169 3300042659 Bacteria 3126
69 Ga0466733_071083 3300042659 Bacteria 9797
70 Ga0466733_093556 3300042659 Bacteria 3713
71 Ga0265387_1061997 3300024582 Unclassified 699
72 Ga0415639_006963 3300038395 Bacteria 9614
73 Ga0466699_256991 3300042597 Bacteria 17612
74 IMNBL1DRAFT_c0049860 3300000062 Bacteria 1332
75 JGI24695J34938_10022267 3300002450 Bacteria 3081
76 Ga0068305_10736790 3300005083 Bacteria 2228
77 Ga0466706_013322 3300042599 Bacteria 22899
78 Ga0466700_402676 3300042600 Bacteria 88704
79 Ga0466714_134725 3300042603 Unclassified 1545
80 Ga0466719_130653 3300042606 Bacteria 158630
81 Ga0466720_176377 3300042607 Bacteria 1072
82 Ga0123356_10000028 3300010049 Bacteria 164875
83 Ga0123356_10095138 3300010049 Bacteria 2847
84 Ga0123356_13585956 3300010049 Bacteria 537
85 Ga0123353_10000019 3300010167 Bacteria 185006
86 Ga0123353_10783725 3300010167 Bacteria 1320
87 Ga0123353_11737781 3300010167 Bacteria 779
88 Ga0123354_10307120 3300010882 Bacteria 1489
89 Ga0466705_519922 3300042612 Bacteria 6917
90 Ga0466711_491881 3300042615 Bacteria 2562
91 Ga0466723_175546 3300042618 Bacteria 1022
92 Ga0466734_110705 3300042623 Bacteria 1692
93 Ga0466704_448187 3300042643 Bacteria 10130
94 Ga0466727_054865 3300042655 Bacteria 148022
95 Ga0466733_003819 3300042659 Bacteria 23682
96 Ga0265387_1131106 3300024582 Bacteria 551
97 Ga0466692_130735 3300042591 Bacteria 26218
98 JGI24696J40584_12783247 3300002834 Unclassified 840
99 Ga0466698_174739 3300042610 Bacteria 1953
100 Ga0123357_10412482 3300009784 Bacteria 1215
101 Ga0123355_10765329 3300009826 Bacteria 1087
102 Ga0123353_10009458 3300010167 Bacteria 13466
103 Ga0123353_10025534 3300010167 Bacteria 9003
104 Ga0123353_10631339 3300010167 Bacteria 1522
105 Ga0123353_12130583 3300010167 Unclassified 681
106 Ga0466705_411844 3300042612 Bacteria 13683
107 Ga0466715_509206 3300042616 Bacteria 1606
108 Ga0466702_111134 3300042635 Bacteria 1140
109 Ga0466733_131750 3300042659 Bacteria 3083
110 Ga0466733_174298 3300042659 Unclassified 1388
111 Ga0415639_026077 3300038395 Bacteria 21089
112 Ga0466657_371178 3300042582 Bacteria 21430
113 Ga0466691_071505 3300042593 Bacteria 23482
114 JGI24702J35022_10010130 3300002462 Bacteria 5277
115 JGI24696J40584_12408126 3300002834 Bacteria 558
116 Ga0068305_10646888 3300005083 Bacteria 642
117 Ga0072941_1032250 3300005201 Bacteria 17989
118 Ga0466714_077489 3300042603 Bacteria 2518
119 Ga0466721_235909 3300042608 Bacteria 27576
120 Ga0123355_12111054 3300009826 Bacteria 518
121 Ga0123353_10221232 3300010167 Bacteria 2960
122 Ga0123354_10096403 3300010882 Bacteria 4041
123 Ga0466715_430157 3300042616 Bacteria 1768
124 Ga0466726_195176 3300042619 Bacteria 1007
125 Ga0466726_452480 3300042619 Bacteria 13818
126 Ga0466729_073087 3300042621 Bacteria 1374
127 Ga0466734_128146 3300042623 Bacteria 1284
128 Ga0466735_005075 3300042624 Bacteria 1848
129 Ga0466702_396344 3300042635 Bacteria 2258
130 Ga0466703_349078 3300042636 Bacteria 2227
131 Ga0466704_025574 3300042643 Bacteria 55023
132 Ga0466705_115521 3300042612 Bacteria 2357
133 Ga0466705_357809 3300042612 Bacteria 37083
134 Ga0466733_119837 3300042659 Bacteria 2132
135 Ga0415639_170651 3300038395 Bacteria 6762
136 Ga0466692_120097 3300042591 Bacteria 76506
137 JGI24698J34947_10023752 3300002449 Unclassified 3278
138 JGI24705J35276_12238808 3300002504 Bacteria 121301
139 JGI24699J35502_10945964 3300002509 Bacteria 1159
140 Ga0466706_284767 3300042599 Bacteria 1263
141 Ga0466714_046049 3300042603 Unclassified 1446
142 Ga0466717_035673 3300042604 Bacteria 3668
143 Ga0466716_160113 3300042605 Bacteria 1023
144 Ga0123357_10575354 3300009784 Bacteria 881
145 Ga0123355_10026940 3300009826 Bacteria 9279
146 Ga0123356_10000763 3300010049 Bacteria 35616
147 Ga0123356_10341477 3300010049 Bacteria 1618
148 Ga0123353_12695797 3300010167 Bacteria 585
149 Ga0123354_10496124 3300010882 Bacteria 955
150 Ga0466715_329238 3300042616 Bacteria 3036
151 Ga0466726_214965 3300042619 Bacteria 31160
152 Ga0466734_004198 3300042623 Bacteria 1214
153 Ga0466702_125533 3300042635 Bacteria 57100
154 Ga0466705_079320 3300042612 Bacteria 80574
155 Ga0466705_318976 3300042612 Unclassified 1813
156 Ga0466696_197096 3300042596 Bacteria 6228
157 IMNBL1DRAFT_c0162642 3300000062 Bacteria 569
158 Ga0068305_10001287 3300005083 Bacteria 40663
159 Ga0466707_281543 3300042601 Bacteria 1906
160 Ga0466707_375112 3300042601 Bacteria 17480
161 Ga0466714_075336 3300042603 Unclassified 1849
162 Ga0466717_021470 3300042604 Bacteria 2103
163 Ga0466720_037933 3300042607 Bacteria 27996
164 Ga0123357_10059279 3300009784 Bacteria 5137
165 Ga0123356_10703415 3300010049 Unclassified 1180
166 Ga0123356_10835874 3300010049 Unclassified 1092
167 Ga0123353_10018232 3300010167 Bacteria 10368
168 Ga0123353_10243706 3300010167 Bacteria 2790
169 Ga0123353_10570534 3300010167 Bacteria 1626
170 Ga0123353_11133083 3300010167 Bacteria 1035
171 Ga0123353_11805246 3300010167 Bacteria 760
172 Ga0123353_12088035 3300010167 Bacteria 690
173 Ga0466710_419232 3300042613 Bacteria 6782
174 Ga0466712_100338 3300042614 Bacteria 15027
175 Ga0466718_046336 3300042617 Bacteria 63413

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300009826 Ga0123355_10924432 Ga0123355_109244322 87
2 3300007505 Ga0105005_1036411 Ga0105005_10364117 89
3 3300024582 Ga0265387_1000159 Ga0265387_100015921 89
4 3300024582 Ga0265387_1061997 Ga0265387_10619972 89
5 3300024582 Ga0265387_1131106 Ga0265387_11311061 89
6 3300042591 Ga0466692_120097 Ga0466692_120097_16613_16882 89
7 3300042599 Ga0466706_013322 Ga0466706_013322_9051_9320 89
8 3300042599 Ga0466706_067758 Ga0466706_067758_12149_12418 89
9 3300042599 Ga0466706_262595 Ga0466706_262595_2854_3123 89
10 3300042600 Ga0466700_260085 Ga0466700_260085_335_604 89
11 3300042603 Ga0466714_035770 Ga0466714_035770_1110_1379 89
12 3300042603 Ga0466714_046049 Ga0466714_046049_339_608 89
13 3300042603 Ga0466714_052822 Ga0466714_052822_2786_3055 89
14 3300042603 Ga0466714_075336 Ga0466714_075336_1048_1317 89
15 3300042603 Ga0466714_088948 Ga0466714_088948_849_1118 89
16 3300042603 Ga0466714_092590 Ga0466714_092590_1225_1494 89
17 3300042603 Ga0466714_101031 Ga0466714_101031_64598_64867 89
18 3300042603 Ga0466714_134725 Ga0466714_134725_636_905 89
19 3300042604 Ga0466717_219725 Ga0466717_219725_444_713 89
20 3300042623 Ga0466734_004198 Ga0466734_004198_27_296 89
21 3300042659 Ga0466733_003819 Ga0466733_003819_17001_17270 89
22 3300042659 Ga0466733_013347 Ga0466733_013347_2029_2298 89
23 3300042659 Ga0466733_028639 Ga0466733_028639_785_1054 89
24 3300042659 Ga0466733_048169 Ga0466733_048169_693_962 89
25 3300042659 Ga0466733_071083 Ga0466733_071083_6288_6557 89
26 3300042659 Ga0466733_093556 Ga0466733_093556_3123_3392 89
27 3300042659 Ga0466733_119837 Ga0466733_119837_870_1139 89
28 3300042659 Ga0466733_131750 Ga0466733_131750_1582_1851 89
29 3300042659 Ga0466733_174298 Ga0466733_174298_448_717 89
30 iso_pr_bacteria 2820768849 2820769685 89
31 iso_pr_bacteria 2820774381 2820774686 89
32 2225789004 2227191891 2227613418 90
33 3300002462 JGI24702J35022_10925828 JGI24702J35022_109258281 90
34 3300009784 Ga0123357_10054524 Ga0123357_1005452410 90
35 3300009784 Ga0123357_10989576 Ga0123357_109895762 90
36 3300010049 Ga0123356_10195163 Ga0123356_101951634 90
37 3300010049 Ga0123356_10703415 Ga0123356_107034152 90
38 3300010167 Ga0123353_10000019 Ga0123353_1000001968 90
39 3300010167 Ga0123353_10003138 Ga0123353_1000313827 90
40 3300010167 Ga0123353_10286056 Ga0123353_102860562 90
41 3300010882 Ga0123354_10096403 Ga0123354_100964036 90
42 3300010882 Ga0123354_10496124 Ga0123354_104961242 90
43 3300042593 Ga0466691_071505 Ga0466691_071505_2956_3228 90
44 3300042612 Ga0466705_318976 Ga0466705_318976_717_989 90
45 3300042643 Ga0466704_025574 Ga0466704_025574_51821_52093 90
46 3300042643 Ga0466704_525120 Ga0466704_525120_5483_5755 90
47 iso_pr_bacteria 2820873081 2820873472 90
48 3300000062 IMNBL1DRAFT_c0001685 IMNBL1DRAFT_00016856 91
49 3300010049 Ga0123356_10698086 Ga0123356_106980862 91
50 3300010167 Ga0123353_10018232 Ga0123353_1001823210 91
51 3300042596 Ga0466696_053065 Ga0466696_053065_1812_2087 91
52 3300042601 Ga0466707_375112 Ga0466707_375112_14911_15186 91
53 3300042610 Ga0466698_174739 Ga0466698_174739_1624_1899 91
54 3300042610 Ga0466698_279801 Ga0466698_279801_832_1107 91
55 3300042613 Ga0466710_419232 Ga0466710_419232_503_778 91
56 3300042619 Ga0466726_125853 Ga0466726_125853_3164_3439 91
57 3300042621 Ga0466729_073087 Ga0466729_073087_642_917 91
58 3300042623 Ga0466734_061713 Ga0466734_061713_4391_4666 91
59 3300042623 Ga0466734_128146 Ga0466734_128146_657_932 91
60 3300042635 Ga0466702_125533 Ga0466702_125533_32807_33082 91
61 3300042635 Ga0466702_129145 Ga0466702_129145_15498_15773 91
62 3300042659 Ga0466733_041624 Ga0466733_041624_2364_2639 91
63 iso_pr_bacteria 2820360414 2820361185 91
64 iso_pr_bacteria 2820549969 2820551082 91
65 iso_pr_bacteria 2820570671 2820571574 91
66 3300000062 IMNBL1DRAFT_c0162642 IMNBL1DRAFT_01626421 92
67 3300002462 JGI24702J35022_10010130 JGI24702J35022_100101302 92
68 3300005200 Ga0072940_1484112 Ga0072940_14841122 92
69 3300009784 Ga0123357_10088730 Ga0123357_100887305 92
70 3300010049 Ga0123356_10000028 Ga0123356_1000002829 92
71 3300010049 Ga0123356_10341477 Ga0123356_103414772 92
72 3300010167 Ga0123353_10221232 Ga0123353_102212322 92
73 3300010167 Ga0123353_12695797 Ga0123353_126957972 92
74 3300010882 Ga0123354_10307120 Ga0123354_103071203 92
75 3300038395 Ga0415639_006963 Ga0415639_006963_3153_3431 92
76 3300038395 Ga0415639_012074 Ga0415639_012074_15671_15949 92
77 3300038395 Ga0415639_078078 Ga0415639_078078_123_401 92
78 3300042594 Ga0466694_237102 Ga0466694_237102_657_935 92
79 3300042597 Ga0466699_256991 Ga0466699_256991_4920_5198 92
80 3300042597 Ga0466699_409111 Ga0466699_409111_561_839 92
81 3300042602 Ga0466713_003867 Ga0466713_003867_285_563 92
82 3300042606 Ga0466719_322558 Ga0466719_322558_1834_2112 92
83 3300042610 Ga0466698_105271 Ga0466698_105271_15209_15487 92
84 3300042612 Ga0466705_519922 Ga0466705_519922_2684_2962 92
85 3300042615 Ga0466711_268245 Ga0466711_268245_10646_10924 92
86 3300042617 Ga0466718_046336 Ga0466718_046336_37811_38089 92
87 3300042619 Ga0466726_214965 Ga0466726_214965_6163_6441 92
88 3300042619 Ga0466726_452480 Ga0466726_452480_10594_10872 92
89 3300042655 Ga0466727_054865 Ga0466727_054865_79628_79906 92
90 iso_pr_bacteria 2820497731 2820498478 92
91 iso_pr_bacteria 2820721785 2820723761 92
92 iso_pr_bacteria 2820854745 2820854964 92
93 3300000062 IMNBL1DRAFT_c0049860 IMNBL1DRAFT_00498602 93
94 3300002450 JGI24695J34938_10078886 JGI24695J34938_100788862 93
95 3300002834 JGI24696J40584_12408126 JGI24696J40584_124081261 93
96 3300002834 JGI24696J40584_12783247 JGI24696J40584_127832472 93
97 3300005200 Ga0072940_1219897 Ga0072940_12198972 93
98 3300005201 Ga0072941_1032250 Ga0072941_10322507 93
99 3300009826 Ga0123355_10765329 Ga0123355_107653292 93
100 3300010049 Ga0123356_10095138 Ga0123356_100951384 93
101 3300010049 Ga0123356_11165207 Ga0123356_111652072 93
102 3300010167 Ga0123353_10000803 Ga0123353_1000080332 93
103 3300010167 Ga0123353_10631339 Ga0123353_106313391 93
104 3300010167 Ga0123353_11510414 Ga0123353_115104142 93
105 3300010167 Ga0123353_11737781 Ga0123353_117377812 93
106 3300010167 Ga0123353_12088035 Ga0123353_120880352 93
107 3300010167 Ga0123353_12130583 Ga0123353_121305832 93
108 3300042582 Ga0466657_371178 Ga0466657_371178_18012_18293 93
109 3300042591 Ga0466692_130735 Ga0466692_130735_3283_3564 93
110 3300042601 Ga0466707_281543 Ga0466707_281543_318_599 93
111 3300042605 Ga0466716_157301 Ga0466716_157301_760_1041 93
112 3300042605 Ga0466716_160113 Ga0466716_160113_230_511 93
113 3300042607 Ga0466720_176377 Ga0466720_176377_189_470 93
114 3300042612 Ga0466705_079320 Ga0466705_079320_16829_17110 93
115 3300042612 Ga0466705_115521 Ga0466705_115521_1284_1565 93
116 3300042612 Ga0466705_357809 Ga0466705_357809_14490_14771 93
117 3300042612 Ga0466705_411844 Ga0466705_411844_9903_10184 93
118 3300042616 Ga0466715_329238 Ga0466715_329238_1232_1513 93
119 3300042616 Ga0466715_430157 Ga0466715_430157_36_317 93
120 3300042616 Ga0466715_509206 Ga0466715_509206_823_1104 93
121 3300042618 Ga0466723_175546 Ga0466723_175546_225_506 93
122 3300042623 Ga0466734_110705 Ga0466734_110705_298_579 93
123 3300042624 Ga0466735_005075 Ga0466735_005075_647_928 93
124 3300042636 Ga0466703_349078 Ga0466703_349078_752_1033 93
125 3300042643 Ga0466704_448187 Ga0466704_448187_6314_6595 93
126 3300042652 Ga0466708_079679 Ga0466708_079679_3808_4089 93
127 iso_pr_bacteria 2518645548 2518801857 93
128 iso_pr_bacteria 2820094617 2820095951 93
129 iso_pr_bacteria 2820451402 2820452017 93
130 3300002449 JGI24698J34947_10023752 JGI24698J34947_100237525 94
131 3300005083 Ga0068305_10646888 Ga0068305_106468881 94
132 3300009784 Ga0123357_10412482 Ga0123357_104124822 94
133 3300009784 Ga0123357_10575354 Ga0123357_105753541 94
134 3300009826 Ga0123355_12111054 Ga0123355_121110541 94
135 3300010049 Ga0123356_10367062 Ga0123356_103670623 94
136 3300010049 Ga0123356_12953395 Ga0123356_129533952 94
137 3300010049 Ga0123356_13585956 Ga0123356_135859562 94
138 3300010167 Ga0123353_10009458 Ga0123353_100094584 94
139 3300010167 Ga0123353_10025534 Ga0123353_100255347 94
140 3300010167 Ga0123353_10243706 Ga0123353_102437065 94
141 3300010167 Ga0123353_10570534 Ga0123353_105705341 94
142 3300010167 Ga0123353_10783725 Ga0123353_107837252 94
143 3300010167 Ga0123353_11133083 Ga0123353_111330831 94
144 3300010167 Ga0123353_12421873 Ga0123353_124218732 94
145 3300010167 Ga0123353_13255754 Ga0123353_132557542 94
146 3300022232 Ga0233288_1002398 Ga0233288_10023983 94
147 3300038395 Ga0415639_026077 Ga0415639_026077_8362_8646 94
148 3300038395 Ga0415639_117686 Ga0415639_117686_1595_1879 94
149 3300038395 Ga0415639_170651 Ga0415639_170651_266_550 94
150 3300042550 Ga0466656_194335 Ga0466656_194335_72_356 94
151 3300042596 Ga0466696_197096 Ga0466696_197096_3064_3348 94
152 3300042597 Ga0466699_210793 Ga0466699_210793_902_1186 94
153 3300042600 Ga0466700_402676 Ga0466700_402676_29443_29727 94
154 3300042602 Ga0466713_092327 Ga0466713_092327_3383_3667 94
155 3300042602 Ga0466713_104587 Ga0466713_104587_3234_3518 94
156 3300042603 Ga0466714_077489 Ga0466714_077489_559_843 94
157 3300042604 Ga0466717_021470 Ga0466717_021470_277_561 94
158 3300042604 Ga0466717_035673 Ga0466717_035673_2341_2625 94
159 3300042606 Ga0466719_130653 Ga0466719_130653_3461_3745 94
160 3300042607 Ga0466720_037933 Ga0466720_037933_11929_12213 94
161 3300042608 Ga0466721_235909 Ga0466721_235909_17719_18003 94
162 3300042614 Ga0466712_100338 Ga0466712_100338_5971_6255 94
163 3300042615 Ga0466711_491881 Ga0466711_491881_1096_1380 94
164 3300042619 Ga0466726_195176 Ga0466726_195176_143_427 94
165 3300042622 Ga0466731_384826 Ga0466731_384826_849_1133 94
166 3300042635 Ga0466702_046380 Ga0466702_046380_242_526 94
167 3300042635 Ga0466702_111134 Ga0466702_111134_105_389 94
168 3300042635 Ga0466702_141512 Ga0466702_141512_105_389 94
169 3300042635 Ga0466702_396344 Ga0466702_396344_1018_1302 94
170 iso_pr_bacteria 2740892547 2743913157 94
171 iso_pr_bacteria 2772190893 2773438317 94
172 iso_pr_bacteria 2772190895 2773440580 94
173 iso_pr_bacteria 2773857778 2774475342 94
174 iso_pr_bacteria 2778260935 2778343694 94
175 iso_pr_bacteria 2778260936 2778345639 94
176 iso_pr_bacteria 2778260938 2778350278 94
177 iso_pr_bacteria 2820211246 2820212026 94
178 iso_pr_bacteria 2820580397 2820580545 94
179 iso_pr_bacteria 2820647881 2820649674 94
180 iso_pr_bacteria 3002028123 3002028515 94
181 3300000089 AustNasuHG_c1000697 AustNasuHG_10006971 95
182 3300002450 JGI24695J34938_10000424 JGI24695J34938_1000042420 95
183 3300002450 JGI24695J34938_10381861 JGI24695J34938_103818612 95
184 3300002504 JGI24705J35276_12238808 JGI24705J35276_122388088 95
185 3300002509 JGI24699J35502_10945964 JGI24699J35502_109459643 95
186 3300005083 Ga0068305_10001287 Ga0068305_100012876 95
187 3300005201 Ga0072941_1015695 Ga0072941_101569528 95
188 3300009784 Ga0123357_10059279 Ga0123357_100592797 95
189 3300009826 Ga0123355_10026940 Ga0123355_100269402 95
190 3300010049 Ga0123356_10000763 Ga0123356_1000076336 95
191 3300010049 Ga0123356_10835874 Ga0123356_108358741 95
192 3300010167 Ga0123353_10137894 Ga0123353_101378945 95
193 3300042594 Ga0466694_401170 Ga0466694_401170_187_474 95
194 iso_pr_bacteria 2820280018 2820280712 95
195 iso_pr_bacteria 2820316744 2820317606 96
196 iso_pr_bacteria 2820711732 2820711901 96
197 3300002450 JGI24695J34938_10022267 JGI24695J34938_100222674 97
198 3300042599 Ga0466706_284767 Ga0466706_284767_197_493 98
199 3300005083 Ga0068305_10736790 Ga0068305_107367902 100
200 3300007505 Ga0105005_1302262 Ga0105005_13022622 103
201 3300010167 Ga0123353_11805246 Ga0123353_118052462 108

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00203 Ribosomal_S19 Ribosomal protein S19 3 86 0.94

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.69 0.85 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.