Protein Family IF01896
Metagenome
Isolate
697
Members
457
Samples
336
Scaffolds
344.88
Avg Length
Representative Sequence
- ID
- 3300007190|Ga0103267_1034093|Ga0103267_10340932
- Length
- 400 aa
- Sequence
- MVLAFIVKAFPVKSGQFDFTGEGHTPAREERKTIPQTRLRPIIPAPFGISFQVFPMQQTMKALVKREARKGIWLEQVPVXXXGPNEVLIKLEKTAICGTDLHIYLWDEWSQRTVKPGTVIGHEFVGRIVELGAAVSGYEIGQRVSAEGHLVCGHCRNCRAGRPHLCPNTVGIGVQRNGAFAEYIVMPASNLWPVPDQIPSELAAFFDPYGNAAHCALEFDVIGEDVLITGAGPIGVMAAGICKHIGARNVVVTDINDYRLKLAADMGATRVVNVSNTSLSDVMHELHLEGFDVGLEMSGNVRAFNDMLDCMYHGGKVALLGILPKGAGIDWERIIFKGLTVQGIYGRKMYETWYKMTQLVLSGFPLGKVLSHQLPVDEFQKGFDLMESGKSGKVVLSWV*
Sample Types
Isolate
51.8%
Metagenome
48.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
29.6%
Coreidae
18.2%
Termitidae
7.1%
Formicidae
4.8%
Anthocoridae
4.8%
Elmidae
3.6%
Culicidae
3.2%
Muscidae
3.0%
Curculionidae
2.5%
Tenebrionidae
2.5%
Drosophilidae
2.1%
Calliphoridae
2.1%
Armadillidiidae
1.6%
Kalotermitidae
1.4%
Cerambycidae
0.9%
Blattidae
0.9%
Talitridae
0.7%
Tephritidae
0.7%
Apidae
0.7%
Cambaridae
0.7%
Nephropidae
0.5%
Berytidae
0.5%
Rhinotermitidae
0.5%
Sarcophagidae
0.5%
Largidae
0.5%
Ixodidae
0.5%
Hydrophilidae
0.5%
Daphniidae
0.5%
Palinuridae
0.5%
Pentatomidae
0.5%
Pteromalidae
0.2%
Majidae
0.2%
Plutellidae
0.2%
Thripidae
0.2%
Anthomyiidae
0.2%
Artemiidae
0.2%
Ceratophyllidae
0.2%
Siricidae
0.2%
Passalidae
0.2%
Crambidae
0.2%
Alydidae
0.2%
Aphididae
0.2%
Kiwaidae
0.2%
Lysianassidae
0.2%
Hodotermitidae
0.2%
Rhopalidae
0.2%
Penaeidae
0.2%
Carabidae
0.2%
Cixiidae
0.2%
Termopsidae
0.2%
Taxonomy
Archaea
0
Bacteria
654
Eukaryota
0
Viruses
0
Unclassified
43
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8116627632 | Vibrio penaeicida NBRC 15640 | Isolate | Unclassified |
| 2 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 3 | 2838140227 | Dyella sp. OAE510 | Isolate | Unclassified |
| 4 | 2839785767 | Thalassobius sp. I31.1 | Isolate | Nephropidae |
| 5 | 2843904799 | Shewanella khirikhana TH2012 | Isolate | Unclassified |
| 6 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 7 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 8 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 9 | 2873884416 | Photobacterium sanguinicancri Mj110 CAIM 1827 | Isolate | Majidae |
| 10 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 11 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 12 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 13 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 14 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 15 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 16 | 2551306507 | Vibrio parahaemolyticus PCV08-7 | Isolate | Unclassified |
| 17 | 2585427605 | Colwellia sp. MT2012 | Isolate | |
| 18 | 2603880164 | Opitutus sp. | Isolate | Formicidae |
| 19 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 20 | 2636415586 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 21 | 2667527887 | Vibrio harveyi LMG 4044 | Isolate | Unclassified |
| 22 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 23 | 2791355471 | Vibrio bivalvicida 605 | Isolate | Unclassified |
| 24 | 2791355473 | Vibrio barjaei 3062 | Isolate | Unclassified |
| 25 | 2820025825 | Unclassified Spirochaetes Lab288P1bin8 | Isolate | Unclassified |
| 26 | 2820545146 | Unclassified Firmicutes Lab288P1bin104 | Isolate | Unclassified |
| 27 | 2820619171 | Unclassified Firmicutes Emb289P1bin130 | Isolate | Unclassified |
| 28 | 2820637417 | Unclassified Firmicutes Emb289P1bin108 | Isolate | Unclassified |
| 29 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 30 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 31 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 32 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 33 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 34 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 35 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 36 | 8048923410 | Photobacterium sanguinicancri CECT 7579 | Isolate | Unclassified |
| 37 | 8051534459 | Vibrio vulnificus Vv004 | Isolate | |
| 38 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 39 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 40 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 41 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 42 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 43 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 44 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 45 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 46 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 47 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
| 48 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 49 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 50 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 51 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 52 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 53 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 54 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 55 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 56 | 3006225627 | Vibrio sp. Hep-1b-8 | Isolate | Unclassified |
| 57 | 3006242587 | Vibrio sp. RE86 | Isolate | Unclassified |
| 58 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 59 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 60 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 61 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 62 | 3300035364 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut | Metagenome | Plutellidae |
| 63 | 2850895757 | Vibrio campbellii 170502 | Isolate | Unclassified |
| 64 | 2860776474 | Vibrio parahaemolyticus R14 | Isolate | Unclassified |
| 65 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 66 | 2872471378 | Vibrio owensii V180403 | Isolate | Unclassified |
| 67 | 2902916284 | Pseudoalteromonas rubra S1946 | Isolate | Unclassified |
| 68 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 69 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 70 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 71 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 72 | 2958255616 | Serratia marcescens TM | Isolate | |
| 73 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 74 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 75 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 76 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 77 | 2571042430 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 78 | 2627854002 | Vibrio nigripulchritudo ENn2 | Isolate | Unclassified |
| 79 | 2711768158 | Vibrio coralliilyticus S2043 | Isolate | Unclassified |
| 80 | 2816332503 | Tritonibacter mobilis S1611 | Isolate | Unclassified |
| 81 | 2820431532 | Unclassified Firmicutes Lab288P3bin230 | Isolate | Unclassified |
| 82 | 2820479655 | Unclassified Firmicutes Lab288P1bin77 | Isolate | Unclassified |
| 83 | 2820613375 | Unclassified Firmicutes Emb289P1bin134 | Isolate | Unclassified |
| 84 | 2820661146 | Unclassified Firmicutes Co191P3bin61 | Isolate | Unclassified |
| 85 | 2820707375 | Unclassified Firmicutes Co191P1bin31 | Isolate | Unclassified |
| 86 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 87 | 651324086 | Plautia crossota stali symbiont | Isolate | Unclassified |
| 88 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 89 | 8022087107 | Vibrio sp. OULL4 | Isolate | Unclassified |
| 90 | 8022439116 | Vibrio sp. ArtGut-C1 | Isolate | Artemiidae |
| 91 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 92 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 93 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 94 | 8062637095 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 95 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 96 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 97 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 98 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 99 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 100 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 101 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 102 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 103 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 104 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 105 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 106 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 107 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 108 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 109 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 110 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 111 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 112 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 113 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 114 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 115 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 116 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 117 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 118 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 119 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 120 | 2864761044 | Stenotrophomonas rhizophilia S00008 | Isolate | Elmidae |
| 121 | 2864951976 | Brevundimonas bullata S00223 | Isolate | Elmidae |
| 122 | 2885046828 | Erwinia sp. OLCASP19 | Isolate | Anthocoridae |
| 123 | 2885054481 | Erwinia sp. OLMDSP33 | Isolate | Anthocoridae |
| 124 | 2902451016 | Photobacterium leiognathi mandapamensis ajapo.4.1 | Isolate | Unclassified |
| 125 | 2902896024 | Pseudoalteromonas sp. S1612 | Isolate | Unclassified |
| 126 | 2908136803 | Vibrio owensii 1700302 | Isolate | Unclassified |
| 127 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 128 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 129 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 130 | 2565956518 | Vibrio pacinii DSM 19139 | Isolate | Unclassified |
| 131 | 2600255074 | Vibrio proteolyticus NBRC 13287 | Isolate | Unclassified |
| 132 | 2693429575 | Vibrio parahaemolyticus ISF-54-12 | Isolate | Unclassified |
| 133 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 134 | 2711768164 | Tritonibacter mobilis S1942 | Isolate | Unclassified |
| 135 | 2816332545 | Tritonibacter mobilis S1923 | Isolate | Unclassified |
| 136 | 2820442516 | Unclassified Firmicutes Lab288P3bin200 | Isolate | Unclassified |
| 137 | 2820481688 | Unclassified Firmicutes Lab288P1bin76 | Isolate | Unclassified |
| 138 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 139 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 140 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 141 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 142 | 640963010 | Vibrio harveyi HY01 | Isolate | Unclassified |
| 143 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 144 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 145 | 8022345672 | Vibrio sp. 070316B | Isolate | Unclassified |
| 146 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 147 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 148 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 149 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 150 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 151 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 152 | 8033364368 | Vibrio panuliri LBS 2 | Isolate | Nephropidae |
| 153 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 154 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 155 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 156 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 157 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 158 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 159 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 160 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 161 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 162 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 163 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 164 | 2997380424 | Vibrio parahaemolyticus MVP1 | Isolate | Unclassified |
| 165 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 166 | 3300006995 | Ant gut microbial communities from Cephalotes angustus, Brazil | Metagenome | Formicidae |
| 167 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 168 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 169 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Drosophilidae |
| 170 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 171 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 172 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 173 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 174 | 2864812326 | Chitinimonas taiwanensis S00057 | Isolate | Elmidae |
| 175 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 176 | 2864866972 | Brevundimonas bullata S00123 | Isolate | Elmidae |
| 177 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 178 | 2885043073 | Erwinia sp. OLSSP12 | Isolate | Anthocoridae |
| 179 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 180 | 2902438364 | Photobacterium damselae Hep-2a-11 | Isolate | Unclassified |
| 181 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 182 | 2940270707 | Lachnoclostridium sp. PF1-13 | Isolate | Blattidae |
| 183 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 184 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 185 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 186 | 2548876789 | Xanthomonas sacchari NCPPB 4393 | Isolate | |
| 187 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 188 | 2648501820 | Vibrio nigripulchritudo BLFn1 | Isolate | Unclassified |
| 189 | 2667527830 | Vibrio parahaemolyticus ISF-29-3 | Isolate | Unclassified |
| 190 | 2700989396 | Vibrio parahaemolyticus ISF-77-01 | Isolate | Unclassified |
| 191 | 2718217749 | Coxiella mudrowiae CRt | Isolate | Ixodidae |
| 192 | 2731957969 | Proteus mirabilis Wood | Isolate | Calliphoridae |
| 193 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 194 | 2785510762 | Vibrio parahaemolyticus VP14 | Isolate | Unclassified |
| 195 | 2820314258 | Unclassified Firmicutes Nt197P4bin16 | Isolate | Unclassified |
| 196 | 2820483401 | Unclassified Firmicutes Lab288P1bin74 | Isolate | Unclassified |
| 197 | 2820535361 | Unclassified Firmicutes Lab288P1bin14 | Isolate | Unclassified |
| 198 | 2820681712 | Unclassified Firmicutes Co191P1bin84 | Isolate | Unclassified |
| 199 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 200 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 201 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 202 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 203 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 204 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 205 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 206 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 207 | 8042061949 | Vibrio harveyi Hep-2a-10 | Isolate | Unclassified |
| 208 | 8062747827 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 209 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 210 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 211 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 212 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 213 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 214 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 215 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 216 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 217 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 218 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 219 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 220 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 221 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 222 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 223 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 224 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 225 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 226 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 227 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 228 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 229 | 2841330038 | Sulfitobacter sp. D7 | Isolate | |
| 230 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 231 | 2864808494 | Chitinimonas taiwanensis S00056 | Isolate | Elmidae |
| 232 | 2864934081 | Brevundimonas vesicularis S00192 | Isolate | Elmidae |
| 233 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 234 | 2885050628 | Erwinia sp. OLMTSP26 | Isolate | Anthocoridae |
| 235 | 2885061987 | Erwinia sp. OLFS4 | Isolate | Anthocoridae |
| 236 | 2885065815 | Erwinia sp. OAMSP11 | Isolate | Anthocoridae |
| 237 | 2889908211 | Bowmanella denitrificans JL63 | Isolate | Unclassified |
| 238 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 239 | 2912570088 | Vibrio parahaemolyticus CHN25 | Isolate | |
| 240 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 241 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 242 | 2531839005 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 243 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 244 | 2554235022 | Vibrio parahaemolyticus v110 | Isolate | |
| 245 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 246 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 247 | 2648501158 | Vibrio hepatarius DSM 19134 | Isolate | Unclassified |
| 248 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 249 | 2663763317 | Vibrio parahaemolyticus ISF-94-1 | Isolate | Unclassified |
| 250 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 251 | 2718218026 | Phaeobacter porticola P97 | Isolate | Unclassified |
| 252 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 253 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 254 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 255 | 2820223845 | Unclassified Firmicutes Th196P4bin57 | Isolate | Unclassified |
| 256 | 2820323050 | Unclassified Firmicutes Nt197P3bin84 | Isolate | Unclassified |
| 257 | 2820432912 | Unclassified Firmicutes Lab288P3bin219 | Isolate | Unclassified |
| 258 | 2820530790 | Unclassified Firmicutes Lab288P1bin141 | Isolate | Unclassified |
| 259 | 2820566695 | Unclassified Firmicutes Emb289P3bin50 | Isolate | Unclassified |
| 260 | 2820598593 | Unclassified Firmicutes Emb289P1bin53 | Isolate | Unclassified |
| 261 | 2820666966 | Unclassified Firmicutes Co191P3bin39 | Isolate | Unclassified |
| 262 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 263 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 264 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 265 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 266 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 267 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 268 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 269 | 8051551332 | Vibrio vulnificus Vv003 | Isolate | |
| 270 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 271 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 272 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 273 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 274 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 275 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 276 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 277 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 278 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 279 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 280 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 281 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 282 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 283 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 284 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 285 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 286 | 3300013007 | Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts | Metagenome | Kiwaidae |
| 287 | 2844251356 | Photobacterium leiognathi mandapamensis ajapo.3.1 | Isolate | Unclassified |
| 288 | 2858407585 | Photobacterium swingsii DSM 24669 | Isolate | Unclassified |
| 289 | 2864764899 | Aeromonas fluvialis S00019 | Isolate | Elmidae |
| 290 | 2864768727 | Aeromonas veronii S00020 | Isolate | Elmidae |
| 291 | 2873558832 | Propioniciclava coleopterorum HDW11 | Isolate | Hydrophilidae |
| 292 | 2873562573 | Thermomonas sp. HDW16 | Isolate | Hydrophilidae |
| 293 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 294 | 2880115952 | Vibrio parahaemolyticus PB1937 | Isolate | Unclassified |
| 295 | 2900349738 | Photobacterium lucens CAIM 1938 | Isolate | Unclassified |
| 296 | 2912636047 | Vibrio crassostreae 9CS106 | Isolate | Unclassified |
| 297 | 2940264388 | Lachnospiraceae bacterium PFB1-17 | Isolate | Blattidae |
| 298 | 2940267548 | Lachnospiraceae bacterium PFB1-22 | Isolate | Blattidae |
| 299 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 300 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 301 | 2501651205 | Colwellia sp. MT41 | Isolate | Lysianassidae |
| 302 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 303 | 2556921669 | Shinella sp. DD12 | Isolate | Daphniidae |
| 304 | 2574179716 | Serratia sp. DD3 | Isolate | Daphniidae |
| 305 | 2609459958 | Vibrio nigripulchritudo Wn13 | Isolate | Unclassified |
| 306 | 2630968716 | Vibrio nigripulchritudo AM115 | Isolate | Unclassified |
| 307 | 2636415542 | Vibrio nigripulchritudo SFn135 | Isolate | Unclassified |
| 308 | 2654587515 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 309 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 310 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 311 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 312 | 2806310572 | Pukyongiella litopenaei SH-1 | Isolate | Unclassified |
| 313 | 2820495292 | Unclassified Firmicutes Lab288P1bin59 | Isolate | Unclassified |
| 314 | 2820620956 | Unclassified Firmicutes Emb289P1bin128 | Isolate | Unclassified |
| 315 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 316 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 317 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 318 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 319 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 320 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 321 | 8048928574 | Photobacterium swingsii CECT 7576 | Isolate | Unclassified |
| 322 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 323 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 324 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 325 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 326 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 327 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 328 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 329 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 330 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 331 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 332 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 333 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 334 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 335 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 336 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 337 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 338 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 339 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 340 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 341 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 342 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 343 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 344 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 345 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 346 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 347 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 348 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 349 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 350 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 351 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 352 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 353 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 354 | 2820946191 | Unclassified Acidobacteria Nt197P3bin31 | Isolate | Unclassified |
| 355 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 356 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 357 | 2848339753 | Ephemeroptericola cinctiostellae F02 | Isolate | Unclassified |
| 358 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 359 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 360 | 2864791955 | Aeromonas veronii S00030 | Isolate | Elmidae |
| 361 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 362 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 363 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 364 | 2875320051 | Vibrio parahaemolyticus 160807 | Isolate | Unclassified |
| 365 | 2877638525 | Vibrio campbellii 1114GL | Isolate | Penaeidae |
| 366 | 2877647439 | Vibrio parahaemolyticus R13 | Isolate | Unclassified |
| 367 | 2885058212 | Erwinia sp. OLTSP20 | Isolate | Anthocoridae |
| 368 | 2896925746 | Vibrio nigripulchritudo SFn27 | Isolate | Unclassified |
| 369 | 2902469402 | Photobacterium lucens CAIM 1937 | Isolate | Unclassified |
| 370 | 2909412500 | Yimella sp. cx-573 | Isolate | Cambaridae |
| 371 | 2515154106 | Streptomyces sp. FxanaD5 | Isolate | Unclassified |
| 372 | 2585428048 | Colwellia sp. NBT2012 | Isolate | |
| 373 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 374 | 2609459925 | Vibrio nigripulchritudo SO65 | Isolate | Unclassified |
| 375 | 2627853677 | Vibrio nigripulchritudo FTn2 | Isolate | Unclassified |
| 376 | 2648501628 | Xanthomonas sp. Cag60 | Isolate | Unclassified |
| 377 | 2684622551 | Vibrio campbellii E1 | Isolate | Unclassified |
| 378 | 2731957638 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 379 | 2820303403 | Unclassified Firmicutes Th196P1bin2 | Isolate | Unclassified |
| 380 | 2820312173 | Unclassified Firmicutes Nt197P4bin8 | Isolate | Unclassified |
| 381 | 2820469612 | Unclassified Firmicutes Lab288P1bin92 | Isolate | Unclassified |
| 382 | 2820522177 | Unclassified Firmicutes Lab288P1bin22 | Isolate | Unclassified |
| 383 | 2820688768 | Unclassified Firmicutes Co191P1bin74 | Isolate | Unclassified |
| 384 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 385 | 8022096067 | Vibrio sp. SALL6 | Isolate | Unclassified |
| 386 | 8022116796 | Vibrio sp. T3Y01 | Isolate | Unclassified |
| 387 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 388 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 389 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 390 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 391 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 392 | 8051461712 | Vibrio vulnificus Vv002 | Isolate | |
| 393 | 8060845732 | Vibrio vulnificus Vv006 | Isolate | |
| 394 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 395 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 396 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 397 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 398 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 399 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 400 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 401 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 402 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 403 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 404 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 405 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 406 | 2989793055 | Vibrio atypicus DSM 25292 | Isolate | Unclassified |
| 407 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 408 | 3002773460 | Coxiella endosymbiont of Amblyomma nuttalli Craf2019 | Isolate | Ixodidae |
| 409 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 410 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 411 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 412 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 413 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 414 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 415 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 416 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 417 | 2820947865 | Unclassified Acidobacteria Nt197P3bin133 | Isolate | Unclassified |
| 418 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 419 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 420 | 2864955722 | Sphingomonas kyeonggiensis S00224 | Isolate | Elmidae |
| 421 | 2868883784 | Photobacterium leiognathi mandapamensis AJ-1a | Isolate | Unclassified |
| 422 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 423 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 424 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 425 | 2940273867 | Lachnoclostridium sp. PH1-16 | Isolate | Blattidae |
| 426 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 427 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 428 | 2617270844 | Dyella sp. HyOG | Isolate | Cixiidae |
| 429 | 2671180705 | Pseudoalteromonas piscicida S2040 | Isolate | Unclassified |
| 430 | 2775506951 | Candidatus Coxiella mudrowiae CRS-CAT | Isolate | Unclassified |
| 431 | 2781125686 | Treponema sp. Lab288P4bin22 | Isolate | Unclassified |
| 432 | 2820504582 | Unclassified Firmicutes Lab288P1bin5 | Isolate | Unclassified |
| 433 | 2820587002 | Unclassified Firmicutes Emb289P1bin94 | Isolate | Unclassified |
| 434 | 2820690275 | Unclassified Firmicutes Co191P1bin72 | Isolate | Unclassified |
| 435 | 2820127165 | Unclassified Proteobacteria Emb289P3bin90 | Isolate | Unclassified |
| 436 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 437 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 438 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 439 | 8033368880 | Vibrio panuliri CAIM 1902 | Isolate | Palinuridae |
| 440 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 441 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 442 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 443 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 444 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 445 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 446 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 447 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 448 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 449 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 450 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 451 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 452 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 453 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 454 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 455 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 456 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 457 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_092456 | 3300042611 | Bacteria | 4054 |
| 2 | Ga0466733_197636 | 3300042659 | Bacteria | 18159 |
| 3 | Ga0562376_0409 | 3300056857 | Bacteria | 80612 |
| 4 | Ga0123357_10008195 | 3300009784 | Bacteria | 13022 |
| 5 | Ga0123357_10053230 | 3300009784 | Bacteria | 5461 |
| 6 | Ga0123355_10000626 | 3300009826 | Bacteria | 47835 |
| 7 | Ga0123355_10192575 | 3300009826 | Bacteria | 2999 |
| 8 | Ga0123355_10339366 | 3300009826 | Bacteria | 2003 |
| 9 | Ga0123355_10373147 | 3300009826 | Bacteria | 1866 |
| 10 | Ga0123356_10036499 | 3300010049 | Bacteria | 4589 |
| 11 | Ga0123356_10109268 | 3300010049 | Bacteria | 2668 |
| 12 | Ga0123356_10179986 | 3300010049 | Bacteria | 2135 |
| 13 | Ga0123353_10008607 | 3300010167 | Bacteria | 13961 |
| 14 | Ga0123353_10039732 | 3300010167 | Bacteria | 7413 |
| 15 | Ga0123353_10162332 | 3300010167 | Bacteria | 3556 |
| 16 | Ga0123353_10172524 | 3300010167 | Bacteria | 3431 |
| 17 | Ga0123354_10224951 | 3300010882 | Bacteria | 1981 |
| 18 | Ga0466698_336075 | 3300042610 | Bacteria | 1149 |
| 19 | Ga0160456_100017 | 3300012820 | Bacteria | 301819 |
| 20 | Ga0160467_100114 | 3300012829 | Bacteria | 115506 |
| 21 | Ga0160444_100472 | 3300012841 | Unclassified | 18422 |
| 22 | Ga0466690_238918 | 3300042590 | Bacteria | 1057 |
| 23 | Ga0466693_167887 | 3300042592 | Bacteria | 10383 |
| 24 | Ga0466699_104033 | 3300042597 | Bacteria | 26132 |
| 25 | Ga0466725_028957 | 3300042654 | Bacteria | 12700 |
| 26 | Ga0466718_146980 | 3300042617 | Bacteria | 3846 |
| 27 | Ga0466726_075251 | 3300042619 | Bacteria | 2449 |
| 28 | Ga0466726_360931 | 3300042619 | Bacteria | 8938 |
| 29 | JGI24705J35276_12236818 | 3300002504 | Bacteria | 8998 |
| 30 | Ga0063521_1000009 | 3300003973 | Bacteria | 190208 |
| 31 | Ga0072941_1126081 | 3300005201 | Bacteria | 2935 |
| 32 | Ga0074188_1039520 | 3300005318 | Bacteria | 5085 |
| 33 | Ga0103263_100009 | 3300007042 | Bacteria | 52903 |
| 34 | Ga0102736_1000381 | 3300007052 | Bacteria | 9318 |
| 35 | Ga0102740_1002498 | 3300007140 | Unclassified | 6731 |
| 36 | Ga0123357_10204694 | 3300009784 | Bacteria | 2236 |
| 37 | Ga0123355_10000436 | 3300009826 | Bacteria | 54934 |
| 38 | Ga0123355_10004208 | 3300009826 | Bacteria | 20907 |
| 39 | Ga0123356_10000604 | 3300010049 | Bacteria | 39698 |
| 40 | Ga0123356_10070414 | 3300010049 | Bacteria | 3280 |
| 41 | Ga0123356_10120454 | 3300010049 | Bacteria | 2551 |
| 42 | Ga0123356_10121999 | 3300010049 | Bacteria | 2537 |
| 43 | Ga0123356_10143212 | 3300010049 | Bacteria | 2361 |
| 44 | Ga0123356_10270278 | 3300010049 | Bacteria | 1789 |
| 45 | Ga0123353_10047769 | 3300010167 | Bacteria | 6811 |
| 46 | Ga0123353_10194190 | 3300010167 | Bacteria | 3201 |
| 47 | Ga0123353_10246286 | 3300010167 | Bacteria | 2773 |
| 48 | Ga0123353_10432245 | 3300010167 | Bacteria | 1946 |
| 49 | Ga0123354_10165071 | 3300010882 | Bacteria | 2608 |
| 50 | Ga0466713_041448 | 3300042602 | Bacteria | 72943 |
| 51 | Ga0160456_100002 | 3300012820 | Bacteria | 798475 |
| 52 | Ga0160446_101394 | 3300012835 | Unclassified | 5295 |
| 53 | Ga0160448_100024 | 3300012854 | Bacteria | 191582 |
| 54 | Ga0160435_1008317 | 3300012857 | Unclassified | 2240 |
| 55 | Ga0247290_00293 | 3300035364 | Unclassified | 11750 |
| 56 | Ga0466693_200153 | 3300042592 | Bacteria | 1745 |
| 57 | Ga0466699_002445 | 3300042597 | Bacteria | 17182 |
| 58 | Ga0466699_039596 | 3300042597 | Bacteria | 15491 |
| 59 | Ga0466699_088808 | 3300042597 | Bacteria | 1951 |
| 60 | Ga0466699_122271 | 3300042597 | Bacteria | 4930 |
| 61 | Ga0466730_002899 | 3300042625 | Unclassified | 42586 |
| 62 | Ga0466730_022792 | 3300042625 | Bacteria | 9676 |
| 63 | Ga0466730_092902 | 3300042625 | Bacteria | 57909 |
| 64 | Ga0466708_012531 | 3300042652 | Bacteria | 2762 |
| 65 | Ga0466725_035356 | 3300042654 | Bacteria | 3535 |
| 66 | Ga0466712_211564 | 3300042614 | Bacteria | 1944 |
| 67 | JGI24702J35022_10000969 | 3300002462 | Bacteria | 17944 |
| 68 | JGI24705J35276_12234408 | 3300002504 | Bacteria | 5492 |
| 69 | Ga0063521_1004223 | 3300003973 | Bacteria | 3402 |
| 70 | Ga0102733_100003 | 3300006995 | Bacteria | 141982 |
| 71 | Ga0103266_1000026 | 3300007067 | Bacteria | 144145 |
| 72 | Ga0103261_1002107 | 3300007083 | Unclassified | 4819 |
| 73 | Ga0103268_1001234 | 3300007192 | Bacteria | 6553 |
| 74 | Ga0562377_0013 | 3300056842 | Bacteria | 1229680 |
| 75 | Ga0562375_1214 | 3300056856 | Bacteria | 37276 |
| 76 | Ga0562376_0369 | 3300056857 | Bacteria | 85849 |
| 77 | Ga0123355_10000750 | 3300009826 | Bacteria | 44327 |
| 78 | Ga0123355_10001870 | 3300009826 | Unclassified | 29520 |
| 79 | Ga0123355_10466596 | 3300009826 | Bacteria | 1581 |
| 80 | Ga0123355_10624006 | 3300009826 | Bacteria | 1269 |
| 81 | Ga0123356_10006956 | 3300010049 | Bacteria | 11355 |
| 82 | Ga0123356_10015188 | 3300010049 | Bacteria | 7382 |
| 83 | Ga0123353_10005708 | 3300010167 | Bacteria | 16413 |
| 84 | Ga0123353_10053008 | 3300010167 | Bacteria | 6483 |
| 85 | Ga0123353_10160132 | 3300010167 | Bacteria | 3584 |
| 86 | Ga0123353_10166919 | 3300010167 | Bacteria | 3498 |
| 87 | Ga0123353_10582849 | 3300010167 | Bacteria | 1604 |
| 88 | Ga0466714_074198 | 3300042603 | Bacteria | 829090 |
| 89 | Ga0466714_132388 | 3300042603 | Bacteria | 4781 |
| 90 | Ga0466722_224456 | 3300042609 | Bacteria | 4201 |
| 91 | Ga0160440_100002 | 3300012815 | Bacteria | 1234951 |
| 92 | Ga0160440_100151 | 3300012815 | Bacteria | 63162 |
| 93 | Ga0160456_104761 | 3300012820 | Unclassified | 1731 |
| 94 | Ga0160459_104796 | 3300012831 | Bacteria | 1809 |
| 95 | Ga0160443_100007 | 3300012848 | Bacteria | 631542 |
| 96 | Ga0160436_1002915 | 3300012861 | Bacteria | 4264 |
| 97 | Ga0415639_091595 | 3300038395 | Bacteria | 4112 |
| 98 | Ga0466690_388969 | 3300042590 | Bacteria | 1356 |
| 99 | Ga0466693_172424 | 3300042592 | Bacteria | 1244 |
| 100 | Ga0466694_194097 | 3300042594 | Bacteria | 3626 |
| 101 | Ga0466695_191661 | 3300042595 | Bacteria | 2764 |
| 102 | Ga0466730_026308 | 3300042625 | Bacteria | 2977 |
| 103 | Ga0466730_072517 | 3300042625 | Unclassified | 2964 |
| 104 | Ga0466704_531633 | 3300042643 | Bacteria | 2589 |
| 105 | Ga0466725_149957 | 3300042654 | Bacteria | 2506 |
| 106 | Ga0466725_174219 | 3300042654 | Bacteria | 1746 |
| 107 | Ga0466712_089928 | 3300042614 | Bacteria | 37345 |
| 108 | Ga0466729_160196 | 3300042621 | Bacteria | 1148 |
| 109 | DPO_contig01767 | 2032320009 | Unclassified | 1675 |
| 110 | FGTW_contig31762 | 2065487013 | Unclassified | 3526 |
| 111 | JGI24698J34947_10001791 | 3300002449 | Bacteria | 11460 |
| 112 | JGI24695J34938_10029109 | 3300002450 | Bacteria | 2587 |
| 113 | JGI24695J34938_10033459 | 3300002450 | Bacteria | 2364 |
| 114 | CVPL010W_10006175 | 3300002931 | Bacteria | 12427 |
| 115 | Ga0102736_1000007 | 3300007052 | Bacteria | 80760 |
| 116 | Ga0102736_1000283 | 3300007052 | Unclassified | 12002 |
| 117 | Ga0102735_1002891 | 3300007080 | Bacteria | 2504 |
| 118 | Ga0105553_1025595 | 3300007767 | Bacteria | 9856 |
| 119 | Ga0123355_10004710 | 3300009826 | Bacteria | 19830 |
| 120 | Ga0123355_10025791 | 3300009826 | Unclassified | 9468 |
| 121 | Ga0123355_10033733 | 3300009826 | Bacteria | 8313 |
| 122 | Ga0123355_10188632 | 3300009826 | Bacteria | 3042 |
| 123 | Ga0123355_10290351 | 3300009826 | Bacteria | 2245 |
| 124 | Ga0123356_10000760 | 3300010049 | Bacteria | 35664 |
| 125 | Ga0123356_10001890 | 3300010049 | Bacteria | 22704 |
| 126 | Ga0123356_10025786 | 3300010049 | Bacteria | 5525 |
| 127 | Ga0123356_10030137 | 3300010049 | Bacteria | 5078 |
| 128 | Ga0123356_10169892 | 3300010049 | Unclassified | 2190 |
| 129 | Ga0123356_10189263 | 3300010049 | Bacteria | 2087 |
| 130 | Ga0123353_10327148 | 3300010167 | Bacteria | 2323 |
| 131 | Ga0466707_303819 | 3300042601 | Bacteria | 1396 |
| 132 | Ga0466698_008986 | 3300042610 | Bacteria | 1791 |
| 133 | Ga0160458_103689 | 3300012832 | Bacteria | 1915 |
| 134 | Ga0160445_101828 | 3300012847 | Bacteria | 5485 |
| 135 | Ga0160435_1000130 | 3300012857 | Bacteria | 44096 |
| 136 | Ga0316159_10328 | 3300030930 | Bacteria | 7597 |
| 137 | Ga0415639_000734 | 3300038395 | Bacteria | 2314 |
| 138 | Ga0415639_126456 | 3300038395 | Unclassified | 2326 |
| 139 | Ga0466699_214939 | 3300042597 | Bacteria | 4197 |
| 140 | Ga0466731_128696 | 3300042622 | Bacteria | 1973 |
| 141 | Ga0466731_272697 | 3300042622 | Bacteria | 1631 |
| 142 | JGI24695J34938_10000115 | 3300002450 | Bacteria | 71817 |
| 143 | CVPL010W_10004533 | 3300002931 | Unclassified | 24675 |
| 144 | CVPL005W_1000680 | 3300002934 | Unclassified | 21288 |
| 145 | Ga0063521_1001819 | 3300003973 | Bacteria | 5477 |
| 146 | Ga0072941_1015118 | 3300005201 | Bacteria | 11425 |
| 147 | Ga0102735_1000280 | 3300007080 | Bacteria | 12079 |
| 148 | Ga0103260_1000012 | 3300007139 | Bacteria | 144208 |
| 149 | Ga0102737_1008539 | 3300007142 | Bacteria | 1808 |
| 150 | Ga0103267_1034093 | 3300007190 | Bacteria | 1699 |
| 151 | Ga0530661_000207 | 3300056564 | Unclassified | 49023 |
| 152 | Ga0562379_0169 | 3300056790 | Bacteria | 193067 |
| 153 | Ga0123355_10001348 | 3300009826 | Bacteria | 34067 |
| 154 | Ga0123355_10008075 | 3300009826 | Bacteria | 15878 |
| 155 | Ga0123355_10011363 | 3300009826 | Bacteria | 13720 |
| 156 | Ga0123355_10083030 | 3300009826 | Bacteria | 5108 |
| 157 | Ga0123355_10542665 | 3300009826 | Bacteria | 1410 |
| 158 | Ga0123356_10003578 | 3300010049 | Bacteria | 16238 |
| 159 | Ga0123356_10008052 | 3300010049 | Bacteria | 10489 |
| 160 | Ga0123356_10018936 | 3300010049 | Bacteria | 6531 |
| 161 | Ga0123356_10022838 | 3300010049 | Bacteria | 5900 |
| 162 | Ga0123356_10026304 | 3300010049 | Bacteria | 5466 |
| 163 | Ga0123356_10185260 | 3300010049 | Bacteria | 2107 |
| 164 | Ga0123353_10059844 | 3300010167 | Bacteria | 6109 |
| 165 | Ga0123353_10215669 | 3300010167 | Bacteria | 3006 |
| 166 | Ga0123353_10328190 | 3300010167 | Bacteria | 2318 |
| 167 | Ga0123353_10342817 | 3300010167 | Bacteria | 2256 |
| 168 | Ga0123353_10426912 | 3300010167 | Bacteria | 1962 |
| 169 | Ga0466701_045622 | 3300042598 | Bacteria | 11773 |
| 170 | Ga0160448_102373 | 3300012854 | Bacteria | 5806 |
| 171 | Ga0160457_1000004 | 3300012858 | Bacteria | 638897 |
| 172 | Ga0157631_138132 | 3300013007 | Bacteria | 1130 |
| 173 | Ga0264413_156158 | 3300024493 | Bacteria | 1329 |
| 174 | Ga0415639_163040 | 3300038395 | Bacteria | 1561 |
| 175 | Ga0466694_154493 | 3300042594 | Bacteria | 2019 |
| 176 | Ga0466699_416061 | 3300042597 | Bacteria | 10123 |
| 177 | Ga0466730_040153 | 3300042625 | Bacteria | 14548 |
| 178 | Ga0466705_414352 | 3300042612 | Unclassified | 1957 |
| 179 | Ga0466710_070299 | 3300042613 | Bacteria | 3249 |
| 180 | Ga0466710_167450 | 3300042613 | Bacteria | 1074 |
| 181 | Ga0466726_249681 | 3300042619 | Bacteria | 4301 |
| 182 | DPOL_contig04075 | 2035918003 | Unclassified | 23444 |
| 183 | SWWA_contig09242__length_16133___numreads_332 | 2100351016 | Bacteria | 16133 |
| 184 | JGI24695J34938_10018024 | 3300002450 | Bacteria | 3544 |
| 185 | JGI24695J34938_10030194 | 3300002450 | Bacteria | 2526 |
| 186 | JGI24702J35022_10003485 | 3300002462 | Bacteria | 9474 |
| 187 | JGI24700J35501_10930561 | 3300002508 | Bacteria | 15704 |
| 188 | CVPL005W_1000026 | 3300002934 | Bacteria | 94760 |
| 189 | Ga0063521_1001705 | 3300003973 | Bacteria | 5699 |
| 190 | Ga0102734_1000697 | 3300007129 | Bacteria | 11767 |
| 191 | Ga0102734_1001195 | 3300007129 | Bacteria | 7649 |
| 192 | Ga0103260_1009737 | 3300007139 | Unclassified | 1656 |
| 193 | Ga0104040_1041336 | 3300007149 | Bacteria | 5158 |
| 194 | Ga0123357_10204306 | 3300009784 | Bacteria | 2239 |
| 195 | Ga0123355_10000336 | 3300009826 | Bacteria | 60947 |
| 196 | Ga0123355_10005824 | 3300009826 | Bacteria | 18122 |
| 197 | Ga0123355_10023627 | 3300009826 | Bacteria | 9873 |
| 198 | Ga0123355_10026653 | 3300009826 | Bacteria | 9327 |
| 199 | Ga0123355_10056790 | 3300009826 | Bacteria | 6335 |
| 200 | Ga0123355_10309738 | 3300009826 | Bacteria | 2142 |
| 201 | Ga0123356_10036590 | 3300010049 | Bacteria | 4583 |
| 202 | Ga0123356_10117555 | 3300010049 | Unclassified | 2580 |
| 203 | Ga0123356_10125556 | 3300010049 | Bacteria | 2504 |
| 204 | Ga0123356_10231887 | 3300010049 | Bacteria | 1911 |
| 205 | Ga0123356_10286816 | 3300010049 | Bacteria | 1744 |
| 206 | Ga0123356_10569946 | 3300010049 | Bacteria | 1295 |
| 207 | Ga0123353_10002779 | 3300010167 | Bacteria | 21853 |
| 208 | Ga0123353_10013768 | 3300010167 | Bacteria | 11605 |
| 209 | Ga0123353_10081946 | 3300010167 | Bacteria | 5189 |
| 210 | Ga0123353_10345345 | 3300010167 | Bacteria | 2246 |
| 211 | Ga0123353_10407563 | 3300010167 | Bacteria | 2020 |
| 212 | Ga0123353_10576201 | 3300010167 | Bacteria | 1616 |
| 213 | Ga0123353_10830876 | 3300010167 | Bacteria | 1270 |
| 214 | Ga0466713_085715 | 3300042602 | Bacteria | 93291 |
| 215 | Ga0466714_111780 | 3300042603 | Bacteria | 1106 |
| 216 | Ga0466720_015529 | 3300042607 | Bacteria | 20529 |
| 217 | Ga0466721_145019 | 3300042608 | Bacteria | 2224 |
| 218 | Ga0160452_100182 | 3300012834 | Bacteria | 71640 |
| 219 | Ga0160460_100069 | 3300012845 | Bacteria | 159929 |
| 220 | Ga0160447_100379 | 3300012849 | Bacteria | 22319 |
| 221 | Ga0160436_1000005 | 3300012861 | Bacteria | 261259 |
| 222 | Ga0264413_134062 | 3300024493 | Bacteria | 10079 |
| 223 | Ga0466694_365298 | 3300042594 | Bacteria | 2234 |
| 224 | Ga0466695_034987 | 3300042595 | Bacteria | 2804 |
| 225 | Ga0466696_106140 | 3300042596 | Bacteria | 8424 |
| 226 | Ga0466699_203815 | 3300042597 | Bacteria | 2862 |
| 227 | Ga0466730_046712 | 3300042625 | Unclassified | 1193 |
| 228 | Ga0466725_466986 | 3300042654 | Bacteria | 1378 |
| 229 | Ga0466710_235334 | 3300042613 | Bacteria | 1167 |
| 230 | Ga0466712_008766 | 3300042614 | Bacteria | 10464 |
| 231 | JGI24702J35022_10000096 | 3300002462 | Bacteria | 39920 |
| 232 | CVPL010W_10020033 | 3300002931 | Unclassified | 3925 |
| 233 | CVPL010L_1004086 | 3300002932 | Unclassified | 1935 |
| 234 | Ga0072940_1019803 | 3300005200 | Bacteria | 13097 |
| 235 | Ga0103266_1001578 | 3300007067 | Bacteria | 3802 |
| 236 | Ga0103265_1000069 | 3300007068 | Bacteria | 20798 |
| 237 | Ga0102735_1000035 | 3300007080 | Bacteria | 76483 |
| 238 | Ga0102739_1000125 | 3300007095 | Bacteria | 21641 |
| 239 | Ga0102738_1000737 | 3300007141 | Bacteria | 5265 |
| 240 | Ga0102737_1000737 | 3300007142 | Bacteria | 10218 |
| 241 | Ga0123357_10226187 | 3300009784 | Unclassified | 2063 |
| 242 | Ga0123356_10004243 | 3300010049 | Bacteria | 14834 |
| 243 | Ga0123356_10008340 | 3300010049 | Bacteria | 10307 |
| 244 | Ga0123356_10010012 | 3300010049 | Bacteria | 9328 |
| 245 | Ga0123356_10070842 | 3300010049 | Bacteria | 3271 |
| 246 | Ga0123356_10424553 | 3300010049 | Bacteria | 1472 |
| 247 | Ga0123353_10000174 | 3300010167 | Bacteria | 81672 |
| 248 | Ga0123353_10454544 | 3300010167 | Bacteria | 1884 |
| 249 | Ga0123354_10140944 | 3300010882 | Bacteria | 2983 |
| 250 | Ga0123354_10252159 | 3300010882 | Bacteria | 1784 |
| 251 | Ga0466701_025676 | 3300042598 | Bacteria | 163759 |
| 252 | Ga0160467_100007 | 3300012829 | Bacteria | 616894 |
| 253 | Ga0160458_100003 | 3300012832 | Bacteria | 774753 |
| 254 | Ga0160433_100033 | 3300012846 | Bacteria | 161929 |
| 255 | Ga0316159_10410 | 3300030930 | Unclassified | 6731 |
| 256 | Ga0415639_027131 | 3300038395 | Bacteria | 33706 |
| 257 | Ga0415639_107052 | 3300038395 | Bacteria | 6034 |
| 258 | Ga0466657_140125 | 3300042582 | Bacteria | 2172 |
| 259 | Ga0466693_119622 | 3300042592 | Bacteria | 3491 |
| 260 | Ga0466694_093643 | 3300042594 | Bacteria | 1754 |
| 261 | Ga0466699_118435 | 3300042597 | Bacteria | 3010 |
| 262 | Ga0466730_031860 | 3300042625 | Unclassified | 30224 |
| 263 | Ga0466730_070449 | 3300042625 | Unclassified | 7451 |
| 264 | Ga0466730_088751 | 3300042625 | Bacteria | 2020 |
| 265 | Ga0466704_021026 | 3300042643 | Bacteria | 1870 |
| 266 | Ga0466724_34422 | 3300042649 | Unclassified | 6363 |
| 267 | Ga0466724_69537 | 3300042649 | Unclassified | 17464 |
| 268 | Ga0466705_462016 | 3300042612 | Bacteria | 1151 |
| 269 | Ga0466718_013290 | 3300042617 | Bacteria | 3959 |
| 270 | Ga0466718_124957 | 3300042617 | Bacteria | 7760 |
| 271 | Ga0466723_052666 | 3300042618 | Bacteria | 2123 |
| 272 | FGTW_contig30769 | 2065487013 | Bacteria | 9495 |
| 273 | JGI24695J34938_10028919 | 3300002450 | Bacteria | 2597 |
| 274 | Meta3P_1001157 | 3300002464 | Bacteria | 16467 |
| 275 | JGI24700J35501_10930400 | 3300002508 | Bacteria | 13624 |
| 276 | CVPL010L_1000032 | 3300002932 | Bacteria | 56777 |
| 277 | Ga0063521_1000035 | 3300003973 | Bacteria | 116069 |
| 278 | Ga0072941_1004538 | 3300005201 | Bacteria | 4468 |
| 279 | Ga0103261_1000023 | 3300007083 | Bacteria | 256806 |
| 280 | Ga0103264_1000349 | 3300007188 | Bacteria | 28366 |
| 281 | Ga0466733_003654 | 3300042659 | Bacteria | 2444 |
| 282 | Ga0466733_075055 | 3300042659 | Bacteria | 6809 |
| 283 | Ga0562375_0847 | 3300056856 | Bacteria | 51368 |
| 284 | Ga0123355_10000614 | 3300009826 | Bacteria | 48126 |
| 285 | Ga0123355_10039935 | 3300009826 | Bacteria | 7638 |
| 286 | Ga0123355_10095732 | 3300009826 | Bacteria | 4691 |
| 287 | Ga0123355_10187006 | 3300009826 | Unclassified | 3060 |
| 288 | Ga0123355_10378933 | 3300009826 | Bacteria | 1845 |
| 289 | Ga0123355_10489280 | 3300009826 | Bacteria | 1525 |
| 290 | Ga0123355_10543570 | 3300009826 | Unclassified | 1408 |
| 291 | Ga0123356_10115534 | 3300010049 | Bacteria | 2600 |
| 292 | Ga0123356_10117235 | 3300010049 | Bacteria | 2583 |
| 293 | Ga0123356_10121102 | 3300010049 | Bacteria | 2545 |
| 294 | Ga0123356_10149678 | 3300010049 | Bacteria | 2315 |
| 295 | Ga0123356_10151166 | 3300010049 | Bacteria | 2305 |
| 296 | Ga0123356_10296945 | 3300010049 | Bacteria | 1719 |
| 297 | Ga0123356_10340480 | 3300010049 | Unclassified | 1620 |
| 298 | Ga0123356_10685787 | 3300010049 | Bacteria | 1193 |
| 299 | Ga0123353_10004835 | 3300010167 | Bacteria | 17501 |
| 300 | Ga0123353_10054394 | 3300010167 | Bacteria | 6401 |
| 301 | Ga0123353_10064883 | 3300010167 | Bacteria | 5861 |
| 302 | Ga0123353_10088684 | 3300010167 | Bacteria | 4981 |
| 303 | Ga0123353_10437606 | 3300010167 | Unclassified | 1930 |
| 304 | Ga0123353_10621558 | 3300010167 | Bacteria | 1538 |
| 305 | Ga0123354_10284414 | 3300010882 | Bacteria | 1599 |
| 306 | Ga0466706_122046 | 3300042599 | Bacteria | 228896 |
| 307 | Ga0466707_085909 | 3300042601 | Bacteria | 2725 |
| 308 | Ga0466714_147125 | 3300042603 | Bacteria | 3305 |
| 309 | Ga0160472_100413 | 3300012839 | Unclassified | 33974 |
| 310 | Ga0160433_101829 | 3300012846 | Unclassified | 5234 |
| 311 | Ga0265387_1000003 | 3300024582 | Bacteria | 117657 |
| 312 | Ga0415639_001415 | 3300038395 | Bacteria | 5112 |
| 313 | Ga0466693_125830 | 3300042592 | Bacteria | 1551 |
| 314 | Ga0466695_312812 | 3300042595 | Bacteria | 44402 |
| 315 | Ga0466695_319565 | 3300042595 | Bacteria | 9846 |
| 316 | Ga0466699_163687 | 3300042597 | Bacteria | 2151 |
| 317 | Ga0466730_019458 | 3300042625 | Bacteria | 29293 |
| 318 | Ga0466724_40758 | 3300042649 | Bacteria | 20805 |
| 319 | Ga0466724_51021 | 3300042649 | Unclassified | 3692 |
| 320 | Ga0466725_158215 | 3300042654 | Bacteria | 2272 |
| 321 | Ga0466723_153203 | 3300042618 | Bacteria | 2484 |
| 322 | Ga0466729_117408 | 3300042621 | Bacteria | 3448 |
| 323 | Ga0466729_196421 | 3300042621 | Bacteria | 1547 |
| 324 | 2227080775 | 2225789004 | Bacteria | 185106 |
| 325 | JGI24698J34947_10012126 | 3300002449 | Unclassified | 4730 |
| 326 | JGI24695J34938_10000484 | 3300002450 | Bacteria | 38685 |
| 327 | JGI24695J34938_10007973 | 3300002450 | Bacteria | 6112 |
| 328 | JGI24702J35022_10019784 | 3300002462 | Bacteria | 3661 |
| 329 | Ga0072941_1146304 | 3300005201 | Bacteria | 2032 |
| 330 | Ga0102734_1002186 | 3300007129 | Bacteria | 5310 |
| 331 | Ga0103260_1001337 | 3300007139 | Unclassified | 4451 |
| 332 | Ga0102738_1000006 | 3300007141 | Bacteria | 337081 |
| 333 | Ga0102738_1004169 | 3300007141 | Unclassified | 2076 |
| 334 | Ga0102737_1000142 | 3300007142 | Bacteria | 23233 |
| 335 | Ga0102737_1000593 | 3300007142 | Unclassified | 18581 |
| 336 | Ga0103264_1000356 | 3300007188 | Bacteria | 26261 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.