Protein Family IF01907

Metagenome Isolate
223 Members
169 Samples
120 Scaffolds
179.45 Avg Length

🧬 Representative Sequence

ID
3300007192|Ga0103268_1000218|Ga0103268_100021810
Length
189 aa
Sequence
MAELSTVARPYAEAVFASARDAADQAGPNGLSAWSDRLAQMAAVAAHPEVRQALADPRVAPAERIAIFTALIKSELPPGLPPSAHNFIALLVENDRLLLLPEIAAQFAAAKDRHEGVAVAEIASAFALDDAQVQELLAGLEQKFGGKLTARVTVDPALIGGVRVTVGDQVLDTSVRAQLTRLADTLAA*

📊 Sample Types

Isolate 46.2%
Metagenome 53.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Coreidae 48.2%
Termitidae 13.9%
Unclassified 12.0%
Formicidae 9.0%
Kalotermitidae 7.2%
Termopsidae 2.4%
Rhinotermitidae 1.8%
Largidae 1.2%
Culicidae 1.2%
Berytidae 1.2%
Armadillidiidae 0.6%
Crambidae 0.6%
Alydidae 0.6%

🌳 Taxonomy

Archaea 0
Bacteria 215
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820065746 Unclassified Proteobacteria Nt197P3bin56 Isolate Unclassified
2 2820084079 Unclassified Proteobacteria Lab288P4bin103 Isolate Unclassified
3 3003869270 Paraburkholderia sp. PGU16 Isolate Largidae
4 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
5 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
6 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
7 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
8 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
9 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
10 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
11 8023747282 Caballeronia zhejiangensis LZ019 Isolate Coreidae
12 8024025509 Caballeronia grimmiae Lep1A1 Isolate Coreidae
13 8024037630 Caballeronia zhejiangensis A33_M4_a Isolate Coreidae
14 8025685901 Caballeronia fortuita LZ035 Isolate Coreidae
15 8025723035 Caballeronia grimmiae LZ025 Isolate Coreidae
16 8025756023 Caballeronia peredens LZ002 Isolate Coreidae
17 8078130113 Caballeronia sp. INDeC2 Isolate Coreidae
18 8102054868 Caballeronia sp. GAFFF1 Isolate Coreidae
19 8102102351 Caballeronia sp. INML1 Isolate Coreidae
20 8102161003 Caballeronia sp. LZ002 Isolate Coreidae
21 8102174626 Caballeronia sp. LZ024 Isolate Coreidae
22 8102246966 Caballeronia sp. LZ050 Isolate Coreidae
23 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
24 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
25 2687453742 Burkholderiales bacterium B_Cag20 Isolate Unclassified
26 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
27 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
28 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
29 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
30 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
31 8023757577 Caballeronia peredens LP006 Isolate Coreidae
32 8023764196 Caballeronia peredens LZ001 Isolate Coreidae
33 8025678175 Caballeronia hypogeia LZ043 Isolate Coreidae
34 8025728939 Caballeronia telluris LZ024 Isolate Coreidae
35 8025747911 Caballeronia peredens LZ003 Isolate Coreidae
36 8069755105 Caballeronia sp. LZ003 Isolate Coreidae
37 8069775773 Caballeronia sp. LZ062 Isolate Coreidae
38 8101951471 Caballeronia sp. AAUFL_F1_KS45 Isolate Coreidae
39 8101974301 Caballeronia sp. ASUFL_F2_KS49 Isolate Coreidae
40 8101981714 Caballeronia sp. ATUFL_F1_KS39 Isolate Coreidae
41 8102020860 Caballeronia sp. AZ10_KS36 Isolate Coreidae
42 8102026984 Caballeronia sp. AZ1_KS37 Isolate Coreidae
43 8102067727 Caballeronia sp. GAFFF3 Isolate Coreidae
44 2820121232 Unclassified Proteobacteria Emb289P4bin32 Isolate Unclassified
45 2820123897 Unclassified Proteobacteria Emb289P4bin18 Isolate Unclassified
46 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
47 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
48 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
49 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
50 8023724303 Caballeronia zhejiangensis LP003 Isolate Coreidae
51 8024001094 Caballeronia sp. TF1N1 Isolate Berytidae
52 8025666332 Caballeronia grimmiae LZ050 Isolate Coreidae
53 8025694439 Caballeronia cordobensis LZ033 Isolate Coreidae
54 8025701579 Caballeronia telluris LZ031 Isolate Coreidae
55 8101967387 Caballeronia sp. AAUFL_F3_KS11A Isolate Coreidae
56 8102007614 Caballeronia sp. ATUFL_M1_KS5A Isolate Coreidae
57 8102041249 Caballeronia sp. GACF4 Isolate Coreidae
58 8102087471 Caballeronia sp. GAWG2-1 Isolate Coreidae
59 8102201977 Caballeronia sp. LZ031 Isolate Coreidae
60 8102264549 Caballeronia sp. NCF2 Isolate Coreidae
61 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
62 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
63 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
64 2891720358 Azoarcus nasutitermitis CC-YHH838 Isolate Unclassified
65 2820042117 Unclassified Proteobacteria Th196P4bin58 Isolate Unclassified
66 2820050117 Unclassified Proteobacteria Th196P3bin129 Isolate Unclassified
67 2820086750 Unclassified Proteobacteria Lab288P3bin98 Isolate Unclassified
68 2820132692 Unclassified Proteobacteria Emb289P3bin76 Isolate Unclassified
69 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
70 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
71 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
72 8025650824 Caballeronia hypogeia LZ032 Isolate Coreidae
73 8025671076 Caballeronia cordobensis LZ034LL Isolate Coreidae
74 8025735396 Caballeronia zhejiangensis LZ016 Isolate Coreidae
75 8102047609 Caballeronia sp. GACF5 Isolate Coreidae
76 8102074813 Caballeronia sp. GAWG1-1 Isolate Coreidae
77 8102081745 Caballeronia sp. GAWG1-5s-s Isolate Coreidae
78 8102117041 Caballeronia sp. INML3 Isolate Coreidae
79 8102131453 Caballeronia sp. INML5 Isolate Coreidae
80 8102138357 Caballeronia sp. INSB1 Isolate Coreidae
81 8102216467 Caballeronia sp. LZ033 Isolate Coreidae
82 8102230706 Caballeronia sp. LZ035 Isolate Coreidae
83 8102239244 Caballeronia sp. LZ043 Isolate Coreidae
84 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
85 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
86 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
87 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
88 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
89 2603880165 Burkholderiales A1 Isolate Unclassified
90 2603880170 Burkholderiales A2 Isolate Unclassified
91 2603880172 Burkholderiales C Isolate Unclassified
92 2820089333 Unclassified Proteobacteria Lab288P3bin88 Isolate Unclassified
93 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
94 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
95 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
96 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
97 8025658853 Caballeronia temeraria LZ065 Isolate Coreidae
98 8025708040 Caballeronia jiangsuensis LZ029 Isolate Coreidae
99 8069770227 Caballeronia sp. LZ019 Isolate Coreidae
100 8101994502 Caballeronia sp. ATUFL_F2_KS42 Isolate Coreidae
101 8102124461 Caballeronia sp. INML3B Isolate Coreidae
102 8102193924 Caballeronia sp. LZ029 Isolate Coreidae
103 8102312426 Caballeronia sp. AAUFL_F1_KS47 Isolate Coreidae
104 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
105 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
106 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
107 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
108 2687453753 Burkholderiales bacterium B_Cag25 Isolate Unclassified
109 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
110 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
111 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
112 8024014383 Caballeronia sp. SL2Y3 Isolate Berytidae
113 8025740903 Caballeronia zhejiangensis LZ008 Isolate Coreidae
114 8069748016 Caballeronia sp. LP003 Isolate Coreidae
115 8102033761 Caballeronia sp. AZ7_KS35 Isolate Coreidae
116 8102094248 Caballeronia sp. GaOx3 Isolate Coreidae
117 8102109360 Caballeronia sp. INML2 Isolate Coreidae
118 8102145433 Caballeronia sp. LP006 Isolate Coreidae
119 8102186987 Caballeronia sp. LZ028 Isolate Coreidae
120 8102223607 Caballeronia sp. LZ034LL Isolate Coreidae
121 8102286609 Caballeronia sp. NCTM5 Isolate Coreidae
122 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
123 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
124 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
125 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
126 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
127 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
128 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
129 2855798354 Achromobacter insolitus AR476-2 Isolate Crambidae
130 2597489944 Caballeronia insecticola RPE64 Isolate Alydidae
131 2820152154 Unclassified Proteobacteria Cu122P5bin47 Isolate Unclassified
132 3003878002 Paraburkholderia sp. PGU19 Isolate Largidae
133 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
134 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
135 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
136 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
137 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
138 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
139 8023752828 Caballeronia grimmiae LZ062 Isolate Coreidae
140 8024019580 Caballeronia sp. Lep1P3 Isolate Coreidae
141 8024044713 Caballeronia sp. Sq4a Isolate Coreidae
142 8069763219 Caballeronia sp. LZ008 Isolate Coreidae
143 8102001125 Caballeronia sp. ATUFL_F2_KS9A Isolate Coreidae
144 8102169119 Caballeronia sp. LZ016 Isolate Coreidae
145 8102181083 Caballeronia sp. LZ025 Isolate Coreidae
146 8102271933 Caballeronia sp. NCF4 Isolate Coreidae
147 2820047982 Unclassified Proteobacteria Th196P3bin67 Isolate Unclassified
148 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
149 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
150 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
151 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
152 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
153 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
154 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
155 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
156 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
157 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
158 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
159 8025716094 Caballeronia zhejiangensis LZ028 Isolate Coreidae
160 8101960468 Caballeronia sp. AAUFL_F2_KS46 Isolate Coreidae
161 8101988189 Caballeronia sp. ATUFL_F1_KS4A Isolate Coreidae
162 8102014801 Caballeronia sp. ATUFL_M2_KS44 Isolate Coreidae
163 8102060671 Caballeronia sp. GAFFF2 Isolate Coreidae
164 8102152052 Caballeronia sp. LZ001 Isolate Coreidae
165 8102208438 Caballeronia sp. LZ032 Isolate Coreidae
166 8102251710 Caballeronia sp. LZ065 Isolate Coreidae
167 8102279326 Caballeronia sp. NCTM1 Isolate Coreidae
168 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
169 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466719_318030 3300042606 Bacteria 16946
2 Ga0466722_117171 3300042609 Bacteria 8925
3 Ga0123353_12037254 3300010167 Bacteria 701
4 Ga0123354_10221514 3300010882 Bacteria 2008
5 Ga0466715_489248 3300042616 Bacteria 48521
6 Ga0466734_059542 3300042623 Bacteria 5289
7 Ga0466734_143966 3300042623 Bacteria 5120
8 Ga0466734_173135 3300042623 Bacteria 3761
9 Ga0466708_334281 3300042652 Bacteria 33858
10 Ga0466725_115558 3300042654 Bacteria 1211
11 Ga0160457_1000405 3300012858 Unclassified 22189
12 Ga0466657_005142 3300042582 Bacteria 5751
13 JGI24705J35276_12140654 3300002504 Unclassified 1140
14 Ga0072941_1734208 3300005201 Bacteria 801
15 Ga0103261_1007382 3300007083 Bacteria 1571
16 Ga0103264_1000943 3300007188 Bacteria 24253
17 Ga0466707_251230 3300042601 Bacteria 10685
18 Ga0123356_10109662 3300010049 Bacteria 2664
19 Ga0160464_100021 3300012805 Bacteria 235073
20 Ga0466715_026089 3300042616 Bacteria 3374
21 Ga0466718_102895 3300042617 Bacteria 8438
22 Ga0466725_074169 3300042654 Bacteria 76060
23 Ga0466727_259800 3300042655 Bacteria 8194
24 Ga0466694_107424 3300042594 Bacteria 3800
25 CVPL010W_10005572 3300002931 Bacteria 13386
26 CVPL010W_10011897 3300002931 Bacteria 17210
27 Ga0068302_10159304 3300005071 Bacteria 5884
28 Ga0068305_10452970 3300005083 Bacteria 11850
29 Ga0102736_1003202 3300007052 Bacteria 4944
30 Ga0102737_1002361 3300007142 Bacteria 4719
31 Ga0102737_1003130 3300007142 Bacteria 3875
32 Ga0466717_205487 3300042604 Unclassified 1320
33 Ga0466719_038470 3300042606 Bacteria 6808
34 Ga0466697_166925 3300042611 Bacteria 1567
35 Ga0466723_004783 3300042618 Bacteria 50754
36 Ga0466726_036682 3300042619 Bacteria 6343
37 Ga0466734_136333 3300042623 Bacteria 1993
38 Ga0466730_079112 3300042625 Bacteria 1647
39 Ga0466725_216650 3300042654 Bacteria 1325
40 Ga0466690_124436 3300042590 Bacteria 3305
41 Ga0102734_1002104 3300007129 Bacteria 5319
42 Ga0103260_1031882 3300007139 Unclassified 795
43 Ga0466713_138497 3300042602 Bacteria 33519
44 Ga0466717_044506 3300042604 Unclassified 3150
45 Ga0466719_124770 3300042606 Bacteria 18525
46 Ga0466735_073173 3300042624 Bacteria 4246
47 Ga0466703_408887 3300042636 Bacteria 13876
48 Ga0466709_073297 3300042648 Bacteria 46472
49 Ga0466708_403743 3300042652 Bacteria 6295
50 Ga0466727_036206 3300042655 Bacteria 41561
51 Ga0160441_100002 3300012825 Bacteria 856781
52 Ga0466693_316890 3300042592 Bacteria 5155
53 CVPL005W_1000361 3300002934 Bacteria 20202
54 Ga0072941_1096165 3300005201 Bacteria 6990
55 Ga0102736_1001599 3300007052 Bacteria 3898
56 Ga0103264_1000547 3300007188 Bacteria 22281
57 Ga0103268_1000218 3300007192 Bacteria 18974
58 Ga0123356_10573371 3300010049 Bacteria 1291
59 Ga0466703_038344 3300042636 Bacteria 10455
60 Ga0466703_195519 3300042636 Bacteria 74513
61 Ga0466724_33963 3300042649 Bacteria 1580
62 Ga0466657_269966 3300042582 Bacteria 100925
63 CVPL010W_10021137 3300002931 Unclassified 5323
64 CVPL005L_10002296 3300002938 Bacteria 21930
65 Ga0103265_1007061 3300007068 Bacteria 1499
66 Ga0102739_1000307 3300007095 Bacteria 11194
67 Ga0102737_1002402 3300007142 Bacteria 4658
68 Ga0466700_428137 3300042600 Bacteria 1954
69 Ga0466722_048156 3300042609 Bacteria 4557
70 Ga0466697_156548 3300042611 Bacteria 1212
71 Ga0466697_252057 3300042611 Bacteria 3603
72 Ga0466705_118406 3300042612 Bacteria 22374
73 Ga0466733_040157 3300042659 Bacteria 27331
74 Ga0123353_10000519 3300010167 Bacteria 47639
75 Ga0466710_118073 3300042613 Bacteria 32374
76 Ga0466726_312095 3300042619 Bacteria 3512
77 Ga0466704_026564 3300042643 Bacteria 41642
78 Ga0466725_041394 3300042654 Bacteria 1426
79 Ga0160459_103166 3300012831 Unclassified 2431
80 Ga0466657_343428 3300042582 Bacteria 4279
81 Ga0466691_030876 3300042593 Bacteria 9288
82 JGI24699J35502_10974689 3300002509 Bacteria 1249
83 CVPL005W_1001625 3300002934 Bacteria 5568
84 Ga0102740_1000232 3300007140 Bacteria 16196
85 Ga0102737_1011350 3300007142 Bacteria 1478
86 Ga0103264_1000737 3300007188 Bacteria 15353
87 Ga0123357_10000050 3300009784 Bacteria 93540
88 Ga0466707_267550 3300042601 Bacteria 3625
89 Ga0466717_162124 3300042604 Bacteria 1176
90 Ga0466721_059157 3300042608 Bacteria 2433
91 Ga0123356_10013535 3300010049 Unclassified 7869
92 Ga0160471_101702 3300012812 Bacteria 4099
93 Ga0466710_141802 3300042613 Bacteria 2314
94 Ga0466715_523004 3300042616 Bacteria 4734
95 Ga0466726_237804 3300042619 Bacteria 14855
96 Ga0466728_060718 3300042620 Bacteria 51497
97 Ga0466729_228872 3300042621 Bacteria 6116
98 Ga0466702_373908 3300042635 Bacteria 8072
99 Ga0466725_138046 3300042654 Bacteria 19951
100 Ga0466657_370980 3300042582 Bacteria 5925
101 Ga0466696_350131 3300042596 Bacteria 3436
102 JGI24702J35022_10011013 3300002462 Bacteria 5042
103 CVPL010W_10000454 3300002931 Bacteria 42797
104 CVPL010W_10005886 3300002931 Bacteria 13401
105 Ga0103264_1000047 3300007188 Bacteria 127089
106 Ga0103264_1001108 3300007188 Bacteria 12008
107 Ga0123353_10025510 3300010167 Bacteria 9007
108 Ga0466710_201904 3300042613 Bacteria 119538
109 Ga0466718_033841 3300042617 Bacteria 5173
110 Ga0466708_088629 3300042652 Bacteria 6080
111 Ga0466708_266701 3300042652 Bacteria 15517
112 Ga0466692_091358 3300042591 Bacteria 11125
113 Ga0466701_005790 3300042598 Bacteria 71240
114 Ga0072941_1326033 3300005201 Bacteria 2098
115 Ga0103266_1000558 3300007067 Bacteria 7453
116 Ga0103260_1000534 3300007139 Bacteria 11157
117 Ga0102738_1001390 3300007141 Bacteria 3770
118 Ga0103264_1000411 3300007188 Bacteria 22810
119 Ga0103264_1001079 3300007188 Bacteria 12144
120 Ga0123357_10001794 3300009784 Bacteria 23240

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042590 Ga0466690_124436 Ga0466690_124436_147_680 153
2 3300042648 Ga0466709_073297 Ga0466709_073297_41744_42277 157
3 3300007067 Ga0103266_1000558 Ga0103266_10005584 164
4 3300007141 Ga0102738_1001390 Ga0102738_10013904 164
5 3300042602 Ga0466713_138497 Ga0466713_138497_27281_27814 165
6 3300005083 Ga0068305_10452970 Ga0068305_104529707 166
7 3300042616 Ga0466715_026089 Ga0466715_026089_231_764 166
8 3300042652 Ga0466708_403743 Ga0466708_403743_4083_4640 166
9 3300007052 Ga0102736_1001599 Ga0102736_10015993 167
10 3300042616 Ga0466715_523004 Ga0466715_523004_4176_4709 169
11 3300042611 Ga0466697_156548 Ga0466697_156548_541_1071 171
12 3300042623 Ga0466734_059542 Ga0466734_059542_2859_3398 172
13 3300042654 Ga0466725_041394 Ga0466725_041394_78_617 172
14 3300042617 Ga0466718_033841 Ga0466718_033841_3452_4015 174
15 3300042592 Ga0466693_316890 Ga0466693_316890_3571_4101 176
16 3300042594 Ga0466694_107424 Ga0466694_107424_1707_2237 176
17 3300042608 Ga0466721_059157 Ga0466721_059157_1554_2084 176
18 3300042611 Ga0466697_252057 Ga0466697_252057_550_1080 176
19 3300042623 Ga0466734_136333 Ga0466734_136333_498_1028 176
20 3300042623 Ga0466734_173135 Ga0466734_173135_2142_2672 176
21 3300042654 Ga0466725_115558 Ga0466725_115558_603_1133 176
22 3300005201 Ga0072941_1326033 Ga0072941_13260332 177
23 3300010167 Ga0123353_12037254 Ga0123353_120372541 177
24 3300042582 Ga0466657_269966 Ga0466657_269966_29783_30316 177
25 3300042582 Ga0466657_343428 Ga0466657_343428_1473_2006 177
26 3300042591 Ga0466692_091358 Ga0466692_091358_3940_4473 177
27 3300042593 Ga0466691_030876 Ga0466691_030876_4616_5149 177
28 3300042601 Ga0466707_251230 Ga0466707_251230_3055_3588 177
29 3300042601 Ga0466707_267550 Ga0466707_267550_3057_3590 177
30 3300042604 Ga0466717_044506 Ga0466717_044506_2537_3070 177
31 3300042606 Ga0466719_038470 Ga0466719_038470_3200_3733 177
32 3300042606 Ga0466719_124770 Ga0466719_124770_16054_16587 177
33 3300042606 Ga0466719_318030 Ga0466719_318030_4354_4887 177
34 3300042609 Ga0466722_117171 Ga0466722_117171_4153_4686 177
35 3300042612 Ga0466705_118406 Ga0466705_118406_3347_3880 177
36 3300042613 Ga0466710_201904 Ga0466710_201904_78560_79093 177
37 3300042616 Ga0466715_489248 Ga0466715_489248_4135_4668 177
38 3300042618 Ga0466723_004783 Ga0466723_004783_45186_45719 177
39 3300042619 Ga0466726_036682 Ga0466726_036682_5418_5951 177
40 3300042620 Ga0466728_060718 Ga0466728_060718_35006_35539 177
41 3300042621 Ga0466729_228872 Ga0466729_228872_734_1267 177
42 3300042624 Ga0466735_073173 Ga0466735_073173_2963_3496 177
43 3300042636 Ga0466703_038344 Ga0466703_038344_5620_6153 177
44 3300042636 Ga0466703_195519 Ga0466703_195519_68825_69358 177
45 3300042636 Ga0466703_408887 Ga0466703_408887_259_792 177
46 3300042643 Ga0466704_026564 Ga0466704_026564_21583_22116 177
47 3300042652 Ga0466708_088629 Ga0466708_088629_3050_3583 177
48 3300042652 Ga0466708_266701 Ga0466708_266701_13329_13862 177
49 3300042652 Ga0466708_334281 Ga0466708_334281_23805_24338 177
50 3300042654 Ga0466725_074169 Ga0466725_074169_60220_60753 177
51 3300042655 Ga0466727_036206 Ga0466727_036206_14539_15072 177
52 iso_pr_bacteria 2820084079 2820085491 177
53 iso_pr_bacteria 2820086750 2820088280 177
54 iso_pr_bacteria 2820123897 2820126092 177
55 iso_pr_bacteria 2820132692 2820132928 177
56 3300005071 Ga0068302_10159304 Ga0068302_101593046 178
57 3300005201 Ga0072941_1096165 Ga0072941_10961658 178
58 3300009784 Ga0123357_10000050 Ga0123357_1000005057 178
59 3300010049 Ga0123356_10013535 Ga0123356_100135354 178
60 3300010167 Ga0123353_10000519 Ga0123353_1000051941 178
61 3300042609 Ga0466722_048156 Ga0466722_048156_2294_2830 178
62 3300042619 Ga0466726_237804 Ga0466726_237804_5892_6428 178
63 3300042619 Ga0466726_312095 Ga0466726_312095_1828_2364 178
64 3300042655 Ga0466727_259800 Ga0466727_259800_7353_7889 178
65 iso_pr_bacteria 2891720358 2891722753 178
66 3300007129 Ga0102734_1002104 Ga0102734_10021046 179
67 3300042598 Ga0466701_005790 Ga0466701_005790_56882_57421 179
68 3300042613 Ga0466710_141802 Ga0466710_141802_1522_2061 179
69 3300042617 Ga0466718_102895 Ga0466718_102895_6740_7279 179
70 3300042625 Ga0466730_079112 Ga0466730_079112_364_903 179
71 iso_pr_bacteria 2603880165 2606013794 179
72 iso_pr_bacteria 2820047982 2820048771 179
73 iso_pr_bacteria 2820050117 2820051114 179
74 iso_pr_bacteria 2855798354 2855798779 179
75 iso_pr_bacteria 3003869270 3003872624 179
76 iso_pr_bacteria 3003878002 3003881641 179
77 3300002509 JGI24699J35502_10974689 JGI24699J35502_109746892 180
78 3300002931 CVPL010W_10005886 CVPL010W_100058862 180
79 3300002931 CVPL010W_10011897 CVPL010W_1001189715 180
80 3300005201 Ga0072941_1734208 Ga0072941_17342081 180
81 3300007095 Ga0102739_1000307 Ga0102739_10003076 180
82 3300007142 Ga0102737_1011350 Ga0102737_10113502 180
83 3300007188 Ga0103264_1000737 Ga0103264_100073714 180
84 3300042596 Ga0466696_350131 Ga0466696_350131_2613_3155 180
85 3300042635 Ga0466702_373908 Ga0466702_373908_724_1266 180
86 3300042654 Ga0466725_216650 Ga0466725_216650_463_1005 180
87 iso_pr_bacteria 2597489944 2598058815 180
88 iso_pr_bacteria 8023724303 8023728002 180
89 iso_pr_bacteria 8023747282 8023751107 180
90 iso_pr_bacteria 8023752828 8023756576 180
91 iso_pr_bacteria 8023757577 8023761276 180
92 iso_pr_bacteria 8023764196 8023769731 180
93 iso_pr_bacteria 8024001094 8024003836 180
94 iso_pr_bacteria 8024014383 8024017003 180
95 iso_pr_bacteria 8024019580 8024019703 180
96 iso_pr_bacteria 8024025509 8024025590 180
97 iso_pr_bacteria 8024037630 8024040441 180
98 iso_pr_bacteria 8024044713 8024047436 180
99 iso_pr_bacteria 8025650824 8025653836 180
100 iso_pr_bacteria 8025658853 8025659033 180
101 iso_pr_bacteria 8025666332 8025669074 180
102 iso_pr_bacteria 8025671076 8025673851 180
103 iso_pr_bacteria 8025678175 8025680782 180
104 iso_pr_bacteria 8025685901 8025686077 180
105 iso_pr_bacteria 8025694439 8025697485 180
106 iso_pr_bacteria 8025701579 8025706060 180
107 iso_pr_bacteria 8025708040 8025710960 180
108 iso_pr_bacteria 8025716094 8025716263 180
109 iso_pr_bacteria 8025723035 8025725611 180
110 iso_pr_bacteria 8025728939 8025731951 180
111 iso_pr_bacteria 8025735396 8025736270 180
112 iso_pr_bacteria 8025740903 8025743635 180
113 iso_pr_bacteria 8025747911 8025750798 180
114 iso_pr_bacteria 8025756023 8025758910 180
115 iso_pr_bacteria 8069748016 8069749178 180
116 iso_pr_bacteria 8069755105 8069757992 180
117 iso_pr_bacteria 8069763219 8069765951 180
118 iso_pr_bacteria 8069770227 8069774052 180
119 iso_pr_bacteria 8069775773 8069779521 180
120 iso_pr_bacteria 8078130113 8078132865 180
121 iso_pr_bacteria 8101951471 8101954287 180
122 iso_pr_bacteria 8101960468 8101963241 180
123 iso_pr_bacteria 8101967387 8101970157 180
124 iso_pr_bacteria 8101974301 8101977078 180
125 iso_pr_bacteria 8101981714 8101984463 180
126 iso_pr_bacteria 8101988189 8101990997 180
127 iso_pr_bacteria 8101994502 8101994670 180
128 iso_pr_bacteria 8102001125 8102003735 180
129 iso_pr_bacteria 8102007614 8102010412 180
130 iso_pr_bacteria 8102014801 8102017587 180
131 iso_pr_bacteria 8102020860 8102021033 180
132 iso_pr_bacteria 8102026984 8102029851 180
133 iso_pr_bacteria 8102033761 8102033867 180
134 iso_pr_bacteria 8102041249 8102043956 180
135 iso_pr_bacteria 8102047609 8102047660 180
136 iso_pr_bacteria 8102054868 8102057555 180
137 iso_pr_bacteria 8102060671 8102063647 180
138 iso_pr_bacteria 8102067727 8102070503 180
139 iso_pr_bacteria 8102074813 8102077636 180
140 iso_pr_bacteria 8102081745 8102081804 180
141 iso_pr_bacteria 8102087471 8102090191 180
142 iso_pr_bacteria 8102094248 8102094415 180
143 iso_pr_bacteria 8102102351 8102105080 180
144 iso_pr_bacteria 8102109360 8102112152 180
145 iso_pr_bacteria 8102117041 8102119769 180
146 iso_pr_bacteria 8102124461 8102124517 180
147 iso_pr_bacteria 8102131453 8102133490 180
148 iso_pr_bacteria 8102138357 8102141117 180
149 iso_pr_bacteria 8102145433 8102149132 180
150 iso_pr_bacteria 8102152052 8102157587 180
151 iso_pr_bacteria 8102161003 8102167700 180
152 iso_pr_bacteria 8102169119 8102169993 180
153 iso_pr_bacteria 8102174626 8102177638 180
154 iso_pr_bacteria 8102181083 8102183659 180
155 iso_pr_bacteria 8102186987 8102187156 180
156 iso_pr_bacteria 8102193924 8102196842 180
157 iso_pr_bacteria 8102201977 8102206458 180
158 iso_pr_bacteria 8102208438 8102211450 180
159 iso_pr_bacteria 8102216467 8102219513 180
160 iso_pr_bacteria 8102223607 8102226382 180
161 iso_pr_bacteria 8102230706 8102230882 180
162 iso_pr_bacteria 8102239244 8102241849 180
163 iso_pr_bacteria 8102246966 8102249708 180
164 iso_pr_bacteria 8102251710 8102251890 180
165 iso_pr_bacteria 8102264549 8102267398 180
166 iso_pr_bacteria 8102271933 8102271983 180
167 iso_pr_bacteria 8102279326 8102282118 180
168 iso_pr_bacteria 8102286609 8102286704 180
169 iso_pr_bacteria 8102312426 8102315011 180
170 3300002934 CVPL005W_1001625 CVPL005W_10016252 181
171 3300012805 Ga0160464_100021 Ga0160464_100021167 181
172 3300012812 Ga0160471_101702 Ga0160471_1017022 181
173 3300012825 Ga0160441_100002 Ga0160441_100002802 181
174 3300012831 Ga0160459_103166 Ga0160459_1031664 181
175 3300012858 Ga0160457_1000405 Ga0160457_100040518 181
176 iso_pr_bacteria 2820152154 2820154483 181
177 3300007188 Ga0103264_1000047 Ga0103264_1000047105 182
178 iso_pr_bacteria 2603880170 2606028909 182
179 iso_pr_bacteria 2687453742 2689988326 182
180 iso_pr_bacteria 2687453753 2690037335 182
181 3300002931 CVPL010W_10021137 CVPL010W_100211374 183
182 3300002934 CVPL005W_1000361 CVPL005W_100036120 183
183 3300002938 CVPL005L_10002296 CVPL005L_1000229623 183
184 3300007083 Ga0103261_1007382 Ga0103261_10073822 183
185 3300007139 Ga0103260_1031882 Ga0103260_10318822 183
186 3300007140 Ga0102740_1000232 Ga0102740_100023212 183
187 3300007142 Ga0102737_1002402 Ga0102737_10024026 183
188 3300007142 Ga0102737_1003130 Ga0102737_10031302 183
189 3300007188 Ga0103264_1000411 Ga0103264_100041115 183
190 3300007188 Ga0103264_1000547 Ga0103264_100054724 183
191 3300007188 Ga0103264_1000943 Ga0103264_100094312 183
192 3300007068 Ga0103265_1007061 Ga0103265_10070611 184
193 3300007188 Ga0103264_1001079 Ga0103264_100107911 184
194 3300042582 Ga0466657_005142 Ga0466657_005142_5177_5731 184
195 3300042582 Ga0466657_370980 Ga0466657_370980_2698_3252 184
196 3300042600 Ga0466700_428137 Ga0466700_428137_588_1142 184
197 3300042611 Ga0466697_166925 Ga0466697_166925_965_1519 184
198 3300042613 Ga0466710_118073 Ga0466710_118073_21942_22496 184
199 3300042623 Ga0466734_143966 Ga0466734_143966_3102_3656 184
200 3300042654 Ga0466725_138046 Ga0466725_138046_11537_12091 184
201 3300042659 Ga0466733_040157 Ga0466733_040157_21452_22006 184
202 iso_pr_bacteria 2820089333 2820091167 184
203 iso_pr_bacteria 2820121232 2820122649 184
204 3300007139 Ga0103260_1000534 Ga0103260_10005345 185
205 3300007142 Ga0102737_1002361 Ga0102737_10023614 185
206 3300009784 Ga0123357_10001794 Ga0123357_100017947 185
207 3300010049 Ga0123356_10109662 Ga0123356_101096624 185
208 3300010049 Ga0123356_10573371 Ga0123356_105733712 185
209 3300010167 Ga0123353_10025510 Ga0123353_100255103 185
210 3300002931 CVPL010W_10000454 CVPL010W_1000045436 186
211 3300007188 Ga0103264_1001108 Ga0103264_100110811 187
212 3300042604 Ga0466717_162124 Ga0466717_162124_559_1122 187
213 3300042604 Ga0466717_205487 Ga0466717_205487_199_762 187
214 3300042649 Ga0466724_33963 Ga0466724_33963_64_627 187
215 iso_pr_bacteria 2820042117 2820044596 187
216 iso_pr_bacteria 2820065746 2820067148 187
217 3300002462 JGI24702J35022_10011013 JGI24702J35022_100110133 188
218 3300002504 JGI24705J35276_12140654 JGI24705J35276_121406541 188
219 3300010882 Ga0123354_10221514 Ga0123354_102215142 188
220 iso_pr_bacteria 2603880172 2606033258 188
221 3300002931 CVPL010W_10005572 CVPL010W_100055728 189
222 3300007052 Ga0102736_1003202 Ga0102736_10032024 189
223 3300007192 Ga0103268_1000218 Ga0103268_100021810 189

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00213 OSCP ATP synthase delta (OSCP) subunit 7 186 0.94

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.6 0.62 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.