- ArthroVerse

Protein Family IF01897

Metagenome Isolate

134 Members

65 Samples

115 Scaffolds

147.42 Avg Length

🧬 Representative Sequence

ID: 3300007192|Ga0103268_1000008|Ga0103268_100000812
Length: 148 aa
Sequence: VSLSDKYWMQLALDEANKALYVKEVPIGAVVVSNDKLIGRGYNFTEHLNDVTAHAEMQAITAASNYLGGKYLHKCTLYVTIEPCVMCAGALYWTQIDRIVFGATDPKRGAGRFENVYHPKTIIESGLLAEESLKMLKTFFQSVRNNK*

📊 Sample Types

Isolate 14.2%

Metagenome 85.8%

MAG 0.0%

Metatranscriptome 0.0%

Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 32.8%

Kalotermitidae 18.8%

Unclassified 10.9%

Blaberidae 7.8%

Blattellidae 4.7%

Formicidae 4.7%

Passalidae 3.1%

Rhinotermitidae 3.1%

Termopsidae 3.1%

Pyroglyphidae 1.6%

Harpacticidae 1.6%

Hodotermitidae 1.6%

Delphacidae 1.6%

Kiwaidae 1.6%

Corydiidae 1.6%

Apidae 1.6%

🌳 Taxonomy

Archaea 0

Bacteria 122

Eukaryota 0

Viruses 0

Unclassified 12

🗂️ Samples

#	Sample ID	Description	Type	Taxa Family
1	2225789004	Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL)	Metagenome	Passalidae
2	3000153175	Cardinium endosymbiont of Dermatophagoides farinae UMMZ BMOC 05-0812-001	Isolate	Pyroglyphidae
3	3002026852	Blattabacterium cuenoti BEYBkur	Isolate	Blattellidae
4	3300009784	Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4	Metagenome	Termitidae
5	2820735654	Unclassified Bacteroidetes Th196P4bin9	Isolate	Unclassified
6	2021593000	Sample 264	Metagenome	Harpacticidae
7	3300042582	Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373	Metagenome	Termitidae
8	3300042594	Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324	Metagenome	Termitidae
9	3300042612	Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485	Metagenome	Kalotermitidae
10	3300042617	Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494	Metagenome	Termitidae
11	3300000062	Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL)	Metagenome	Passalidae
12	3300042591	Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509	Metagenome	Rhinotermitidae
13	3300042597	Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330	Metagenome	Termitidae
14	3300042599	Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464	Metagenome	Hodotermitidae
15	3300042614	Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344	Metagenome	Termitidae
16	3300042652	Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510	Metagenome	Kalotermitidae
17	3300042654	Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449	Metagenome	Termitidae
18	3000336795	Cardinium endosymbiont of Sogatella furcifera cSfur	Isolate	Delphacidae
19	3300005201	Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome	Metagenome
20	3300007080	Ant gut microbial communities from Cephalotes clypeatus, Brazil	Metagenome	Formicidae
21	3300007190	Ant gut microbial communities from Cephalotes umbraculatus, Peru	Metagenome	Formicidae
22	3300007192	Ant gut microbial communities from Cephalotes persimplex, Brazil	Metagenome	Formicidae
23	3300010049	Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3	Metagenome	Termitidae
24	3300010167	Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3	Metagenome	Termitidae
25	3300010882	Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4	Metagenome	Termitidae
26	2820783511	Unclassified Bacteroidetes Emb289P3bin108	Isolate	Unclassified
27	3300042596	Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408	Metagenome	Kalotermitidae
28	3300042605	Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351	Metagenome	Kalotermitidae
29	3300042621	Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511	Metagenome	Rhinotermitidae
30	3300042622	Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319	Metagenome	Termitidae
31	3300042643	Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481	Metagenome	Kalotermitidae
32	3300042648	Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174	Metagenome	Kalotermitidae
33	3300042656	Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a	Metagenome	Termitidae
34	3001995318	Blattabacterium cuenoti DYAKIkur	Isolate	Blattellidae
35	2820753519	Unclassified Bacteroidetes Nc150P4bin20	Isolate	Unclassified
36	3300042590	Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175	Metagenome	Kalotermitidae
37	3300042593	Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354	Metagenome	Kalotermitidae
38	3300042606	Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470	Metagenome	Kalotermitidae
39	3300042655	Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454	Metagenome	Termopsidae
40	3300002504	Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4	Metagenome	Termitidae
41	2820792843	Unclassified Bacteroidetes Cu122P3bin1	Isolate	Unclassified
42	2820740053	Unclassified Bacteroidetes Th196P3bin81	Isolate	Unclassified
43	3300042624	Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50	Metagenome	Termopsidae
44	3002007112	Blattabacterium cuenoti CYRTOsp	Isolate	Blaberidae
45	3002008367	Blattabacterium cuenoti PARANAUcir	Isolate	Blaberidae
46	3002030550	Blattabacterium cuenoti NEOLAXmac	Isolate	Blaberidae
47	3300002834	Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4	Metagenome	Termitidae
48	3300013007	Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts	Metagenome	Kiwaidae
49	2820795054	Unclassified Bacteroidetes Cu122P1bin21	Isolate	Unclassified
50	2820755292	Unclassified Bacteroidetes Nc150P3bin3	Isolate	Unclassified
51	3300042620	Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453	Metagenome	Kalotermitidae
52	3002006476	Blattabacterium cuenoti GYNAcap	Isolate	Blaberidae
53	3002032411	Blattabacterium cuenoti POLYPHAGsp	Isolate	Corydiidae
54	2518645548	Blattabacterium sp. (Blaberus giganteus)	Isolate	Blaberidae
55	3300042595	Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329	Metagenome	Termitidae
56	3300042598	Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382	Metagenome	Termitidae
57	3300042604	Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323	Metagenome	Termitidae
58	3300042611	Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372	Metagenome	Termitidae
59	3300042613	Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357	Metagenome	Termitidae
60	3300042615	Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353	Metagenome	Kalotermitidae
61	3300042636	Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477	Metagenome	Kalotermitidae
62	3300042649	Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381	Metagenome	Termitidae
63	8065497608	Tellurirhabdus bombi IE-0392	Isolate	Apidae
64	3002002726	Blattabacterium cuenoti PARATEMsp	Isolate	Blattellidae
65	3300002462	Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4	Metagenome	Termitidae

🔗 Scaffolds

#	Scaffold	Sample	Taxonomy	Length
1	Ga0123357_10108710	3300009784	Bacteria	3545
2	Ga0123356_10001294	3300010049	Bacteria	27732
3	Ga0123356_11934178	3300010049	Bacteria	735
4	Ga0123353_10766555	3300010167	Unclassified	1339
5	Ga0466710_167734	3300042613	Bacteria	4720
6	Ga0466728_055177	3300042620	Bacteria	5891
7	Ga0466728_096916	3300042620	Bacteria	28105
8	Ga0466657_190693	3300042582	Bacteria	9833
9	Ga0466731_098876	3300042622	Bacteria	4475
10	Ga0466703_337819	3300042636	Unclassified	2534
11	Ga0466709_023140	3300042648	Bacteria	47310
12	Ga0466724_42035	3300042649	Bacteria	2400
13	JGI24702J35022_10017178	3300002462	Bacteria	3958
14	Ga0072941_1187313	3300005201	Bacteria	7613
15	Ga0072941_1421710	3300005201	Bacteria	723
16	Ga0102735_1000443	3300007080	Bacteria	8912
17	Ga0466732_367694	3300042656	Unclassified	1062
18	Ga0123353_10000901	3300010167	Bacteria	36273
19	Ga0123353_11237559	3300010167	Bacteria	976
20	Ga0123354_10217340	3300010882	Bacteria	2043
21	Ga0466701_101347	3300042598	Bacteria	1566
22	Ga0466694_133524	3300042594	Bacteria	2511
23	Ga0466703_192469	3300042636	Bacteria	3052
24	TM1208_contig15477	2021593000	Bacteria	1614
25	JGI24705J35276_12231915	3300002504	Bacteria	4112
26	Ga0123357_10027856	3300009784	Bacteria	7642
27	Ga0123356_12712396	3300010049	Bacteria	620
28	Ga0466728_415914	3300042620	Bacteria	2412
29	Ga0466719_235977	3300042606	Bacteria	1049
30	Ga0466690_158053	3300042590	Bacteria	7263
31	Ga0466694_296117	3300042594	Bacteria	20379
32	Ga0466696_149892	3300042596	Bacteria	24469
33	Ga0466696_241955	3300042596	Bacteria	2123
34	Ga0466696_501894	3300042596	Bacteria	5455
35	Ga0466703_091002	3300042636	Bacteria	7085
36	Ga0466725_415538	3300042654	Bacteria	1521
37	TM1208_contig13557	2021593000	Bacteria	1334
38	2227302182	2225789004	Unclassified	1220
39	JGI24702J35022_10099998	3300002462	Unclassified	1587
40	Ga0103268_1000008	3300007192	Bacteria	68846
41	Ga0466732_029815	3300042656	Bacteria	2721
42	Ga0123356_10006824	3300010049	Bacteria	11484
43	Ga0123356_10016370	3300010049	Unclassified	7076
44	Ga0123353_10911799	3300010167	Bacteria	1195
45	Ga0123354_10030897	3300010882	Bacteria	8407
46	Ga0123354_10045655	3300010882	Bacteria	6702
47	Ga0123354_10995050	3300010882	Bacteria	540
48	Ga0466706_203208	3300042599	Bacteria	47004
49	Ga0466716_414057	3300042605	Bacteria	3187
50	Ga0466719_417924	3300042606	Bacteria	1533
51	Ga0466735_092502	3300042624	Bacteria	1941
52	Ga0466724_50204	3300042649	Bacteria	2296
53	Ga0466708_194630	3300042652	Bacteria	8837
54	JGI24702J35022_10000345	3300002462	Bacteria	27477
55	Ga0123356_10959242	3300010049	Bacteria	1026
56	Ga0123356_12232371	3300010049	Bacteria	684
57	Ga0123353_10001777	3300010167	Bacteria	26482
58	Ga0123353_10001838	3300010167	Bacteria	26117
59	Ga0123353_10196433	3300010167	Unclassified	3180
60	Ga0123354_10000449	3300010882	Bacteria	40514
61	Ga0123354_10027242	3300010882	Bacteria	9005
62	Ga0466712_223461	3300042614	Unclassified	2673
63	Ga0466711_113876	3300042615	Bacteria	14801
64	Ga0466701_060966	3300042598	Bacteria	35648
65	Ga0466719_267430	3300042606	Bacteria	1223
66	Ga0466695_268050	3300042595	Bacteria	2535
67	Ga0466731_192221	3300042622	Bacteria	60315
68	Ga0466735_162257	3300042624	Bacteria	4946
69	Ga0466704_298510	3300042643	Bacteria	23069
70	IMNBL1DRAFT_c0011647	3300000062	Bacteria	4091
71	JGI24702J35022_10000747	3300002462	Unclassified	20049
72	Ga0103267_1000146	3300007190	Bacteria	45071
73	Ga0466697_222583	3300042611	Bacteria	2396
74	Ga0466705_043883	3300042612	Bacteria	44680
75	Ga0466732_223985	3300042656	Bacteria	3571
76	Ga0123353_10081391	3300010167	Bacteria	5207
77	Ga0123353_10270818	3300010167	Bacteria	2616
78	Ga0123354_10009178	3300010882	Bacteria	15112
79	Ga0466710_013283	3300042613	Bacteria	2604
80	Ga0466729_097581	3300042621	Bacteria	10218
81	Ga0466701_067160	3300042598	Bacteria	1221
82	Ga0466719_547412	3300042606	Bacteria	1333
83	Ga0466699_179608	3300042597	Bacteria	1021
84	Ga0466701_010815	3300042598	Bacteria	22674
85	Ga0466708_059801	3300042652	Bacteria	3242
86	Ga0466708_114972	3300042652	Bacteria	11833
87	Ga0466727_307411	3300042655	Bacteria	80907
88	JGI24702J35022_10019636	3300002462	Bacteria	3675
89	JGI24696J40584_12289851	3300002834	Bacteria	516
90	Ga0123356_10159358	3300010049	Bacteria	2252
91	Ga0123356_10283595	3300010049	Bacteria	1753
92	Ga0123353_10119280	3300010167	Bacteria	4243
93	Ga0466718_039509	3300042617	Bacteria	3250
94	Ga0466717_046953	3300042604	Bacteria	1391
95	Ga0466717_229031	3300042604	Unclassified	1285
96	Ga0466697_015249	3300042611	Bacteria	2226
97	Ga0157631_138106	3300013007	Bacteria	2287
98	Ga0466657_229008	3300042582	Bacteria	97233
99	Ga0466690_244227	3300042590	Bacteria	8579
100	Ga0466704_484735	3300042643	Bacteria	1419
101	IMNBL1DRAFT_c0014499	3300000062	Bacteria	3475
102	Ga0466697_197696	3300042611	Bacteria	22639
103	Ga0123353_10723922	3300010167	Bacteria	1391
104	Ga0123354_10002407	3300010882	Bacteria	24661
105	Ga0466710_040076	3300042613	Bacteria	1387
106	Ga0466692_046415	3300042591	Bacteria	1829
107	Ga0466691_057313	3300042593	Bacteria	7402
108	Ga0466694_341624	3300042594	Bacteria	5131
109	Ga0466695_176639	3300042595	Bacteria	1309
110	Ga0466699_386489	3300042597	Bacteria	2910
111	Ga0466703_403613	3300042636	Bacteria	4404
112	Ga0466704_126383	3300042643	Unclassified	1899
113	Ga0466708_232400	3300042652	Unclassified	4239
114	JGI24696J40584_12828876	3300002834	Bacteria	925
115	Ga0103267_1000009	3300007190	Bacteria	74171

📋 Family Sequences

#	Sample	Scaffold	Protein	Length (aa)
1	3300042612	Ga0466705_043883	Ga0466705_043883_20394_20807	137
2	3300042621	Ga0466729_097581	Ga0466729_097581_3748_4161	137
3	3300010882	Ga0123354_10000449	Ga0123354_100004492	139
4	3300042596	Ga0466696_149892	Ga0466696_149892_23226_23654	142
5	3300042595	Ga0466695_176639	Ga0466695_176639_763_1194	143
6	iso_pr_bacteria	2518645548	2518801612	143
7	3300042606	Ga0466719_547412	Ga0466719_547412_203_637	144
8	3300042652	Ga0466708_114972	Ga0466708_114972_7518_7952	144
9	2225789004	2227302182	2227751987	145
10	3300002834	JGI24696J40584_12289851	JGI24696J40584_122898511	145
11	3300007190	Ga0103267_1000009	Ga0103267_100000914	145
12	3300010049	Ga0123356_10159358	Ga0123356_101593583	145
13	3300042582	Ga0466657_190693	Ga0466657_190693_1798_2235	145
14	3300042590	Ga0466690_244227	Ga0466690_244227_4781_5218	145
15	3300042591	Ga0466692_046415	Ga0466692_046415_948_1385	145
16	3300042594	Ga0466694_133524	Ga0466694_133524_1709_2146	145
17	3300042594	Ga0466694_341624	Ga0466694_341624_4531_4968	145
18	3300042596	Ga0466696_241955	Ga0466696_241955_1259_1696	145
19	3300042596	Ga0466696_501894	Ga0466696_501894_324_761	145
20	3300042598	Ga0466701_067160	Ga0466701_067160_26_463	145
21	3300042611	Ga0466697_197696	Ga0466697_197696_2066_2503	145
22	3300042615	Ga0466711_113876	Ga0466711_113876_8223_8660	145
23	3300042620	Ga0466728_055177	Ga0466728_055177_2802_3239	145
24	3300042620	Ga0466728_415914	Ga0466728_415914_1157_1594	145
25	3300042624	Ga0466735_162257	Ga0466735_162257_1139_1576	145
26	3300042643	Ga0466704_126383	Ga0466704_126383_66_503	145
27	3300042643	Ga0466704_484735	Ga0466704_484735_137_574	145
28	3300042648	Ga0466709_023140	Ga0466709_023140_46601_47038	145
29	iso_pr_bacteria	2820740053	2820740374	145
30	iso_pr_bacteria	2820783511	2820785114	145
31	iso_pr_bacteria	3002007112	3002007257	145
32	iso_pr_bacteria	8065497608	8065498634	145
33	3300000062	IMNBL1DRAFT_c0011647	IMNBL1DRAFT_00116475	146
34	3300002462	JGI24702J35022_10000747	JGI24702J35022_1000074716	146
35	3300010049	Ga0123356_10016370	Ga0123356_100163703	146
36	3300010049	Ga0123356_10283595	Ga0123356_102835951	146
37	3300010049	Ga0123356_10959242	Ga0123356_109592422	146
38	3300010167	Ga0123353_10001777	Ga0123353_1000177711	146
39	3300042595	Ga0466695_268050	Ga0466695_268050_1766_2206	146
40	3300042597	Ga0466699_179608	Ga0466699_179608_377_817	146
41	3300042597	Ga0466699_386489	Ga0466699_386489_1314_1754	146
42	3300042598	Ga0466701_010815	Ga0466701_010815_10762_11202	146
43	3300042604	Ga0466717_229031	Ga0466717_229031_673_1113	146
44	3300042605	Ga0466716_414057	Ga0466716_414057_1455_1895	146
45	3300042606	Ga0466719_417924	Ga0466719_417924_76_516	146
46	3300042611	Ga0466697_015249	Ga0466697_015249_1301_1741	146
47	3300042611	Ga0466697_222583	Ga0466697_222583_1097_1537	146
48	3300042613	Ga0466710_013283	Ga0466710_013283_1809_2249	146
49	3300042613	Ga0466710_167734	Ga0466710_167734_1329_1769	146
50	3300042614	Ga0466712_223461	Ga0466712_223461_1668_2108	146
51	3300042617	Ga0466718_039509	Ga0466718_039509_922_1362	146
52	3300042620	Ga0466728_096916	Ga0466728_096916_1879_2319	146
53	3300042622	Ga0466731_098876	Ga0466731_098876_3415_3855	146
54	3300042636	Ga0466703_192469	Ga0466703_192469_919_1359	146
55	3300042636	Ga0466703_337819	Ga0466703_337819_677_1117	146
56	3300042636	Ga0466703_403613	Ga0466703_403613_1822_2262	146
57	3300042643	Ga0466704_298510	Ga0466704_298510_8622_9062	146
58	3300042656	Ga0466732_223985	Ga0466732_223985_2744_3184	146
59	iso_pr_bacteria	2820753519	2820754830	146
60	iso_pr_bacteria	2820755292	2820756948	146
61	iso_pr_bacteria	2820792843	2820794456	146
62	iso_pr_bacteria	2820795054	2820796641	146
63	3300002462	JGI24702J35022_10099998	JGI24702J35022_100999982	147
64	3300002834	JGI24696J40584_12828876	JGI24696J40584_128288762	147
65	3300005201	Ga0072941_1421710	Ga0072941_14217101	147
66	3300009784	Ga0123357_10108710	Ga0123357_101087104	147
67	3300010049	Ga0123356_10006824	Ga0123356_100068244	147
68	3300010049	Ga0123356_11934178	Ga0123356_119341781	147
69	3300010049	Ga0123356_12232371	Ga0123356_122323712	147
70	3300010049	Ga0123356_12712396	Ga0123356_127123961	147
71	3300010167	Ga0123353_10000901	Ga0123353_1000090121	147
72	3300010167	Ga0123353_10119280	Ga0123353_101192802	147
73	3300010167	Ga0123353_10766555	Ga0123353_107665552	147
74	3300010167	Ga0123353_10911799	Ga0123353_109117992	147
75	3300010882	Ga0123354_10027242	Ga0123354_100272427	147
76	3300010882	Ga0123354_10995050	Ga0123354_109950501	147
77	3300042582	Ga0466657_229008	Ga0466657_229008_14843_15286	147
78	3300042590	Ga0466690_158053	Ga0466690_158053_3185_3628	147
79	3300042593	Ga0466691_057313	Ga0466691_057313_2374_2817	147
80	3300042594	Ga0466694_296117	Ga0466694_296117_3631_4074	147
81	3300042598	Ga0466701_060966	Ga0466701_060966_556_999	147
82	3300042613	Ga0466710_040076	Ga0466710_040076_857_1300	147
83	3300042622	Ga0466731_192221	Ga0466731_192221_42826_43269	147
84	3300042636	Ga0466703_091002	Ga0466703_091002_3583_4026	147
85	3300042652	Ga0466708_059801	Ga0466708_059801_2766_3209	147
86	3300042652	Ga0466708_194630	Ga0466708_194630_833_1276	147
87	3300042652	Ga0466708_232400	Ga0466708_232400_3277_3720	147
88	3300042655	Ga0466727_307411	Ga0466727_307411_20067_20510	147
89	3300042656	Ga0466732_029815	Ga0466732_029815_1512_1955	147
90	iso_pr_bacteria	2820735654	2820735841	147
91	iso_pr_bacteria	3002006476	3002006622	147
92	3300000062	IMNBL1DRAFT_c0014499	IMNBL1DRAFT_00144995	148
93	3300002462	JGI24702J35022_10000345	JGI24702J35022_1000034528	148
94	3300002462	JGI24702J35022_10019636	JGI24702J35022_100196363	148
95	3300007192	Ga0103268_1000008	Ga0103268_100000812	148
96	3300010882	Ga0123354_10009178	Ga0123354_100091788	148
97	3300042598	Ga0466701_101347	Ga0466701_101347_1045_1491	148
98	3300042624	Ga0466735_092502	Ga0466735_092502_1190_1636	148
99	3300042649	Ga0466724_50204	Ga0466724_50204_1776_2222	148
100	2021593000	TM1208_contig13557	TM1208A_134470	149
101	3300002504	JGI24705J35276_12231915	JGI24705J35276_122319155	149
102	3300010167	Ga0123353_10001838	Ga0123353_1000183815	149
103	3300010167	Ga0123353_10196433	Ga0123353_101964332	149
104	3300010882	Ga0123354_10002407	Ga0123354_100024072	149
105	3300010882	Ga0123354_10030897	Ga0123354_100308977	149
106	3300010882	Ga0123354_10045655	Ga0123354_100456551	149
107	3300010882	Ga0123354_10217340	Ga0123354_102173403	149
108	3300042604	Ga0466717_046953	Ga0466717_046953_309_758	149
109	3300042649	Ga0466724_42035	Ga0466724_42035_1702_2151	149
110	3300042656	Ga0466732_367694	Ga0466732_367694_247_696	149
111	iso_pr_bacteria	3002032411	3002032556	149
112	2021593000	TM1208_contig15477	TM1208A_1143120	150
113	3300010167	Ga0123353_10270818	Ga0123353_102708185	150
114	3300013007	Ga0157631_138106	Ga0157631_1381065	150
115	3300042599	Ga0466706_203208	Ga0466706_203208_5482_5934	150
116	3300042606	Ga0466719_267430	Ga0466719_267430_104_556	150
117	iso_pr_bacteria	3001995318	3001995464	150
118	3300007080	Ga0102735_1000443	Ga0102735_10004433	151
119	3300007190	Ga0103267_1000146	Ga0103267_100014614	151
120	3300010049	Ga0123356_10001294	Ga0123356_100012946	151
121	3300010167	Ga0123353_10723922	Ga0123353_107239222	151
122	iso_pr_bacteria	3002026852	3002026997	151
123	3300002462	JGI24702J35022_10017178	JGI24702J35022_100171785	152
124	3300010167	Ga0123353_10081391	Ga0123353_100813916	152
125	iso_pr_bacteria	3002008367	3002008511	152
126	iso_pr_bacteria	3002030550	3002030696	152
127	3300005201	Ga0072941_1187313	Ga0072941_11873135	153
128	iso_pr_bacteria	3002002726	3002002874	153
129	3300042606	Ga0466719_235977	Ga0466719_235977_236_700	154
130	3300042654	Ga0466725_415538	Ga0466725_415538_787_1251	154
131	iso_pr_bacteria	3000336795	3000337551	154
132	iso_pr_bacteria	3000153175	3000153688	161
133	3300009784	Ga0123357_10027856	Ga0123357_100278564	164
134	3300010167	Ga0123353_11237559	Ga0123353_112375592	174

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM ID	Name	Description	Start	End	Accuracy
PF00383	dCMP_cyt_deam_1	Cytidine and deoxycytidylate deaminase zinc-binding region	4	102	0.97
PF14437	MafB19-deam	MafB19-like deaminase	5	111	0.91

⚛️ Structure & Feature Viewer

pLDDT	pTM	Quality
0.93	0.93	High

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.